Citrus Sinensis ID: 025364

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNKHV
cccccHHHHHHHHHHHHHHHHHHccccccEEEEEccEEEccccccccccccEEEccccccccccccccccccccHHHHHccccccHHHHHHHccccccHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHEEEcccc
cccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEccccEEEEcccEEEEEccEEEcccHHHEccccccccHHHccccccccEEEEEEccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHccEEEEEEcccc
MNQGKLEECKDFFRTLYSFIYLLGthlkphvailngvtmgggagvsipgtfrvacgktvfatpetligfhpdagasfylshlpghLGEFLALTGAKLNGAEMMACGLAThysvseklPLIEEELgklvtddpsVIEACLEKYsdlvypdknsvihridivdkcfglDTVEEIIDSLESeaslindpwcgsTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRlisgdfyevsnfqilnkhv
mnqgkleeCKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKvslrsiregrfqtfdeclvREYRMSLQGVSRlisgdfyevsnfqilnkhv
MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNKHV
*******ECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQIL****
*****LEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEK*************HRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNKHV
MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNKHV
**QGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVSNFQILNKHV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q8RXN4409 3-hydroxyisobutyryl-CoA h yes no 0.992 0.616 0.630 4e-94
Q5XF59401 3-hydroxyisobutyryl-CoA h no no 0.988 0.625 0.681 1e-91
Q6NMB0378 Probable 3-hydroxyisobuty no no 0.956 0.642 0.497 3e-65
Q9LKJ1378 3-hydroxyisobutyryl-CoA h no no 0.956 0.642 0.481 2e-64
Q1PEY5378 Probable 3-hydroxyisobuty no no 0.984 0.661 0.472 1e-62
Q9SHJ8387 3-hydroxyisobutyryl-CoA h no no 0.948 0.622 0.431 3e-55
Q6NVY1386 3-hydroxyisobutyryl-CoA h yes no 0.885 0.582 0.412 5e-42
Q8QZS1385 3-hydroxyisobutyryl-CoA h yes no 0.854 0.563 0.392 1e-41
Q28FR6385 3-hydroxyisobutyryl-CoA h yes no 0.925 0.610 0.374 2e-40
Q5XIE6385 3-hydroxyisobutyryl-CoA h yes no 0.850 0.561 0.390 2e-40
>sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 Back     alignment and function desciption
 Score =  344 bits (882), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 207/252 (82%)

Query: 1   MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVF 60
           +N+G  EE K FF  LY F+YL GT+LKP++AI++GVTMG G G+S+PG FRVA  KTV 
Sbjct: 111 INEGNTEESKLFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFRVATDKTVL 170

Query: 61  ATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLI 120
           A PE  IGFHPDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLI
Sbjct: 171 AHPEVQIGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLI 230

Query: 121 EEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEA 180
           EE +GKL+TDDP+VIE  L +Y DLVYPD +SV+H+I+++DK FGLDTVEEII+++E+EA
Sbjct: 231 EERIGKLLTDDPAVIEDSLAQYGDLVYPDSSSVLHKIELIDKYFGLDTVEEIIEAMENEA 290

Query: 181 SLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGD 240
           +   + WC  TL+ +KEASPLSLK++L+SIREGRFQT D+CL  EYR+S+ GVS+++SGD
Sbjct: 291 ANSCNEWCKKTLKQIKEASPLSLKITLQSIREGRFQTLDQCLTHEYRISICGVSKVVSGD 350

Query: 241 FYEVSNFQILNK 252
           F E    ++++K
Sbjct: 351 FCEGIRARLVDK 362

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 Back     alignment and function description
>sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 Back     alignment and function description
>sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 Back     alignment and function description
>sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHJ8|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=2 SV=2 Back     alignment and function description
>sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 Back     alignment and function description
>sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 Back     alignment and function description
>sp|Q28FR6|HIBCH_XENTR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 Back     alignment and function description
>sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
255541138 415 catalytic, putative [Ricinus communis] g 0.992 0.607 0.761 1e-112
357512817 378 3-hydroxyisobutyryl-CoA hydrolase-like p 1.0 0.671 0.716 1e-105
357512815 401 3-hydroxyisobutyryl-CoA hydrolase-like p 1.0 0.633 0.716 1e-105
356504605 407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.992 0.619 0.714 1e-105
224136292 415 predicted protein [Populus trichocarpa] 0.992 0.607 0.757 1e-103
225453474 405 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.992 0.622 0.710 1e-101
225430480 407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.992 0.619 0.682 1e-100
326507476 424 predicted protein [Hordeum vulgare subsp 0.992 0.594 0.690 1e-97
449442604 406 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.992 0.620 0.706 6e-97
242035143 406 hypothetical protein SORBIDRAFT_01g02960 0.992 0.620 0.678 2e-96
>gi|255541138|ref|XP_002511633.1| catalytic, putative [Ricinus communis] gi|223548813|gb|EEF50302.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/252 (76%), Positives = 225/252 (89%)

Query: 1   MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVF 60
           + +GKLE+CK+FFRTLY+FIY+LGT+LKPHVAIL+G+TMGGGAGVSIPGTFR+A  KTVF
Sbjct: 117 VKKGKLEDCKEFFRTLYTFIYILGTYLKPHVAILDGITMGGGAGVSIPGTFRIATDKTVF 176

Query: 61  ATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLI 120
           ATPETLIGFHPDAGASF+LSHLPGHLGE+LALTG  LNG EM+ACGLATHYS SE+L LI
Sbjct: 177 ATPETLIGFHPDAGASFHLSHLPGHLGEYLALTGETLNGVEMIACGLATHYSYSERLQLI 236

Query: 121 EEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEA 180
           +++LG+LVTDDPSVIEA LEKY DLV+PDK S +HRI+ VD+CFG DTVEEI ++LESEA
Sbjct: 237 DQQLGQLVTDDPSVIEATLEKYGDLVHPDKMSALHRIETVDRCFGYDTVEEIFEALESEA 296

Query: 181 SLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGD 240
           S  ND +C STLR LKEASPLSLKVSLRSIREGRFQT D+CLVREYRMSLQG+S+ IS D
Sbjct: 297 SGTNDAFCNSTLRRLKEASPLSLKVSLRSIREGRFQTLDQCLVREYRMSLQGISKQISND 356

Query: 241 FYEVSNFQILNK 252
           FYE    +++++
Sbjct: 357 FYEGVRARMVDR 368

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357512817|ref|XP_003626697.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355520719|gb|AET01173.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357512815|ref|XP_003626696.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355520718|gb|AET01172.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356504605|ref|XP_003521086.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|224136292|ref|XP_002326825.1| predicted protein [Populus trichocarpa] gi|222835140|gb|EEE73575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225453474|ref|XP_002274299.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial [Vitis vinifera] gi|297734569|emb|CBI16620.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225430480|ref|XP_002283319.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial [Vitis vinifera] gi|296082135|emb|CBI21140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|326507476|dbj|BAK03131.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|449442604|ref|XP_004139071.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|242035143|ref|XP_002464966.1| hypothetical protein SORBIDRAFT_01g029600 [Sorghum bicolor] gi|241918820|gb|EER91964.1| hypothetical protein SORBIDRAFT_01g029600 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:2116797409 AT4G31810 [Arabidopsis thalian 0.992 0.616 0.630 1.3e-86
TAIR|locus:2054437378 AT2G30660 [Arabidopsis thalian 0.992 0.666 0.484 8.1e-60
TAIR|locus:2152069378 CHY1 "beta-hydroxyisobutyryl-C 0.956 0.642 0.481 2.5e-58
TAIR|locus:2054517378 AT2G30650 [Arabidopsis thalian 0.984 0.661 0.472 6.6e-58
TAIR|locus:2009180387 AT1G06550 [Arabidopsis thalian 0.948 0.622 0.431 7.2e-52
UNIPROTKB|Q6NVY1386 HIBCH "3-hydroxyisobutyryl-CoA 0.921 0.606 0.401 2.2e-41
FB|FBgn0038326386 CG5044 [Drosophila melanogaste 0.937 0.616 0.38 2.6e-40
MGI|MGI:1923792385 Hibch "3-hydroxyisobutyryl-Coe 0.929 0.612 0.382 2.3e-39
UNIPROTKB|F1MPK4387 F1MPK4 "Uncharacterized protei 0.929 0.609 0.386 3.7e-39
UNIPROTKB|Q2HJ73386 HIBCH "3-hydroxyisobutyryl-CoA 0.929 0.611 0.386 3.7e-39
TAIR|locus:2116797 AT4G31810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 866 (309.9 bits), Expect = 1.3e-86, P = 1.3e-86
 Identities = 159/252 (63%), Positives = 207/252 (82%)

Query:     1 MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVF 60
             +N+G  EE K FF  LY F+YL GT+LKP++AI++GVTMG G G+S+PG FRVA  KTV 
Sbjct:   111 INEGNTEESKLFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFRVATDKTVL 170

Query:    61 ATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLI 120
             A PE  IGFHPDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLI
Sbjct:   171 AHPEVQIGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLI 230

Query:   121 EEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEA 180
             EE +GKL+TDDP+VIE  L +Y DLVYPD +SV+H+I+++DK FGLDTVEEII+++E+EA
Sbjct:   231 EERIGKLLTDDPAVIEDSLAQYGDLVYPDSSSVLHKIELIDKYFGLDTVEEIIEAMENEA 290

Query:   181 SLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGD 240
             +   + WC  TL+ +KEASPLSLK++L+SIREGRFQT D+CL  EYR+S+ GVS+++SGD
Sbjct:   291 ANSCNEWCKKTLKQIKEASPLSLKITLQSIREGRFQTLDQCLTHEYRISICGVSKVVSGD 350

Query:   241 FYEVSNFQILNK 252
             F E    ++++K
Sbjct:   351 FCEGIRARLVDK 362
GO:0003824 "catalytic activity" evidence=IEA
GO:0003860 "3-hydroxyisobutyryl-CoA hydrolase activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2054437 AT2G30660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152069 CHY1 "beta-hydroxyisobutyryl-CoA hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054517 AT2G30650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009180 AT1G06550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NVY1 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0038326 CG5044 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1923792 Hibch "3-hydroxyisobutyryl-Coenzyme A hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPK4 F1MPK4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ73 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RXN4HIBC5_ARATH3, ., 1, ., 2, ., -0.63090.99210.6161yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.20.766
3rd Layer3.1.2.40.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.40.97.1
hypothetical protein (381 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VIII0916
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
  •  • •0.907
grail3.0006050201
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
  •  • •0.907
estExt_fgenesh4_pg.C_LG_VI1023
SubName- Full=Putative uncharacterized protein; (380 aa)
  •  • •0.907
eugene3.00013051
hypothetical protein (348 aa)
••   •  0.900

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
PLN02851407 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol 1e-141
PLN02157401 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol 1e-125
PLN02874379 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol 5e-98
PLN02988381 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol 1e-80
PRK05617342 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol 5e-72
pfam13766117 pfam13766, ECH_C, 2-enoyl-CoA Hydratase C-terminal 5e-28
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 2e-20
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 2e-18
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 7e-09
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 5e-07
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 7e-07
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 1e-06
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 3e-06
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 7e-06
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 2e-05
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 4e-05
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 7e-05
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 9e-05
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 1e-04
PRK06072248 PRK06072, PRK06072, enoyl-CoA hydratase; Provision 1e-04
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 3e-04
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 4e-04
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 5e-04
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 7e-04
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 8e-04
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 0.003
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 0.003
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 0.004
>gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information 
 Score =  401 bits (1032), Expect = e-141
 Identities = 166/243 (68%), Positives = 204/243 (83%)

Query: 1   MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVF 60
           +N+G +EECK FF  LY F+YL GT+LKP+VAI++G+TMG GAG+SIPG FRV   KTVF
Sbjct: 112 INEGNVEECKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVF 171

Query: 61  ATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLI 120
           A PE  +GFHPDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLI
Sbjct: 172 AHPEVQMGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLI 231

Query: 121 EEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEA 180
           EE LGKL+TDDP+VIE  L +Y DLVYPDK+SV+H+I+ +DKCFG DTVEEII++LE+EA
Sbjct: 232 EERLGKLLTDDPAVIEDSLAQYGDLVYPDKSSVLHKIETIDKCFGHDTVEEIIEALENEA 291

Query: 181 SLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGD 240
           +   D WC   L+ +KEASPLSLKV+L+SIREGRFQT D+CL REYR+SL GVS+ +SGD
Sbjct: 292 ASSYDEWCKKALKKIKEASPLSLKVTLQSIREGRFQTLDQCLAREYRISLCGVSKWVSGD 351

Query: 241 FYE 243
           F E
Sbjct: 352 FCE 354

Length = 407
>gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|205939 pfam13766, ECH_C, 2-enoyl-CoA Hydratase C-terminal region Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
KOG1684401 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PLN02988381 3-hydroxyisobutyryl-CoA hydrolase 100.0
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
PRK08321302 naphthoate synthase; Validated 100.0
PLN02921327 naphthoate synthase 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.97
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 99.97
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.97
PRK05869222 enoyl-CoA hydratase; Validated 99.97
PRK08788287 enoyl-CoA hydratase; Validated 99.97
PRK06213229 enoyl-CoA hydratase; Provisional 99.97
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 99.97
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.97
PRK08290288 enoyl-CoA hydratase; Provisional 99.96
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.96
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 99.95
PRK08272302 enoyl-CoA hydratase; Provisional 99.95
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.95
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 99.95
PLN02267239 enoyl-CoA hydratase/isomerase family protein 99.94
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 99.92
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 99.91
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.89
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 99.89
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.89
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.69
PF13766118 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD 99.67
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.55
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.44
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.14
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 98.96
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 98.95
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 98.9
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 98.81
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 98.73
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 98.67
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.38
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.35
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.27
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.25
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.24
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.24
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.16
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.12
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.1
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.09
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.05
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.04
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.01
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 97.98
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 97.96
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 97.91
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 97.87
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 97.78
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 97.65
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 97.64
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 97.63
PRK07189301 malonate decarboxylase subunit beta; Reviewed 97.48
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.38
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.29
PRK11778330 putative inner membrane peptidase; Provisional 97.12
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 97.07
PRK10949618 protease 4; Provisional 97.05
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 96.99
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 96.81
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 96.73
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 96.64
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 96.64
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 96.57
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.27
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 95.34
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 95.24
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 95.19
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 95.18
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 95.03
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 94.98
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 94.65
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 93.29
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 92.15
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 92.03
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 91.51
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 91.46
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information 
Probab=100.00  E-value=4.4e-48  Score=351.45  Aligned_cols=248  Identities=67%  Similarity=1.137  Sum_probs=222.4

Q ss_pred             hHHHHHHHHHHHHHHHHHhhCCCcEEEEEccccccHHHHhhhhCCeEEEeCCceEeccccccCCCCCccHHHHHhccChH
Q 025364            6 LEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGH   85 (254)
Q Consensus         6 ~~~~~~~~~~~~~l~~~i~~~~kPvIa~v~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~P~~g~~~~l~r~~g~   85 (254)
                      .+...+|+..+|++++.|.++|||+||++||+|+|||++|+++||+|||+++++|++||+++|++|++|++++|+|++|.
T Consensus       117 ~~~~~~~f~~~~~l~~~i~~~pKPvIA~v~G~amGGG~gLal~~D~rVate~a~famPE~~iGl~PdvG~s~~L~rl~g~  196 (407)
T PLN02851        117 VEECKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGFHPDAGASYYLSRLPGY  196 (407)
T ss_pred             hHHHHHHHHHHHHHHHHHHhCCCCEEEEEcCEEeeHHHHHHHhCCEEEEeCCceEecchhccCCCCCccHHHHHHHhcCH
Confidence            35677899999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HHHHHHhcCCCCCHHHHHhcCcchhhcccCChHHHHHHHhhccCCChHHHHHHHHHhccccCCCcchhHhHHHHHHHhcC
Q 025364           86 LGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFG  165 (254)
Q Consensus        86 ~a~~l~ltg~~i~a~ea~~~Glv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (254)
                      .+.||+|||++++++||+++||+|+++++++++.+.+.+.++.+.++..+...+++|.....+...........|++||+
T Consensus       197 ~g~~L~LTG~~i~a~eA~~~GLa~~~v~~~~l~~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~I~~~F~  276 (407)
T PLN02851        197 LGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERLGKLLTDDPAVIEDSLAQYGDLVYPDKSSVLHKIETIDKCFG  276 (407)
T ss_pred             HHHHHHHhCCcCCHHHHHHCCCceeecCHhhHHHHHHHHHhhccCCHHHHHHHHHHhccccCCCcccHHHHHHHHHHHhC
Confidence            89999999999999999999999999999999888888887777778888888888864422222344555789999999


Q ss_pred             CCCHHHHHHHHHhccccCCChHHHHHHHHHHhcCchHHHHHHHHHHhcccCCHHHHHHHHHHHHHHhhhcCCCCChhhhh
Q 025364          166 LDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEVS  245 (254)
Q Consensus       166 ~~~~~~i~~~l~~~~~~~~~~~a~~~~~~i~~~~p~a~~~~k~~l~~~~~~~~~~~l~~e~~~~~~~~~~~~~~d~~eg~  245 (254)
                      .+++++|++.|+...++..++|++++++.|.+.||.|+++|++++++++.++++++++.|+++..+++....++||.|||
T Consensus       277 ~~sv~~I~~~L~~~~~~~~~~wa~~~~~~l~~~SP~Sl~vt~~~~~~~~~~sl~e~l~~E~~l~~~~~~~~~~~DF~EGV  356 (407)
T PLN02851        277 HDTVEEIIEALENEAASSYDEWCKKALKKIKEASPLSLKVTLQSIREGRFQTLDQCLAREYRISLCGVSKWVSGDFCEGV  356 (407)
T ss_pred             CCCHHHHHHHHHhcccccchHHHHHHHHHHHhcCcHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHhcCccchHHHHH
Confidence            99999999999975333357999999999999999999999999999999999999999999999887211279999999


Q ss_pred             hheeccCC
Q 025364          246 NFQILNKH  253 (254)
Q Consensus       246 ~afl~~k~  253 (254)
                      +|.|+||+
T Consensus       357 RA~LIDKd  364 (407)
T PLN02851        357 RARLVDKD  364 (407)
T ss_pred             HHHhcCCC
Confidence            99999997

>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
3bpt_A363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 5e-42
4hdt_A353 Crystal Structure Of A Carnitinyl-Coa Dehydratase F 5e-24
4j2u_A365 Crystal Structure Of An Enoyl-coa Hydratase From Rh 6e-17
3ju1_A407 Crystal Structure Of Enoyl-Coa HydrataseISOMERASE F 7e-13
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 6e-07
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 1e-05
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 4e-05
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 4e-05
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 3e-04
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 3e-04
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 4e-04
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 4e-04
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 5e-04
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 6e-04
1wdk_A 715 Fatty Acid Beta-Oxidation Multienzyme Complex From 6e-04
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/235 (40%), Positives = 139/235 (59%), Gaps = 10/235 (4%)
Query: 12  FFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHP 71
           FFR  Y     +G+  KP+VA+++G+T GGG G+S+ G FRVA  K +FA PET IG  P
Sbjct: 87  FFREEYXLNNAVGSCQKPYVALIHGITXGGGVGLSVHGQFRVATEKCLFAXPETAIGLFP 146
Query: 72  DAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDD 131
           D G  ++L  L G LG FLALTG +L G ++   G+ATH+  SEKL  +EE+L  L +  
Sbjct: 147 DVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAXLEEDLLALKSPS 206
Query: 132 PSVIEACLEKY--SDLVYPDKNSVIHR-IDIVDKCFGLDTVEEIIDSLESEASLINDPWC 188
              I + LE Y     +  DK+ ++    D ++ CF  +TVEEII++L+ + S     + 
Sbjct: 207 KENIASVLENYHTESKIDRDKSFILEEHXDKINSCFSANTVEEIIENLQQDGS----SFA 262
Query: 189 GSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYE 243
              L+++ + SP SLK++LR + EG  +T  E L  EYR+S Q   R    DF+E
Sbjct: 263 LEQLKVINKXSPTSLKITLRQLXEGSSKTLQEVLTXEYRLS-QACXR--GHDFHE 314
>pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 Back     alignment and structure
>pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 Back     alignment and structure
>pdb|3JU1|A Chain A, Crystal Structure Of Enoyl-Coa HydrataseISOMERASE FAMILY PROTEIN Length = 407 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 1e-100
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 7e-95
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 1e-11
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-11
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 1e-11
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 1e-10
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 2e-10
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 3e-10
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 3e-10
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 6e-10
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 7e-10
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 8e-10
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 1e-09
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 2e-09
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 2e-09
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 2e-09
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 3e-09
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 6e-09
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 6e-09
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 7e-09
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 1e-08
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 5e-08
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 7e-08
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 2e-07
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 6e-07
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 1e-06
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 2e-06
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 2e-06
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 3e-06
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 7e-06
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 7e-06
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 9e-06
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 9e-06
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 1e-05
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 2e-05
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 2e-05
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 2e-05
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 2e-05
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 2e-05
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 3e-05
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 3e-05
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 3e-05
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 4e-05
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 4e-05
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 4e-05
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 7e-05
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 8e-05
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 1e-04
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 1e-04
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 1e-04
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 2e-04
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 2e-04
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 2e-04
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 3e-04
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 3e-04
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 3e-04
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 3e-04
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 5e-04
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 5e-04
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 7e-04
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure
 Score =  295 bits (757), Expect = e-100
 Identities = 94/246 (38%), Positives = 141/246 (57%), Gaps = 10/246 (4%)

Query: 1   MNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVF 60
             + K +    FFR  Y     +G+  KP+VA+++G+TMGGG G+S+ G FRVA  K +F
Sbjct: 76  AEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLF 135

Query: 61  ATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLI 120
           A PET IG  PD G  ++L  L G LG FLALTG +L G ++   G+ATH+  SEKL ++
Sbjct: 136 AMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAML 195

Query: 121 EEELGKLVTDDPSVIEACLEKYSDLVYPDKNS---VIHRIDIVDKCFGLDTVEEIIDSLE 177
           EE+L  L +     I + LE Y      D++    +   +D ++ CF  +TVEEII++L+
Sbjct: 196 EEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQ 255

Query: 178 SEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLI 237
            +       +    L+++ + SP SLK++LR + EG  +T  E L  EYR+S   +    
Sbjct: 256 QDG----SSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRG-- 309

Query: 238 SGDFYE 243
             DF+E
Sbjct: 310 -HDFHE 314
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.97
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.97
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 99.97
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 99.97
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.97
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 99.97
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 99.97
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 99.93
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.51
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.48
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.46
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.36
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.34
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.34
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.03
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 98.62
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.25
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.24
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.11
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.06
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 97.99
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 97.9
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 97.35
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 97.31
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 97.15
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 97.07
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.06
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 96.97
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 96.8
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 96.78
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 96.63
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 96.59
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.19
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 95.91
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 95.65
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 95.42
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 94.99
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 94.94
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 94.64
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 94.29
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 93.84
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 93.14
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 92.53
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 92.22
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 90.22
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltrans 87.63
2x24_A793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 83.52
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
Probab=100.00  E-value=5.3e-45  Score=327.58  Aligned_cols=233  Identities=33%  Similarity=0.548  Sum_probs=204.9

Q ss_pred             ChHHHHHHHHHHHHHHHHHhhCCCcEEEEEccccccHHHHhhhhCCeEEEeCCceEeccccccCCCCCccHHHHHhccCh
Q 025364            5 KLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPG   84 (254)
Q Consensus         5 ~~~~~~~~~~~~~~l~~~i~~~~kPvIa~v~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~P~~g~~~~l~r~~g   84 (254)
                      +......++...++++..|.++||||||+|||+|+|||++|+++||+|||+++++|++||+++|++|++|++++|+|++|
T Consensus        83 ~~~~~~~~~~~~~~~~~~i~~~~kPvIAav~G~a~GgG~~lal~cD~ria~~~a~f~~pe~~iGl~p~~g~~~~l~rl~g  162 (353)
T 4hdt_A           83 DGAEARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPG  162 (353)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHHCSSCEEEEECBEEETHHHHHHTTSSEEEECTTCEEECCGGGGTCCCCTTHHHHHHTSST
T ss_pred             hhHHHHHHHHHHHHHHHHHHHCCCCEEEEeECceeecCccccCCcCeeccchhccccCcccccccCCCccceehhhhhhh
Confidence            44567788899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCCHHHHHhcCcchhhcccCChHHHHHHHhhccCCChHHHHHHHHHhccccCCCcchhHhHHHHHHHhc
Q 025364           85 HLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCF  164 (254)
Q Consensus        85 ~~a~~l~ltg~~i~a~ea~~~Glv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (254)
                      ..+++|+|||++++++||+++||||++|+++++++..+.+...      .+......+...  ............|++||
T Consensus       163 ~~a~~l~ltG~~i~A~eA~~~GLv~~vv~~~~l~~~a~~la~~------~~~~~l~~~~~~--~~~~~l~~~~~~i~~~f  234 (353)
T 4hdt_A          163 KLGLHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIAD------GVDAALAAHAQE--PPASPLAEQRSWIDECY  234 (353)
T ss_dssp             THHHHHHHHCCCBCHHHHHHHTSCSEECCGGGHHHHHHHHHHH------CHHHHHHHHCBC--CCCCHHHHTHHHHHHHT
T ss_pred             HHHHHHHhcCCCCCHHHHHHcCCCcEEeCHHHHHHHHHHHHHh------chhHHHHHhccc--CCccchHHHHHHHHHHh
Confidence            7799999999999999999999999999999998777666321      122233333332  33445666789999999


Q ss_pred             CCCCHHHHHHHHHhccccCCChHHHHHHHHHHhcCchHHHHHHHHHHhcccC-CHHHHHHHHHHHHHHhhhcCCCCChhh
Q 025364          165 GLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQ-TFDECLVREYRMSLQGVSRLISGDFYE  243 (254)
Q Consensus       165 ~~~~~~~i~~~l~~~~~~~~~~~a~~~~~~i~~~~p~a~~~~k~~l~~~~~~-~~~~~l~~e~~~~~~~~~~~~~~d~~e  243 (254)
                      +.+++++|++.|+..    ..+|+.++++.|+++||.|++++|++++++.+. +++++++.|.+++..++.   ++|++|
T Consensus       235 ~~~~~~~i~~~L~~~----~~~~a~~~a~~la~~sP~a~~~~k~~l~~~~~~~sl~e~l~~E~~~~~~~~~---s~D~~E  307 (353)
T 4hdt_A          235 TGDTVADIIAALRAH----DAPAAGEAADLIATRSPIALSVTLESVRRAAKLQSLEDTLRQEYRVSCASLK---SHDLVE  307 (353)
T ss_dssp             TCSSHHHHHHHHHHH----CSHHHHHHHHHHTTSCHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHTT---CHHHHH
T ss_pred             CCCCHHHHHHHHHhc----ccHHHHHHHHHHHhcCcHHHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHhC---CchHHH
Confidence            999999999999975    678999999999999999999999999999875 899999999999999998   999999


Q ss_pred             hhhhee--ccC
Q 025364          244 VSNFQI--LNK  252 (254)
Q Consensus       244 g~~afl--~~k  252 (254)
                      ||+|||  +||
T Consensus       308 GvrAfl~dekR  318 (353)
T 4hdt_A          308 GIRAQLVDKDR  318 (353)
T ss_dssp             HHHHHHC----
T ss_pred             HHhhhhhCcCC
Confidence            999999  554
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 4e-16
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 3e-06
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 73.3 bits (179), Expect = 4e-16
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 1/100 (1%)

Query: 8   ECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLI 67
               +     S    +    KP +A +NG  +GGG  +++      A  K  F  PE L+
Sbjct: 78  FQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILL 137

Query: 68  GFHPDAGASFYLSHLPGH-LGEFLALTGAKLNGAEMMACG 106
           G  P AG +  L+   G  L   + LTG +++  +    G
Sbjct: 138 GTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAG 177
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 99.98
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.97
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 99.96
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 98.15
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 98.05
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 98.04
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 98.04
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 97.99
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 97.65
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.15
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.15
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.72
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 96.56
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 96.41
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 96.36
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 95.34
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 95.08
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 95.0
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 94.97
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 93.27
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 91.21
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: AUH protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.5e-39  Score=277.57  Aligned_cols=184  Identities=20%  Similarity=0.204  Sum_probs=170.3

Q ss_pred             CChHHHHHHHHHHHHHHHHHhhCCCcEEEEEccccccHHHHhhhhCCeEEEeCCceEeccccccCCCCCccHHHHHhccC
Q 025364            4 GKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLP   83 (254)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~i~~~~kPvIa~v~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~P~~g~~~~l~r~~   83 (254)
                      .+......+.+.+++++..|.++||||||+|||+|+|||++|+++||+|||+++++|++||+++|++|++|+++++++++
T Consensus        76 ~~~~~~~~~~~~~~~~~~~i~~~~kpvIaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~G~~p~~g~~~~l~~~i  155 (266)
T d1hzda_          76 MSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAI  155 (266)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHTCSSCEEEEESEEEETHHHHHHHHSSEEEEETTCEEECCGGGGTCCCCSSHHHHHHHHH
T ss_pred             ccchhhhhhhhHHHHHHHHHhcCCcccccccccccccccceeccccceeeecCCcEEeecccceeecCCccceeeehhhh
Confidence            44566778899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHH-HHHHHhcCCCCCHHHHHhcCcchhhcccCChHHHHHHHhhccCCChHHHHHHHHHhccccCCCcchhHhHHHHHHH
Q 025364           84 GHL-GEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDK  162 (254)
Q Consensus        84 g~~-a~~l~ltg~~i~a~ea~~~Glv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (254)
                      |.. +.++++||+.+++++|+++||||++++++++.+...                                        
T Consensus       156 g~~~a~~l~ltg~~~~a~eA~~~Glv~~vv~~~~l~~~~~----------------------------------------  195 (266)
T d1hzda_         156 GMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAY----------------------------------------  195 (266)
T ss_dssp             CHHHHHHHHHHTCEEEHHHHHHHTSCSEEECCCTTSCHHH----------------------------------------
T ss_pred             HHHHHHhhhccCCccCHHHhhcccccccccChhhhhhHHH----------------------------------------
Confidence            998 999999999999999999999999999888653222                                        


Q ss_pred             hcCCCCHHHHHHHHHhccccCCChHHHHHHHHHHhcCchHHHHHHHHHHhcccCCHHHHHHHHHHHHHHhhhcCCCCChh
Q 025364          163 CFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFY  242 (254)
Q Consensus       163 ~~~~~~~~~i~~~l~~~~~~~~~~~a~~~~~~i~~~~p~a~~~~k~~l~~~~~~~~~~~l~~e~~~~~~~~~~~~~~d~~  242 (254)
                                             ++|.+++++|+..||.+++.+|++++++...+++++++.|...+...+.   ++|++
T Consensus       196 -----------------------~~a~~~a~~i~~~~p~a~~~~K~~l~~~~~~~~~~~l~~e~~~~~~~~~---s~d~~  249 (266)
T d1hzda_         196 -----------------------RKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIP---TKDRL  249 (266)
T ss_dssp             -----------------------HHHHHHHHTTTTSCHHHHHHHHHHHHHHHTSCHHHHHHHHHHHHHTTTT---CHHHH
T ss_pred             -----------------------HHHHHHHHhcccCChHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhC---CHHHH
Confidence                                   3445678999999999999999999999999999999999999999987   99999


Q ss_pred             hhhhheeccCC
Q 025364          243 EVSNFQILNKH  253 (254)
Q Consensus       243 eg~~afl~~k~  253 (254)
                      ||++||++||+
T Consensus       250 Eg~~AF~eKR~  260 (266)
T d1hzda_         250 EGLLAFKEKRP  260 (266)
T ss_dssp             HHHHHHTTTSC
T ss_pred             HHHHHHhCCCC
Confidence            99999999985
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure