Citrus Sinensis ID: 025427


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
cccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccc
cccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHEcHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHccccccHEEEEEEcccccEEccHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcc
MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKScqredgtddqkkgSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKsaiphpriMGIIRecggkmhmaERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
mepekaewgfkalkqTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEaknerlwfktNLKLCKIWFDMGEYGRMSKILKELHKSCqredgtddqkkgsqLLEVYAIEIQMYTETKNNKKLKQLYQKALaiksaiphpriMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETknnkklkqlyqkalaikSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGfylhllflisiyflylyflTRIICLFVFGF
*******WGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKEL******************LLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFG*
*****AE*GFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELH***************SQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
********GFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK************KGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
*****AEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLYLYFLTRIICLFVFGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query253 2.2.26 [Sep-21-2011]
Q8W207 439 COP9 signalosome complex yes no 0.909 0.523 0.895 1e-121
Q54HL6 449 COP9 signalosome complex yes no 0.913 0.514 0.636 2e-88
Q6IR75 441 COP9 signalosome complex N/A no 0.901 0.517 0.630 5e-85
P61203 443 COP9 signalosome complex yes no 0.901 0.514 0.621 8e-84
P61202 443 COP9 signalosome complex yes no 0.901 0.514 0.621 8e-84
P61201 443 COP9 signalosome complex yes no 0.901 0.514 0.621 8e-84
Q94899 444 COP9 signalosome complex yes no 0.889 0.506 0.634 2e-83
Q6IQT4 443 COP9 signalosome complex yes no 0.901 0.514 0.617 2e-83
Q5B3U7 506 COP9 signalosome complex yes no 0.877 0.438 0.593 3e-82
O01422 495 COP9 signalosome complex yes no 0.901 0.460 0.579 6e-76
>sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1 Back     alignment and function desciption
 Score =  436 bits (1120), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/230 (89%), Positives = 218/230 (94%)

Query: 1   MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFV 60
           MEPEKA+WGFKALKQTVK+YYRLGKYKEMM+AY EMLTYIKSAVTRNYSEKCINNIMDFV
Sbjct: 54  MEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYIKSAVTRNYSEKCINNIMDFV 113

Query: 61  SGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK 120
           SGSASQN  LL+EFYQTTLKALEEAKNERLWFKTNLKLC IWFD+GEY RM+KILKELHK
Sbjct: 114 SGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCNIWFDIGEYRRMTKILKELHK 173

Query: 121 SCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGII 180
           SCQ+EDGTDDQKKGSQLLEVYAIEIQ+YTETK+NKKLKQLY KALAIKSAIPHPRIMGII
Sbjct: 174 SCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQLYHKALAIKSAIPHPRIMGII 233

Query: 181 RECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLF 230
           RECGGKMHMAERQW +AATDFFEAFKNYDEAGNQRRIQCLKY    ++L 
Sbjct: 234 RECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLM 283




Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54HL6|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1 Back     alignment and function description
>sp|Q6IR75|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1 Back     alignment and function description
>sp|P61203|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=2 SV=1 Back     alignment and function description
>sp|P61202|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1 Back     alignment and function description
>sp|P61201|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q94899|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2 Back     alignment and function description
>sp|Q6IQT4|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1 Back     alignment and function description
>sp|Q5B3U7|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2 Back     alignment and function description
>sp|O01422|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
255583651 439 cop9 signalosome complex subunit, putati 0.909 0.523 0.956 1e-128
224106658 439 predicted protein [Populus trichocarpa] 0.909 0.523 0.952 1e-127
224120594 439 predicted protein [Populus trichocarpa] 0.909 0.523 0.947 1e-126
115435976 439 Os01g0279200 [Oryza sativa Japonica Grou 0.909 0.523 0.934 1e-125
56783671 433 putative COP9 signalosome complex subuni 0.909 0.531 0.934 1e-125
242057017 439 hypothetical protein SORBIDRAFT_03g01126 0.909 0.523 0.930 1e-125
297741725 440 unnamed protein product [Vitis vinifera] 0.909 0.522 0.934 1e-125
225440232 439 PREDICTED: COP9 signalosome complex subu 0.909 0.523 0.934 1e-124
357131345 437 PREDICTED: COP9 signalosome complex subu 0.909 0.526 0.921 1e-124
413946876 438 hypothetical protein ZEAMMB73_237868 [Ze 0.909 0.525 0.926 1e-124
>gi|255583651|ref|XP_002532580.1| cop9 signalosome complex subunit, putative [Ricinus communis] gi|223527689|gb|EEF29797.1| cop9 signalosome complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/230 (95%), Positives = 224/230 (97%)

Query: 1   MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFV 60
           MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFV
Sbjct: 54  MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFV 113

Query: 61  SGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK 120
           SGSASQNF LL+EFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK
Sbjct: 114 SGSASQNFGLLQEFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK 173

Query: 121 SCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGII 180
           SCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGII
Sbjct: 174 SCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGII 233

Query: 181 RECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLF 230
           RECGGKMHMAERQWA+AATDFFEAFKNYDEAGNQRRIQCLKY    ++L 
Sbjct: 234 RECGGKMHMAERQWAEAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLM 283




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224106658|ref|XP_002314240.1| predicted protein [Populus trichocarpa] gi|118481037|gb|ABK92472.1| unknown [Populus trichocarpa] gi|222850648|gb|EEE88195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120594|ref|XP_002330981.1| predicted protein [Populus trichocarpa] gi|222872773|gb|EEF09904.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115435976|ref|NP_001042746.1| Os01g0279200 [Oryza sativa Japonica Group] gi|113532277|dbj|BAF04660.1| Os01g0279200 [Oryza sativa Japonica Group] gi|218187979|gb|EEC70406.1| hypothetical protein OsI_01398 [Oryza sativa Indica Group] gi|222618201|gb|EEE54333.1| hypothetical protein OsJ_01306 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|56783671|dbj|BAD81083.1| putative COP9 signalosome complex subunit 2 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242057017|ref|XP_002457654.1| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor] gi|241929629|gb|EES02774.1| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|297741725|emb|CBI32857.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440232|ref|XP_002283810.1| PREDICTED: COP9 signalosome complex subunit 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357131345|ref|XP_003567299.1| PREDICTED: COP9 signalosome complex subunit 2-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413946876|gb|AFW79525.1| hypothetical protein ZEAMMB73_237868 [Zea mays] gi|413946877|gb|AFW79526.1| hypothetical protein ZEAMMB73_237868 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
TAIR|locus:2059289 439 FUS12 "FUSCA 12" [Arabidopsis 0.877 0.505 0.855 1.8e-101
DICTYBASE|DDB_G0289361 449 csn2 "proteasome component reg 0.865 0.487 0.593 8.6e-72
UNIPROTKB|E2REA8 443 COPS2 "Uncharacterized protein 0.869 0.496 0.585 7e-70
UNIPROTKB|P61201 443 COPS2 "COP9 signalosome comple 0.869 0.496 0.585 7e-70
UNIPROTKB|F1SQG5385 COPS2 "Uncharacterized protein 0.869 0.571 0.585 7e-70
MGI|MGI:1330276 443 Cops2 "COP9 (constitutive phot 0.869 0.496 0.585 7e-70
RGD|628791 443 Cops2 "COP9 signalosome subuni 0.869 0.496 0.585 7e-70
UNIPROTKB|P61203 443 Cops2 "COP9 signalosome comple 0.869 0.496 0.585 7e-70
ZFIN|ZDB-GENE-040625-15 443 cops2 "COP9 constitutive photo 0.869 0.496 0.581 1.8e-69
FB|FBgn0013746 444 alien "alien" [Drosophila mela 0.857 0.488 0.598 3.8e-69
TAIR|locus:2059289 FUS12 "FUSCA 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1006 (359.2 bits), Expect = 1.8e-101, P = 1.8e-101
 Identities = 190/222 (85%), Positives = 199/222 (89%)

Query:     1 MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFV 60
             MEPEKA+WGFKALKQTVK+YYRLGKYKEMM+AY EMLTYIKSAVTRNYSEKCINNIMDFV
Sbjct:    54 MEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYIKSAVTRNYSEKCINNIMDFV 113

Query:    61 SGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK 120
             SGSASQN  LL+EFYQTTLKALEEAKNERLWFKTNLKLC IWFD+GEY RM+KILKELHK
Sbjct:   114 SGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCNIWFDIGEYRRMTKILKELHK 173

Query:   121 SCQREDGTDDQKKGSQLLEVYAIEIQMYTETXXXXXXXXXXXXXXXXXSAIPHPRIMGII 180
             SCQ+EDGTDDQKKGSQLLEVYAIEIQ+YTET                 SAIPHPRIMGII
Sbjct:   174 SCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQLYHKALAIKSAIPHPRIMGII 233

Query:   181 RECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKY 222
             RECGGKMHMAERQW +AATDFFEAFKNYDEAGNQRRIQCLKY
Sbjct:   234 RECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCLKY 275




GO:0005634 "nucleus" evidence=ISM;TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0008180 "signalosome" evidence=TAS;IPI
GO:0009640 "photomorphogenesis" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010388 "cullin deneddylation" evidence=RCA;IMP
GO:0005829 "cytosol" evidence=IDA
DICTYBASE|DDB_G0289361 csn2 "proteasome component region PCI (PINT) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2REA8 COPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P61201 COPS2 "COP9 signalosome complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQG5 COPS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1330276 Cops2 "COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628791 Cops2 "COP9 signalosome subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61203 Cops2 "COP9 signalosome complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-15 cops2 "COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0013746 alien "alien" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W207CSN2_ARATHNo assigned EC number0.89560.90900.5239yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 253
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 100.0
KOG1463 411 consensus 26S proteasome regulatory complex, subun 100.0
COG5159 421 RPN6 26S proteasome regulatory complex component [ 100.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 98.0
PRK11788389 tetratricopeptide repeat protein; Provisional 97.67
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.56
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.51
PRK11788389 tetratricopeptide repeat protein; Provisional 97.37
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.25
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.15
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 97.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.08
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.07
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.01
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.94
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.89
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.72
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.68
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.53
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.49
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.36
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.26
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 96.17
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.75
PRK10370198 formate-dependent nitrite reductase complex subuni 95.7
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.61
PRK04841 903 transcriptional regulator MalT; Provisional 95.42
PLN03218 1060 maturation of RBCL 1; Provisional 95.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.19
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.14
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 94.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.88
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.73
PLN03218 1060 maturation of RBCL 1; Provisional 94.54
cd05804355 StaR_like StaR_like; a well-conserved protein foun 94.5
KOG2908 380 consensus 26S proteasome regulatory complex, subun 94.35
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.27
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.22
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 94.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.1
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 94.01
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.88
PRK14574 822 hmsH outer membrane protein; Provisional 93.81
TIGR02552135 LcrH_SycD type III secretion low calcium response 93.73
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.56
PRK11189296 lipoprotein NlpI; Provisional 93.56
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.53
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.29
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 93.29
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.27
cd05804355 StaR_like StaR_like; a well-conserved protein foun 93.27
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 93.21
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 93.11
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 92.76
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 92.69
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 92.66
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.59
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 92.25
KOG2300629 consensus Uncharacterized conserved protein [Funct 92.04
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 91.85
PRK04841903 transcriptional regulator MalT; Provisional 91.81
TIGR02552135 LcrH_SycD type III secretion low calcium response 91.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 91.28
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 91.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 91.12
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 91.12
KOG2300 629 consensus Uncharacterized conserved protein [Funct 91.06
KOG1498 439 consensus 26S proteasome regulatory complex, subun 90.99
PLN03077 857 Protein ECB2; Provisional 90.96
PRK10803263 tol-pal system protein YbgF; Provisional 90.53
KOG2003 840 consensus TPR repeat-containing protein [General f 90.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.31
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 90.12
KOG2688 394 consensus Transcription-associated recombination p 89.97
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.87
PF1337173 TPR_9: Tetratricopeptide repeat 89.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.47
KOG2003 840 consensus TPR repeat-containing protein [General f 89.39
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 89.29
PRK12370553 invasion protein regulator; Provisional 89.21
PRK15359144 type III secretion system chaperone protein SscB; 88.84
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 87.96
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 87.67
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 87.48
PRK14574 822 hmsH outer membrane protein; Provisional 87.39
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 87.22
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 87.16
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 86.93
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 86.48
PLN03077 857 Protein ECB2; Provisional 86.45
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 86.15
COG5600 413 Transcription-associated recombination protein [DN 85.46
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 85.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.05
KOG2376 652 consensus Signal recognition particle, subunit Srp 85.04
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 85.03
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.81
PRK10370198 formate-dependent nitrite reductase complex subuni 84.68
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.31
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 83.2
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 83.19
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 83.16
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 82.91
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 82.73
PRK02603172 photosystem I assembly protein Ycf3; Provisional 82.69
KOG0547 606 consensus Translocase of outer mitochondrial membr 82.54
COG4783484 Putative Zn-dependent protease, contains TPR repea 82.47
COG4105254 ComL DNA uptake lipoprotein [General function pred 82.41
KOG2376652 consensus Signal recognition particle, subunit Srp 81.03
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 80.98
KOG0495 913 consensus HAT repeat protein [RNA processing and m 80.96
PRK14720 906 transcript cleavage factor/unknown domain fusion p 80.52
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=9.9e-80  Score=554.72  Aligned_cols=236  Identities=67%  Similarity=1.096  Sum_probs=231.8

Q ss_pred             CCccchhHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHhcCCCCcchhHHHHHHHHHHH
Q 025427            1 MEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLK   80 (253)
Q Consensus         1 ~~~~~~ew~fkAlkql~kl~~~~~~~~~~~~~~~~ll~~~~~~v~ka~~~K~i~~ild~~s~~~~~~~~~l~~~y~~~~e   80 (253)
                      +|+|+|+|+||||||++|++++.+++++|++.|+++++|++|+|||||++|+||+|+|++|.+  .++++|+.||++|++
T Consensus        56 lEgEKgeWGFKALKQmiKI~f~l~~~~eMm~~Y~qlLTYIkSAVTrNySEKsIN~IlDyiStS--~~m~LLQ~FYeTTL~  133 (440)
T KOG1464|consen   56 LEGEKGEWGFKALKQMIKINFRLGNYKEMMERYKQLLTYIKSAVTRNYSEKSINSILDYISTS--KNMDLLQEFYETTLD  133 (440)
T ss_pred             cccccchhHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHhhh--hhhHHHHHHHHHHHH
Confidence            478999999999999999999999999999999999999999999999999999999999955  468899999999999


Q ss_pred             HHHHhhhhhhHHHHhhhHHHHHhhhcchhHHHHHHHHHHHHcccCCCCchhhhcchHHHHHHHHHHHHHhhcCHHHHHHH
Q 025427           81 ALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL  160 (253)
Q Consensus        81 ~i~~a~~erl~lk~~lkLa~l~l~~~~y~~a~~li~~L~~~l~~~~~~dD~~kk~~LlEv~~lE~~~y~~~~n~~klk~~  160 (253)
                      +++.|+|+|||||++.||+++|+|.++|.+..+++++||++|+..+|+||+.|+++|+||||+|||||+.++|++|+|++
T Consensus       134 ALkdAKNeRLWFKTNtKLgkl~fd~~e~~kl~KIlkqLh~SCq~edGedD~kKGtQLLEiYAlEIQmYT~qKnNKkLK~l  213 (440)
T KOG1464|consen  134 ALKDAKNERLWFKTNTKLGKLYFDRGEYTKLQKILKQLHQSCQTEDGEDDQKKGTQLLEIYALEIQMYTEQKNNKKLKAL  213 (440)
T ss_pred             HHHhhhcceeeeeccchHhhhheeHHHHHHHHHHHHHHHHHhccccCchhhhccchhhhhHhhHhhhhhhhcccHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhccCCchhHHHHHHhhccccccccccHHHHHHHHHHHhcccccccChhhHHHHHHHHHHHHhccCCCchHH
Q 025427          161 YQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYFLY  238 (253)
Q Consensus       161 y~~a~~~~~aI~~P~i~g~I~e~~Gkl~~~ekdy~tA~s~F~EAFe~yde~g~~~a~~~LKYlvL~~iL~~s~id~~~  238 (253)
                      |.+|+.+.+|||||+|||+|||||||||+.||.|++|+++|||||+||||+|+|||++||||+|||+||+.|+||||.
T Consensus       214 YeqalhiKSAIPHPlImGvIRECGGKMHlreg~fe~AhTDFFEAFKNYDEsGspRRttCLKYLVLANMLmkS~iNPFD  291 (440)
T KOG1464|consen  214 YEQALHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFD  291 (440)
T ss_pred             HHHHHHhhccCCchHHHhHHHHcCCccccccchHHHHHhHHHHHHhcccccCCcchhHHHHHHHHHHHHHHcCCCCCc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999985



>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
3txm_A 394 Crystal Structure Of Rpn6 From Drosophila Melanogas 3e-05
>pdb|3TXM|A Chain A, Crystal Structure Of Rpn6 From Drosophila Melanogaster, Gd(3+) Complex Length = 394 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 54/219 (24%), Positives = 100/219 (45%), Gaps = 28/219 (12%) Query: 15 QTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMD-FVSGSASQNFSLLRE 73 Q +LY + GK KE+ D + ++ S++++ + K + +++D F+ A + Sbjct: 24 QQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDAGTGIEV--- 79 Query: 74 FYQTTLKALEEAKNE-RLWFKTNL--KLCKIWFDMGEYGRM----SKILKELHKSCQRED 126 Q +E AK E R + + +L +L ++FD Y +++L+EL K Sbjct: 80 --QLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKK------ 131 Query: 127 GTDDQKKGSQLLEVYAIEIQMYTETXXXXXXXXXXXXXXXXXSAI--PHPRIMGIIRECG 184 DD+ + L+EV +E + Y +AI P P++ G + Sbjct: 132 -LDDK---NLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCP-PKVQGALDLQS 186 Query: 185 GKMHMA-ERQWADAATDFFEAFKNYDEAGNQRRIQCLKY 222 G +H A ER + A + F+EAF+ +D + + + LKY Sbjct: 187 GILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKY 225

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 3e-51
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 9e-04
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  171 bits (433), Expect = 3e-51
 Identities = 41/234 (17%), Positives = 93/234 (39%), Gaps = 12/234 (5%)

Query: 2   EPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIK---SAVTRNYSEKCINNIMD 58
             E  E   +  +Q +     L K +       +++   +   S++++  + K + +++D
Sbjct: 7   GAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVD 66

Query: 59  FVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKEL 118
                      +  +  +  ++  ++ K   L      +L  ++FD   Y     +  +L
Sbjct: 67  MFL-DMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQL 125

Query: 119 HKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAI-PHPRIM 177
            +  ++ D  +       L+EV  +E + Y    N  K +     A    +AI   P++ 
Sbjct: 126 LRELKKLDDKN------LLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQ 179

Query: 178 GIIRECGGKMHM-AERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLF 230
           G +    G +H   ER +  A + F+EAF+ +D   + + +  LKY     ++ 
Sbjct: 180 GALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIML 233


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.97
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 99.96
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 99.8
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 99.04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.99
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.9
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.85
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.84
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.83
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.75
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.66
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.64
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.61
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.56
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 98.55
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 98.52
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.5
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.47
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.44
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.31
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.27
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.16
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.13
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.1
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.02
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.99
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.95
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.93
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.93
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.9
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.9
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.86
3u4t_A272 TPR repeat-containing protein; structural genomics 97.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.84
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.81
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.78
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.78
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.76
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.74
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.74
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.73
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.72
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.71
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.7
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.63
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.61
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.59
3u4t_A272 TPR repeat-containing protein; structural genomics 97.54
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.49
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.49
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.48
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.48
2gw1_A 514 Mitochondrial precursor proteins import receptor; 97.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.45
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.45
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.45
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 97.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.41
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.35
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.34
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.33
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.19
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.05
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.01
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.95
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.92
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.88
4g1t_A472 Interferon-induced protein with tetratricopeptide 96.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.86
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.85
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.83
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.81
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.8
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.72
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.72
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.65
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.65
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.55
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.4
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.34
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.31
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.29
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.27
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.24
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.23
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.19
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.98
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.98
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.96
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.96
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.89
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.85
4g1t_A 472 Interferon-induced protein with tetratricopeptide 95.8
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.8
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.7
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 95.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.66
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 95.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.57
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.21
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.09
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.06
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.0
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.86
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 94.67
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.66
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.59
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.41
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.21
3k9i_A117 BH0479 protein; putative protein binding protein, 94.2
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.15
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 94.03
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 93.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.81
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 93.64
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 93.21
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 92.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.56
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 92.51
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.42
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 92.34
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 91.6
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.55
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.33
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 91.1
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 90.92
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 90.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 90.5
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.28
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 90.08
3k9i_A117 BH0479 protein; putative protein binding protein, 89.73
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 89.71
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 89.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 89.66
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 89.46
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 89.26
2kat_A115 Uncharacterized protein; NESG, structure, structur 88.35
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 88.01
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 87.52
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.37
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 87.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.0
2l6j_A111 TPR repeat-containing protein associated with HSP; 86.0
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 84.24
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 84.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 82.49
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 82.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 82.23
1klx_A138 Cysteine rich protein B; structural genomics, heli 81.45
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.27
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
Probab=100.00  E-value=2.3e-56  Score=422.66  Aligned_cols=222  Identities=23%  Similarity=0.350  Sum_probs=212.5

Q ss_pred             cchhHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHhcCCCCcchhHHHHHHHHHHHHHH
Q 025427            4 EKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALE   83 (253)
Q Consensus         4 ~~~ew~fkAlkql~kl~~~~~~~~~~~~~~~~ll~~~~~~v~ka~~~K~i~~ild~~s~~~~~~~~~l~~~y~~~~e~i~   83 (253)
                      +..++++.|+.+|+++|+++|+++++.+++++++||+ +.++|||++|+||+|||.++.+|++    .+.++++|+++|+
T Consensus        13 ~~~~~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~kak~~k~v~~l~~~~~~~~~~----~~~~~~~~~~~~~   87 (394)
T 3txn_A           13 ERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDAG----TGIEVQLCKDCIE   87 (394)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHTTTGG-GGSCHHHHHHHHHHHHHHHTTSCCC----HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH-HHhchHHHHHHHHHHHHHHhcCCCc----HHHHHHHHHHHHH
Confidence            4567899999999999999999999999999999999 9999999999999999999999875    3688999999999


Q ss_pred             Hhhhh-hhHHHHhh--hHHHHHhhhcchhHHHHHHHHHHHHcccCCCCchhhhcchHHHHHHHHHHHHHhhcCHHHHHHH
Q 025427           84 EAKNE-RLWFKTNL--KLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL  160 (253)
Q Consensus        84 ~a~~e-rl~lk~~l--kLa~l~l~~~~y~~a~~li~~L~~~l~~~~~~dD~~kk~~LlEv~~lE~~~y~~~~n~~klk~~  160 (253)
                      ||+++ |+|||+++  ||+.+|++.|+|++|+++|++|+++|++.   ||   +++++|||++||++|++++|++|+|++
T Consensus        88 ~a~~~~r~flr~~l~~kL~~l~~~~~~y~~a~~~i~~l~~~~~~~---dd---~~~llev~lle~~~~~~~~n~~k~k~~  161 (394)
T 3txn_A           88 WAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKL---DD---KNLLVEVQLLESKTYHALSNLPKARAA  161 (394)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTS---SC---THHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhcc---cc---chhHHHHHHHHHHHHHHhccHHHHHHH
Confidence            99998 59999999  99999999999999999999999999998   78   999999999999999999999999999


Q ss_pred             HHHHHhhhccCCc-hhHHHHHHhhcccccc-ccccHHHHHHHHHHHhcccccccChhhHHHHHHHHHHHHhccCCCch
Q 025427          161 YQKALAIKSAIPH-PRIMGIIRECGGKMHM-AERQWADAATDFFEAFKNYDEAGNQRRIQCLKYGFYLHLLFLISIYF  236 (253)
Q Consensus       161 y~~a~~~~~aI~~-P~i~g~I~e~~Gkl~~-~ekdy~tA~s~F~EAFe~yde~g~~~a~~~LKYlvL~~iL~~s~id~  236 (253)
                      |++|++++|+||| |++||.|++|||++|| .+|||++|+++|||||++|+++|+|++.++||||+||+||+++..|+
T Consensus       162 l~~a~~~~~ai~~~p~i~a~i~~~~Gi~~l~~~rdyk~A~~~F~eaf~~f~~~~~~~~~~~lkYlvL~aLl~~~r~el  239 (394)
T 3txn_A          162 LTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDV  239 (394)
T ss_dssp             HHHHHHHHHHSCCCHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHTTCGGGH
T ss_pred             HHHHHhhhccCCCCHHHHHHHHHHhhHHHHHhccCHHHHHHHHHHHHhcccccccHHHHHHHHHHHHHHHHcCCHHHH
Confidence            9999999999955 9999999999999999 99999999999999999999999999999999999999999995554



>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.18
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.99
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.41
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.37
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.17
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.96
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.71
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.69
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.68
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.47
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.45
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.13
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 95.98
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.68
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.15
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.14
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.23
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.76
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 93.54
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 92.75
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.5
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 91.24
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 88.02
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 85.93
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 84.92
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 84.66
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.65  E-value=1.4e-05  Score=67.66  Aligned_cols=188  Identities=9%  Similarity=0.025  Sum_probs=132.5

Q ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHhcCCCCcchhHHHHHHHHHHHHHHHhhhhhhH
Q 025427           12 ALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLW   91 (253)
Q Consensus        12 Alkql~kl~~~~~~~~~~~~~~~~ll~~~~~~v~ka~~~K~i~~ild~~s~~~~~~~~~l~~~y~~~~e~i~~a~~erl~   91 (253)
                      .+.+++.+|...|+++++++.|.+........-.+..+++...++-..+....+  .+---..|+-+.+......+....
T Consensus        39 ~y~~aa~~y~~~~~~~~A~~~y~kA~~~~~~~~~~~~~a~~~~~~g~~y~~~~~--~~~A~~~~~~a~~~~~~~~~~~~~  116 (290)
T d1qqea_          39 LCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGN--SVNAVDSLENAIQIFTHRGQFRRG  116 (290)
T ss_dssp             HHHHHHHHHHHTTCTHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTC--HHHHHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHHHHHHHHHHCcCHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhCC--cHHHHHHHHHhhHHhhhcccchhH
Confidence            388999999999999999999999998863333445567777777666653322  111112233333332333334455


Q ss_pred             HHHhhhHHHHHhh-hcchhHHHHHHHHHHHHcccCCCCchhhhcchHHHHHHHHHHHHHhhcCHHHHHHHHHHHHhhhcc
Q 025427           92 FKTNLKLCKIWFD-MGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSA  170 (253)
Q Consensus        92 lk~~lkLa~l~l~-~~~y~~a~~li~~L~~~l~~~~~~dD~~kk~~LlEv~~lE~~~y~~~~n~~klk~~y~~a~~~~~a  170 (253)
                      .....+++.+|.. .|+|++|.+..++..+..+..   ++   .....+++.-=..+|..++|+.++...|.++......
T Consensus       117 ~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~---~~---~~~~~~~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~  190 (290)
T d1qqea_         117 ANFKFELGEILENDLHDYAKAIDCYELAGEWYAQD---QS---VALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMG  190 (290)
T ss_dssp             HHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHT---TC---HHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhc---Cc---hhhhhhHHHHHHHHHHHcChHHHHHHHHHHHHHhCcc
Confidence            6666699998865 699999999998887776554   23   4556777777789999999999999999999887766


Q ss_pred             CCc-hhHHHHHHhhccccccccccHHHHHHHHHHHhcc
Q 025427          171 IPH-PRIMGIIRECGGKMHMAERQWADAATDFFEAFKN  207 (253)
Q Consensus       171 I~~-P~i~g~I~e~~Gkl~~~ekdy~tA~s~F~EAFe~  207 (253)
                      .+- +...+.+-...|..+...+|+..|...|-.+.+-
T Consensus       191 ~~~~~~~~~~~~~~~~~~~l~~~d~~~A~~~~~~~~~~  228 (290)
T d1qqea_         191 NRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSE  228 (290)
T ss_dssp             CTTTGGGHHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC
T ss_pred             chhhhhhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHh
Confidence            553 3344455566777778889999998777666554



>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure