Citrus Sinensis ID: 025373

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
cHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccc
cHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDhmlsddvplVVSRQLLQTFAQELGRLEPETQKEIANYTLaqiqprvvsFEEQVLIIREKLADLYESEQQWSKAAQMLSgidldsgmrviddtfRLSKCVQIARLyledddavNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQiqkrqigdetIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYtlaqiqprvvSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLAtlykvnnh
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
******************EQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYK****
***ALA**************YKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKV***
************DQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
*****ASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKVNNH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q8L5U0 397 COP9 signalosome complex yes no 0.984 0.629 0.864 1e-124
Q68FS2 406 COP9 signalosome complex yes no 0.881 0.551 0.491 2e-54
O88544 406 COP9 signalosome complex yes no 0.881 0.551 0.495 2e-54
Q3SZA0 406 COP9 signalosome complex yes no 0.881 0.551 0.5 2e-54
A7Y521 406 COP9 signalosome complex yes no 0.881 0.551 0.5 2e-54
Q4R5E6 406 COP9 signalosome complex N/A no 0.881 0.551 0.5 2e-54
Q9BT78 406 COP9 signalosome complex yes no 0.881 0.551 0.5 2e-54
Q5R648 406 COP9 signalosome complex yes no 0.881 0.551 0.495 3e-54
Q6P0H6 406 COP9 signalosome complex yes no 0.881 0.551 0.482 6e-53
Q54B82 393 COP9 signalosome complex yes no 0.952 0.615 0.432 2e-50
>sp|Q8L5U0|CSN4_ARATH COP9 signalosome complex subunit 4 OS=Arabidopsis thaliana GN=CSN4 PE=1 SV=2 Back     alignment and function desciption
 Score =  445 bits (1144), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/250 (86%), Positives = 235/250 (94%)

Query: 1   MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
           M+ AL +ASAI DQRQKIEQYK ILSSV+SSND++QA++FIDH+LSDDVPLVVSRQLLQ+
Sbjct: 1   MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQS 60

Query: 61  FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
           FAQELGRLEPETQKEIA +TL QIQPRVVSFEEQ L+IREKLA LYESEQ+WSKAAQMLS
Sbjct: 61  FAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLS 120

Query: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
           GIDLDSGMR +DD F+LSKC+QIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct: 121 GIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYK 180

Query: 181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
           VCYARILD+KRKFLEAALRYY ISQI++RQIGDE IDE ALEQALSAAVTCTILA AGPQ
Sbjct: 181 VCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQ 240

Query: 241 RSRVLATLYK 250
           RSRVLATLYK
Sbjct: 241 RSRVLATLYK 250
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q68FS2|CSN4_RAT COP9 signalosome complex subunit 4 OS=Rattus norvegicus GN=Cops4 PE=2 SV=1 Back     alignment and function description
>sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 Back     alignment and function description
>sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|A7Y521|CSN4_PIG COP9 signalosome complex subunit 4 OS=Sus scrofa GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q4R5E6|CSN4_MACFA COP9 signalosome complex subunit 4 OS=Macaca fascicularis GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BT78|CSN4_HUMAN COP9 signalosome complex subunit 4 OS=Homo sapiens GN=COPS4 PE=1 SV=1 Back     alignment and function description
>sp|Q5R648|CSN4_PONAB COP9 signalosome complex subunit 4 OS=Pongo abelii GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q6P0H6|CSN4_DANRE COP9 signalosome complex subunit 4 OS=Danio rerio GN=cops4 PE=2 SV=1 Back     alignment and function description
>sp|Q54B82|CSN4_DICDI COP9 signalosome complex subunit 4 OS=Dictyostelium discoideum GN=csn4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
255538588 397 cop9 complex subunit, putative [Ricinus 0.984 0.629 0.96 1e-134
224129434 397 predicted protein [Populus trichocarpa] 0.984 0.629 0.952 1e-133
118483400 397 unknown [Populus trichocarpa] 0.984 0.629 0.94 1e-132
356531693 397 PREDICTED: COP9 signalosome complex subu 0.984 0.629 0.924 1e-129
356541824 397 PREDICTED: COP9 signalosome complex subu 0.984 0.629 0.924 1e-129
217074960335 unknown [Medicago truncatula] 0.984 0.746 0.904 1e-127
217073438 392 unknown [Medicago truncatula] 0.984 0.637 0.904 1e-126
225458329 397 PREDICTED: COP9 signalosome complex subu 0.937 0.599 0.928 1e-123
147780809 397 hypothetical protein VITISV_036371 [Viti 0.937 0.599 0.928 1e-123
5802627 397 COP8 [Arabidopsis thaliana] 0.984 0.629 0.864 1e-122
>gi|255538588|ref|XP_002510359.1| cop9 complex subunit, putative [Ricinus communis] gi|223551060|gb|EEF52546.1| cop9 complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 240/250 (96%), Positives = 247/250 (98%)

Query: 1   MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
           MESA ASASAITDQRQKIEQYKHIL+SVISSNDI QAKKFIDHMLSDDVPLVVSRQLLQ+
Sbjct: 1   MESAFASASAITDQRQKIEQYKHILASVISSNDIDQAKKFIDHMLSDDVPLVVSRQLLQS 60

Query: 61  FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
           FAQELGRLEP+TQKEIA+YTLAQIQPRVVSFEEQVLIIREKLA+LYESEQQWSKAAQMLS
Sbjct: 61  FAQELGRLEPDTQKEIAHYTLAQIQPRVVSFEEQVLIIREKLAELYESEQQWSKAAQMLS 120

Query: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
           GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSNSQHEVLNLQYK 180

Query: 181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
           VCYARILDLKRKFLEAALRYYDISQI+KRQIGDETIDEEALEQALSAAVTCTILAAAGPQ
Sbjct: 181 VCYARILDLKRKFLEAALRYYDISQIEKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240

Query: 241 RSRVLATLYK 250
           RSRVLATLYK
Sbjct: 241 RSRVLATLYK 250

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129434|ref|XP_002320585.1| predicted protein [Populus trichocarpa] gi|222861358|gb|EEE98900.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118483400|gb|ABK93600.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531693|ref|XP_003534411.1| PREDICTED: COP9 signalosome complex subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356541824|ref|XP_003539372.1| PREDICTED: COP9 signalosome complex subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|217074960|gb|ACJ85840.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217073438|gb|ACJ85078.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225458329|ref|XP_002283011.1| PREDICTED: COP9 signalosome complex subunit 4 [Vitis vinifera] gi|302142470|emb|CBI19673.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147780809|emb|CAN77214.1| hypothetical protein VITISV_036371 [Vitis vinifera] Back     alignment and taxonomy information
>gi|5802627|gb|AAD51742.1|AF176089_1 COP8 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
TAIR|locus:2159961 397 COP8 "AT5G42970" [Arabidopsis 0.984 0.629 0.864 1e-109
RGD|1302952 406 Cops4 "COP9 signalosome subuni 0.881 0.551 0.495 1.9e-51
UNIPROTKB|Q3SZA0 406 COPS4 "COP9 signalosome comple 0.881 0.551 0.504 3.1e-51
MGI|MGI:1349414 406 Cops4 "COP9 (constitutive phot 0.881 0.551 0.5 3.1e-51
UNIPROTKB|E2RT55 406 COPS4 "Uncharacterized protein 0.881 0.551 0.504 4e-51
UNIPROTKB|D6RAX7 420 COPS4 "COP9 signalosome comple 0.881 0.533 0.504 4e-51
UNIPROTKB|Q9BT78 406 COPS4 "COP9 signalosome comple 0.881 0.551 0.504 4e-51
UNIPROTKB|A7Y521 406 COPS4 "COP9 signalosome comple 0.881 0.551 0.504 4e-51
UNIPROTKB|Q5ZJV0 411 COPS4 "Uncharacterized protein 0.881 0.545 0.5 6.5e-51
ZFIN|ZDB-GENE-030131-4317 406 cops4 "COP9 constitutive photo 0.881 0.551 0.487 2.2e-50
TAIR|locus:2159961 COP8 "AT5G42970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1084 (386.6 bits), Expect = 1.0e-109, P = 1.0e-109
 Identities = 216/250 (86%), Positives = 235/250 (94%)

Query:     1 MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
             M+ AL +ASAI DQRQKIEQYK ILSSV+SSND++QA++FIDH+LSDDVPLVVSRQLLQ+
Sbjct:     1 MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQS 60

Query:    61 FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
             FAQELGRLEPETQKEIA +TL QIQPRVVSFEEQ L+IREKLA LYESEQ+WSKAAQMLS
Sbjct:    61 FAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLS 120

Query:   121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
             GIDLDSGMR +DD F+LSKC+QIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct:   121 GIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYK 180

Query:   181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
             VCYARILD+KRKFLEAALRYY ISQI++RQIGDE IDE ALEQALSAAVTCTILA AGPQ
Sbjct:   181 VCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQ 240

Query:   241 RSRVLATLYK 250
             RSRVLATLYK
Sbjct:   241 RSRVLATLYK 250
GO:0008180 "signalosome" evidence=IDA;TAS;IPI
GO:0009640 "photomorphogenesis" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010388 "cullin deneddylation" evidence=RCA;IMP
GO:0010971 "positive regulation of G2/M transition of mitotic cell cycle" evidence=IMP
GO:0043234 "protein complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
RGD|1302952 Cops4 "COP9 signalosome subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZA0 COPS4 "COP9 signalosome complex subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1349414 Cops4 "COP9 (constitutive photomorphogenic) homolog, subunit 4 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RT55 COPS4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RAX7 COPS4 "COP9 signalosome complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BT78 COPS4 "COP9 signalosome complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7Y521 COPS4 "COP9 signalosome complex subunit 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJV0 COPS4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4317 cops4 "COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L5U0CSN4_ARATHNo assigned EC number0.8640.98420.6297yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0012044601
SubName- Full=Putative uncharacterized protein; (398 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.01400002
SubName- Full=Putative uncharacterized protein; (306 aa)
   •• • 0.804
estExt_Genewise1_v1.C_LG_XVIII2221
hypothetical protein (366 aa)
   •• • 0.689
estExt_fgenesh4_pg.C_1470039
hypothetical protein (366 aa)
   •• • 0.685
eugene3.00091438
SubName- Full=Putative uncharacterized protein; (439 aa)
   •• ••0.674
eugene3.01490035
hypothetical protein (439 aa)
   •• ••0.673
fgenesh4_pg.C_LG_I002287
hypothetical protein (423 aa)
   •• • 0.662
estExt_fgenesh4_pg.C_LG_XVII0202
hypothetical protein (424 aa)
   •• • 0.648
estExt_Genewise1_v1.C_LG_I0004
hypothetical protein (199 aa)
   •• • 0.641
estExt_Genewise1_v1.C_LG_II1288
hypothetical protein (436 aa)
   •• • 0.629
estExt_fgenesh4_pg.C_LG_XIV0200
hypothetical protein (436 aa)
   •• • 0.629

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 100.0
KOG1498 439 consensus 26S proteasome regulatory complex, subun 100.0
COG5071 439 RPN5 26S proteasome regulatory complex component [ 99.96
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 98.69
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.03
KOG0687 393 consensus 26S proteasome regulatory complex, subun 95.44
COG5187 412 RPN7 26S proteasome regulatory complex component, 95.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 93.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.84
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.53
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.81
KOG2076 895 consensus RNA polymerase III transcription factor 92.63
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 92.36
cd00189100 TPR Tetratricopeptide repeat domain; typically con 92.3
PF04348 536 LppC: LppC putative lipoprotein; InterPro: IPR0074 92.21
PRK11788389 tetratricopeptide repeat protein; Provisional 91.81
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 91.09
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 90.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 89.86
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 89.75
PRK11788389 tetratricopeptide repeat protein; Provisional 88.96
COG3107 604 LppC Putative lipoprotein [General function predic 88.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 88.46
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 87.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 87.65
cd05804355 StaR_like StaR_like; a well-conserved protein foun 87.61
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 87.01
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 86.02
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 85.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 85.08
PRK10370198 formate-dependent nitrite reductase complex subuni 84.63
cd05804355 StaR_like StaR_like; a well-conserved protein foun 84.61
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 84.0
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 82.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 82.39
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 81.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 80.89
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-65  Score=469.69  Aligned_cols=245  Identities=53%  Similarity=0.826  Sum_probs=236.0

Q ss_pred             HHHHhhhhcchhhhhHHHHHHHHHHhhcCC--C-HHHHHHHHHHHhcCCcchHhHHHHHHHHHHHhcCCChHHHHHHHHH
Q 025373            3 SALASASAITDQRQKIEQYKHILSSVISSN--D-IVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANY   79 (254)
Q Consensus         3 ~~L~~~~~~~~~~~~~~~y~~ll~~i~~~~--~-~~~l~~~i~~~~~~~v~lv~sR~~l~~~~~~l~~l~~~~~~~v~~~   79 (254)
                      +.+.-+-+.+|||++.++|+.+|+..++++  + .+.+|.||+++++++|++|+|||+++.|...|+.++++.+|++.++
T Consensus         7 eev~~~~~~g~hk~~~~qyr~~l~~~lt~~~~el~e~~k~~id~~~~~~vslvvsrqllsl~~~~l~~l~~e~~Kei~~~   86 (399)
T KOG1497|consen    7 EEVVLIFAEGDHKDQAEQYRQLLAKVLTNNGMELLEALKRFIDAIVNENVSLVVSRQLLSLFDVELSILEDELRKEISHF   86 (399)
T ss_pred             HHHHHHHhcCchhhHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHcCCchhhhHHHHHHHHHHHhccCCHHHHHHHHHH
Confidence            345556777899999999999999999877  4 4899999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCcccchHHHHHHHHHHHHHHHHhhccHHHHHHHhccCCCCCCCccCChHHHHHHHHHHHHHhhcccchhhHHHH
Q 025373           80 TLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAF  159 (254)
Q Consensus        80 ~L~~i~~~~is~Eeq~a~lr~~LA~i~E~~~d~~~AA~vL~~I~lEt~~~~~s~~~K~~~~l~i~rL~Le~~D~~~Ae~~  159 (254)
                      +|..|+||.||||||++.+|.+||.+||++++|+.||++|.|||+|||++.++++.|+..|+||+|||||+||.++||.|
T Consensus        87 ~l~~iq~rvisfeEqv~~irl~LAsiYE~Eq~~~~aaq~L~~I~~~tg~~~~d~~~kl~l~iriarlyLe~~d~veae~~  166 (399)
T KOG1497|consen   87 TLEKIQPRVISFEEQVASIRLHLASIYEKEQNWRDAAQVLVGIPLDTGQKAYDVEQKLLLCIRIARLYLEDDDKVEAEAY  166 (399)
T ss_pred             HHHhcccccccHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhccCcccchhhhhhHHHHHHHHHHHHHHHhcCcHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhhcccCcchhHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhhhhhcCCCCCCHHHHHHHHHHHHHHHhcCCCCc
Q 025373          160 INKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGP  239 (254)
Q Consensus       160 ~nKas~~~~~~~d~~LkL~yk~~~ari~d~~rkFLeAa~rY~els~~~~~~~~~~~ide~er~~~L~~Av~caILApagp  239 (254)
                      +||+|.++.+.+|++|++.||+|+||++|++|||+|||+|||++|++       ..+|+.+++++|++|+.|++||.+||
T Consensus       167 inRaSil~a~~~Ne~Lqie~kvc~ARvlD~krkFlEAAqrYyels~~-------ki~~e~~~~~aL~~a~~CtlLA~~gp  239 (399)
T KOG1497|consen  167 INRASILQAESSNEQLQIEYKVCYARVLDYKRKFLEAAQRYYELSQR-------KIVDESERLEALKKALQCTLLASAGP  239 (399)
T ss_pred             HHHHHHhhhcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HhcchHHHHHHHHHhHhheeecCCCh
Confidence            99999999999999999999999999999999999999999999997       55899999999999999999999999


Q ss_pred             hhhHHHHHHhhccCC
Q 025373          240 QRSRVLATLYKVNNH  254 (254)
Q Consensus       240 ~RSrlL~~LykDeR~  254 (254)
                      ||||||++||||||.
T Consensus       240 qrsr~Latlfkder~  254 (399)
T KOG1497|consen  240 QRSRMLATLFKDERC  254 (399)
T ss_pred             HHHHHHHHHhcCccc
Confidence            999999999999983

>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.0 bits (121), Expect = 2e-07
 Identities = 37/228 (16%), Positives = 72/228 (31%), Gaps = 53/228 (23%)

Query: 8   ASAITDQRQKIEQYKHI----LSSVISS-----NDIVQAKKFID-HMLSDDVPLVVSRQL 57
           A +I D     + +KH+    L+++I S           K F    +        +   L
Sbjct: 334 AESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAH--IPTIL 391

Query: 58  LQTFAQELGRLEPET-QKEIANYTLAQIQP--RVVSFEEQVLIIREKLADLYESEQQWSK 114
           L     ++ + +      ++  Y+L + QP    +S     L ++ KL + Y   +    
Sbjct: 392 LSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHR---- 447

Query: 115 AAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAE-----AFINKASFLVSS 169
                          ++D          I + +  DD           + I     L + 
Sbjct: 448 --------------SIVD-------HYNIPKTFDSDDLIPPYLDQYFYSHI--GHHLKNI 484

Query: 170 SQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETID 217
              E + L   V +   LD +  FLE  +R+   +      I +    
Sbjct: 485 EHPERMTLFRMV-F---LDFR--FLEQKIRHDSTAWNASGSILNTLQQ 526
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 99.64
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.29
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 99.07
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.61
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 98.17
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.77
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.63
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.54
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.43
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.26
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.25
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.02
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.72
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 95.72
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 95.68
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.65
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.58
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 95.54
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 95.37
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 95.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 95.0
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.99
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.98
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 94.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 94.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 94.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 94.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 94.44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.29
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.12
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 94.06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 94.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.99
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 93.97
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 93.96
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 93.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 93.85
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 93.8
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 93.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.55
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 93.54
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 93.5
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 93.23
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 93.09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.06
4i17_A228 Hypothetical protein; TPR repeats protein, structu 93.04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.81
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 92.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 92.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 92.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 92.67
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 92.67
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 92.65
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 92.62
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 92.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 92.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 92.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.41
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 92.35
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 92.34
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 92.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 92.03
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 91.97
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 91.96
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 91.87
3q49_B137 STIP1 homology and U box-containing protein 1; E3 91.56
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 91.37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 91.28
2kat_A115 Uncharacterized protein; NESG, structure, structur 91.19
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 91.15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 91.12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 90.94
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 90.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 90.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 90.37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 90.23
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.02
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 89.81
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 89.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 89.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 89.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 89.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 89.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 89.51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 89.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 89.23
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 89.14
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 89.01
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 88.83
3u4t_A272 TPR repeat-containing protein; structural genomics 88.59
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 88.58
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 88.44
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 88.39
2gw1_A 514 Mitochondrial precursor proteins import receptor; 88.31
3u4t_A272 TPR repeat-containing protein; structural genomics 88.23
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 88.21
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 88.15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 88.13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 88.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 87.99
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 87.98
2gw1_A 514 Mitochondrial precursor proteins import receptor; 87.95
4i17_A228 Hypothetical protein; TPR repeats protein, structu 87.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 87.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 87.43
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 87.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 87.22
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 87.15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 86.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 86.76
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 86.37
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 86.24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 85.34
3k9i_A117 BH0479 protein; putative protein binding protein, 85.26
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 84.98
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 84.45
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 84.19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 83.83
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 83.74
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 83.71
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 83.34
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 83.05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 81.74
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 81.72
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 81.64
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 81.3
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 80.61
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 80.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 80.27
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2.3e-35  Score=281.60  Aligned_cols=175  Identities=18%  Similarity=0.198  Sum_probs=163.0

Q ss_pred             HHHHHHHHHHhhcCcccchHHHHHHHHHHHHHHHHhhccHHHHHHHhccCCCCCCCccCChHHHHHHHHHHHHHhhcccc
Q 025373           73 QKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDD  152 (254)
Q Consensus        73 ~~~v~~~~L~~i~~~~is~Eeq~a~lr~~LA~i~E~~~d~~~AA~vL~~I~lEt~~~~~s~~~K~~~~l~i~rL~Le~~D  152 (254)
                      .+.-...+|+.+++|+||+|.++++++..||++||.+|+|.+|+++|++|++||+ +.|++.+|+++|++|+|+|++.+|
T Consensus       114 ~~~~~i~~l~~vte~kiflE~erarl~~~La~i~e~~g~~~eA~~iL~~l~~Et~-~~~~~~~kve~~l~q~rl~l~~~d  192 (445)
T 4b4t_P          114 TRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETY-GSMEMSEKIQFILEQMELSILKGD  192 (445)
T ss_dssp             HHHHHHHCCSSSSSCCCCCCHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHC-SSSCHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHH-hcccHHHHHHHHHHHHHHHHHCCC
Confidence            3445567888999999999999999999999999999999999999999999999 599999999999999999999999


Q ss_pred             hhhHHHHHhhhhhhcc-cCcchhHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhhhhhcCCCCCCHHHHHHHHHHHHHH
Q 025373          153 AVNAEAFINKASFLVS-SSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTC  231 (254)
Q Consensus       153 ~~~Ae~~~nKas~~~~-~~~d~~LkL~yk~~~ari~d~~rkFLeAa~rY~els~~~~~~~~~~~ide~er~~~L~~Av~c  231 (254)
                      |++|+++++|++...+ ...+++++++|+.|++++++++++|++||++|++++.++.     ..-|+..|..+|..+|+|
T Consensus       193 ~~~a~~~~~ki~~~~~~~~~~~~lk~~~~~~~~~~~~~e~~y~~a~~~y~e~~~~~~-----~~~d~~~~~~~L~~~v~~  267 (445)
T 4b4t_P          193 YSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDA-----IKSDEAKWKPVLSHIVYF  267 (445)
T ss_dssp             HHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH-----HHSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhcccCCcHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhccc-----ccCCHHHHHHHHHHHHHH
Confidence            9999999999998665 4678899999999999999999999999999999999854     234889999999999999


Q ss_pred             HhcCCCCchhhHHHHHHhhccC
Q 025373          232 TILAAAGPQRSRVLATLYKVNN  253 (254)
Q Consensus       232 aILApagp~RSrlL~~LykDeR  253 (254)
                      +||+|+||+|+++++++++|++
T Consensus       268 ~iLa~~~~~~~~ll~~~~~~~~  289 (445)
T 4b4t_P          268 LVLSPYGNLQNDLIHKIQNDNN  289 (445)
T ss_dssp             HHHSSCSSTTHHHHHSHHHHSS
T ss_pred             HHhCCCCchHHHHHHHHhhccc
Confidence            9999999999999999999986
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 94.52
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 93.47
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 91.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 90.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 90.25
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 89.75
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 89.32
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.12
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 88.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 88.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.96
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.55
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 86.36
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 85.99
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.22
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 84.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 84.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 84.56
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 84.19
d1hz4a_366 Transcription factor MalT domain III {Escherichia 83.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 81.68
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

Probab=94.52  E-value=0.55  Score=36.47  Aligned_cols=105  Identities=10%  Similarity=-0.087  Sum_probs=82.4

Q ss_pred             HHHHHHHHHhhccHHHHHHHhccCCCCCCCccCChHHHHHHHHHHHHHhhcccchhhHHHHHhhhhhhcccCcchhHHHH
Q 025373           99 REKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQ  178 (254)
Q Consensus        99 r~~LA~i~E~~~d~~~AA~vL~~I~lEt~~~~~s~~~K~~~~l~i~rL~Le~~D~~~Ae~~~nKas~~~~~~~d~~LkL~  178 (254)
                      --..|.++-..|++.+|-+.+... ++... .-++...+..+..++.+|...||+..|..+..++-.+.....+....+.
T Consensus        15 ~~lrA~~~~~~g~~~~A~~~~~~a-L~~~~-~~~~~~~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~   92 (366)
T d1hz4a_          15 NALRAQVAINDGNPDEAERLAKLA-LEELP-PGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWHYALW   92 (366)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHH-HHTCC-TTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHH-HhhCc-CCCcHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHhhcchHHHHH
Confidence            334589999999999999987642 22221 2244567788889999999999999999999999888776666666777


Q ss_pred             HHHHHHHHHhhhhhHHHHHHHHHHHHh
Q 025373          179 YKVCYARILDLKRKFLEAALRYYDISQ  205 (254)
Q Consensus       179 yk~~~ari~d~~rkFLeAa~rY~els~  205 (254)
                      .....+.++....+|..+...|.+...
T Consensus        93 ~~~~~~~~~~~~~~~~~a~~~~~~al~  119 (366)
T d1hz4a_          93 SLIQQSEILFAQGFLQTAWETQEKAFQ  119 (366)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            788888999999999988888876544
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure