Citrus Sinensis ID: 025451
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| 255540171 | 349 | metal ion binding protein, putative [Ric | 0.654 | 0.472 | 0.673 | 1e-48 | |
| 356508829 | 319 | PREDICTED: uncharacterized protein LOC10 | 0.678 | 0.536 | 0.640 | 2e-48 | |
| 255645900 | 319 | unknown [Glycine max] | 0.678 | 0.536 | 0.640 | 4e-48 | |
| 449454814 | 333 | PREDICTED: uncharacterized protein LOC10 | 0.765 | 0.579 | 0.611 | 2e-44 | |
| 363807668 | 320 | uncharacterized protein LOC100814726 [Gl | 0.496 | 0.390 | 0.730 | 2e-44 | |
| 449529214 | 249 | PREDICTED: uncharacterized protein LOC10 | 0.765 | 0.775 | 0.611 | 2e-44 | |
| 224134014 | 251 | predicted protein [Populus trichocarpa] | 0.650 | 0.653 | 0.581 | 7e-44 | |
| 356527888 | 310 | PREDICTED: uncharacterized protein LOC10 | 0.503 | 0.409 | 0.781 | 3e-43 | |
| 255640129 | 219 | unknown [Glycine max] | 0.511 | 0.589 | 0.772 | 7e-43 | |
| 449528291 | 358 | PREDICTED: uncharacterized protein LOC10 | 0.686 | 0.483 | 0.601 | 8e-43 |
| >gi|255540171|ref|XP_002511150.1| metal ion binding protein, putative [Ricinus communis] gi|223550265|gb|EEF51752.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 199 bits (505), Expect = 1e-48, Method: Compositional matrix adjust.
Identities = 124/184 (67%), Positives = 145/184 (78%), Gaps = 19/184 (10%)
Query: 30 EKPAAAEEKK--PAPEESKDAKAAKEEQSPPPPKEIVLKVYMHCEGCARKVRRCLKGFEG 87
+KP A EEKK P+E+K++K ++SPPPP+EI++KVYMHCEGCARKVRRCLKGF+G
Sbjct: 44 DKPPAGEEKKEDKKPDEAKESK----DESPPPPQEIIMKVYMHCEGCARKVRRCLKGFDG 99
Query: 88 VEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHRQVELLSPIPKPTAAEEEKKAEEKAP 147
VEDVITDCK+ KV+VKGEKADPL+VL RVQRKSHRQVEL+SPIPKP + EE+K AEEK
Sbjct: 100 VEDVITDCKSSKVVVKGEKADPLQVLARVQRKSHRQVELISPIPKPPSEEEKKAAEEKEK 159
Query: 148 PKPEEKKEEPQVIIVVLKVHMHCEGCSLEIKKRILRMEGV-------------FFSFFFP 194
PKPEEKKEEP VIIVVLKV+MHCE C++EIKKRI RM+GV F P
Sbjct: 160 PKPEEKKEEPPVIIVVLKVYMHCEACAMEIKKRIQRMKGVESADPDLKSSEVTVKGVFDP 219
Query: 195 QKLF 198
QKL
Sbjct: 220 QKLV 223
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356508829|ref|XP_003523156.1| PREDICTED: uncharacterized protein LOC100787932 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255645900|gb|ACU23439.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449454814|ref|XP_004145149.1| PREDICTED: uncharacterized protein LOC101222573 [Cucumis sativus] gi|449471026|ref|XP_004153186.1| PREDICTED: uncharacterized protein LOC101218262 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363807668|ref|NP_001242418.1| uncharacterized protein LOC100814726 [Glycine max] gi|255635024|gb|ACU17870.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449529214|ref|XP_004171596.1| PREDICTED: uncharacterized protein LOC101224374, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224134014|ref|XP_002321715.1| predicted protein [Populus trichocarpa] gi|222868711|gb|EEF05842.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356527888|ref|XP_003532538.1| PREDICTED: uncharacterized protein LOC100796289 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255640129|gb|ACU20355.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449528291|ref|XP_004171138.1| PREDICTED: uncharacterized protein LOC101226706 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.293 | 0.208 | 0.891 | 2.9e-44 | |
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.281 | 0.244 | 0.830 | 1.1e-40 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.273 | 0.280 | 0.579 | 1.2e-24 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.297 | 0.235 | 0.394 | 4e-19 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.265 | 0.170 | 0.485 | 1.2e-17 | |
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.488 | 0.318 | 0.353 | 5.8e-16 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.488 | 0.502 | 0.317 | 6.2e-14 | |
| TAIR|locus:2018768 | 287 | AT1G29000 [Arabidopsis thalian | 0.488 | 0.428 | 0.266 | 5.9e-12 | |
| TAIR|locus:2089870 | 136 | AT3G21490 "AT3G21490" [Arabido | 0.257 | 0.477 | 0.393 | 2e-10 | |
| TAIR|locus:2121199 | 153 | FP6 "farnesylated protein 6" [ | 0.25 | 0.411 | 0.468 | 4.1e-10 |
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 361 (132.1 bits), Expect = 2.9e-44, Sum P(2) = 2.9e-44
Identities = 66/74 (89%), Positives = 72/74 (97%)
Query: 57 PPPPKEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRV 116
PPPP+E+VLKVYMHCEGCARKVRRCLKGFEGVEDV+TDCKT KV+VKGEKADPLKVL RV
Sbjct: 69 PPPPQEVVLKVYMHCEGCARKVRRCLKGFEGVEDVMTDCKTGKVVVKGEKADPLKVLARV 128
Query: 117 QRKSHRQVELLSPI 130
QRK+HRQV+LLSPI
Sbjct: 129 QRKTHRQVQLLSPI 142
|
|
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089870 AT3G21490 "AT3G21490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 7e-11 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 9e-08 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 7e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 7e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 0.003 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.003 | |
| MTH00097 | 121 | MTH00097, ND6, NADH dehydrogenase subunit 6; Provi | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 0.004 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.004 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 56.1 bits (136), Expect = 7e-11
Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 1/63 (1%)
Query: 64 VLKVY-MHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHR 122
L V M C GC K+ + L+ GVE V D +T K V+ + + L +
Sbjct: 1 ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGY 60
Query: 123 QVE 125
+
Sbjct: 61 KAR 63
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177159 MTH00097, ND6, NADH dehydrogenase subunit 6; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.58 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.49 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.38 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.14 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.06 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.94 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.87 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.73 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.35 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.28 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.28 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.19 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 97.81 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.57 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.47 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.33 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.23 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 96.8 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 95.49 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 95.18 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 85.44 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 82.67 |
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.58 E-value=6e-15 Score=146.91 Aligned_cols=134 Identities=19% Similarity=0.297 Sum_probs=116.0
Q ss_pred ccchhHHHHHHHHhcCCCCceeeecccccceEEeeccc-CChhhhhhhhhccccccccccCCCCCCCchhHhhhhhcCCC
Q 025451 69 MHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEK-ADPLKVLDRVQRKSHRQVELLSPIPKPTAAEEEKKAEEKAP 147 (252)
Q Consensus 69 M~C~~Ca~~Ie~aL~~l~GV~~v~vdl~~~~v~V~~~~-~d~~~i~~~I~k~~G~~a~l~s~~~~~~~~~~~~~~~e~~~ 147 (252)
|+|..|++.|+.++++.+||.++.+++.+++++|.++. .+++.+.+.|+ .+||.+.+.+...
T Consensus 3 mtc~ac~~si~~~~~~~~g~~~i~vsl~~~~~~v~~~~~~~~~~i~~~ie-d~gf~~~~~~~~~---------------- 65 (951)
T KOG0207|consen 3 MTCSACSNSIEKAISRKPGVQKIEVSLAQKRANVSYDNIVSPESIKETIE-DMGFEASLLSDSE---------------- 65 (951)
T ss_pred ccHHHHhhhHHHHHhcCCCceeEEEEeccccceEEEeeccCHHHHHHHhh-cccceeeecccCc----------------
Confidence 99999999999999999999999999999999997643 48899999999 6999988764322
Q ss_pred CCCCCCCCCCceEEEEEEe-cCCChhhHHHHHHHHhcCCCccc----------------CCCCHHHHHHHHHhcCCCeE-
Q 025451 148 PKPEEKKEEPQVIIVVLKV-HMHCEGCSLEIKKRILRMEGVFF----------------SFFFPQKLFRSFYFFGVVYF- 209 (252)
Q Consensus 148 ~~~~~~~~~~~~~~~~L~V-GMtCasCa~~IEkaL~k~~GV~s----------------g~~~~~~L~~aI~~aGY~a~- 209 (252)
....+.+|.| ||||+||++.||+.|++.+||.+ ..++++.+.+.++++||.+.
T Consensus 66 ---------~~~~~~~l~v~GmtC~scv~~i~~~l~~~~gv~~~~val~~~~~~v~~dp~v~s~~~~~e~ie~~gf~a~~ 136 (951)
T KOG0207|consen 66 ---------ITASKCYLSVNGMTCASCVATIERNLRKIEGVESAVVALSASKAEVIYDPAVTSPDSIAESIEDLGFSAEL 136 (951)
T ss_pred ---------cccceeEEEecCceeHHHHHHHHHHhhccCCcceEEEEeeccceeEEECCcccCchhHHHHHHhcCcccee
Confidence 1223678999 99999999999999999999999 46788999999999999763
Q ss_pred -------------EeeccchhHhhHHhhhhcc
Q 025451 210 -------------FFFRFMQFCSCILFNYLLL 228 (252)
Q Consensus 210 -------------~~~~~~~~~~~~~~~~l~~ 228 (252)
+.+.||+|++|+.-+.=.+
T Consensus 137 i~~~~~~~~~~i~L~v~g~~c~s~~~~ie~~l 168 (951)
T KOG0207|consen 137 IESVNGNSNQKIYLDVLGMTCASCVSKIESIL 168 (951)
T ss_pred hhcccCCCCCcEEEEeecccccchhhhhHHHH
Confidence 5699999999999876553
|
|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-18 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 5e-07 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 4e-15 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 9e-05 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 3e-13 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 5e-05 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 2e-12 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 2e-04 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 1e-10 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 6e-04 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 2e-10 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 2e-07 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 7e-07 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 1e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-05 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 5e-06 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 9e-05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 1e-04 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 2e-04 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 3e-04 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 4e-04 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 7e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 77.6 bits (191), Expect = 1e-18
Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 2/84 (2%)
Query: 45 SKDAKAAKEEQSPPPPKEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKG 104
S + A + + + V M C+ C VR+ L+G GV+DV + V+V
Sbjct: 3 SGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHT 62
Query: 105 EKADPLKVLDRVQRKSHRQVELLS 128
+V ++ + RQ L
Sbjct: 63 T-LPSQEVQALLE-GTGRQAVLKG 84
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.8 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.76 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.72 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.2 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.14 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.12 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.12 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.1 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.1 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.07 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.02 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.98 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.95 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.95 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.91 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.89 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.88 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.88 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.88 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.87 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.86 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.86 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.84 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.84 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.84 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.84 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.84 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.83 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.83 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.81 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.81 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.81 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.81 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.8 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.79 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.79 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.79 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.79 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.77 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.77 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.77 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.77 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.76 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.76 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.76 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.74 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.74 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.74 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.74 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.74 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.74 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.74 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.73 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.73 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.72 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.72 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.71 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.71 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.71 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.71 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.68 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.68 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.67 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.66 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.63 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.59 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.59 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.52 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.5 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.49 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.38 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.37 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.37 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.37 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.25 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.95 |
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.80 E-value=3.9e-19 Score=141.29 Aligned_cols=124 Identities=19% Similarity=0.371 Sum_probs=101.4
Q ss_pred CceEEEEEe-ccchhHHHHHHHHhcCCCCceeeecccccceEEeeccc--CChhhhhhhhhccccccccccCCCCCCCch
Q 025451 60 PKEIVLKVY-MHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEK--ADPLKVLDRVQRKSHRQVELLSPIPKPTAA 136 (252)
Q Consensus 60 ~~~v~l~V~-M~C~~Ca~~Ie~aL~~l~GV~~v~vdl~~~~v~V~~~~--~d~~~i~~~I~k~~G~~a~l~s~~~~~~~~ 136 (252)
+.++.|.|. |+|.+|+.+|+++|.+++||.++.+|+.++++.|.++. .+...+...|. .+||.+.+.....
T Consensus 3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~~----- 76 (149)
T 2ew9_A 3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDYA----- 76 (149)
T ss_dssp CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCSC-----
T ss_pred cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeecccc-----
Confidence 567889999 99999999999999999999999999999999986531 25677888888 6899875432100
Q ss_pred hHhhhhhcCCCCCCCCCCCCCceEEEEEEe-cCCChhhHHHHHHHHhcCCCccc----------------CCCCHHHHHH
Q 025451 137 EEEKKAEEKAPPKPEEKKEEPQVIIVVLKV-HMHCEGCSLEIKKRILRMEGVFF----------------SFFFPQKLFR 199 (252)
Q Consensus 137 ~~~~~~~e~~~~~~~~~~~~~~~~~~~L~V-GMtCasCa~~IEkaL~k~~GV~s----------------g~~~~~~L~~ 199 (252)
....+..|.| ||+|++|+++|+++|++++||.+ +.++.++|.+
T Consensus 77 --------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~ 136 (149)
T 2ew9_A 77 --------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIK 136 (149)
T ss_dssp --------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHH
T ss_pred --------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHH
Confidence 0112457899 99999999999999999999977 2357889999
Q ss_pred HHHhcCCCeE
Q 025451 200 SFYFFGVVYF 209 (252)
Q Consensus 200 aI~~aGY~a~ 209 (252)
+|+++||.+.
T Consensus 137 ~i~~~Gy~~~ 146 (149)
T 2ew9_A 137 IIEEIGFHAS 146 (149)
T ss_dssp HHHHHTCEEE
T ss_pred HHHhCCCceE
Confidence 9999999764
|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 252 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 2e-11 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-08 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 1e-08 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 2e-08 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-08 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-08 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 0.004 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 3e-08 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 4e-08 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 5e-08 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 3e-07 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 8e-07 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 2e-06 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 7e-06 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-04 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 56.0 bits (135), Expect = 2e-11
Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 1/59 (1%)
Query: 60 PKEIVLKVYMHCEGCARKVRRCLKGFEGVEDVITDCKTHKVIVKGEKADPLKVLDRVQR 118
E + MHCE C ++ CLK G+ + D + + V+ P +++ ++
Sbjct: 5 TYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVES-SVAPSTIINTLRN 62
|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.42 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.41 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.41 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.38 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.35 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.35 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.34 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.33 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.32 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.29 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.29 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.29 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.28 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.27 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.27 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.27 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.27 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.27 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.25 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.25 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.24 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.24 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.24 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.2 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.2 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.17 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.15 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.13 |
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.42 E-value=1.5e-13 Score=96.78 Aligned_cols=65 Identities=22% Similarity=0.336 Sum_probs=60.3
Q ss_pred CCceEEEEEeccchhHHHHHHHHhcCC-CCceeeecccccceEEeecccCChhhhhhhhhcccccccc
Q 025451 59 PPKEIVLKVYMHCEGCARKVRRCLKGF-EGVEDVITDCKTHKVIVKGEKADPLKVLDRVQRKSHRQVE 125 (252)
Q Consensus 59 ~~~~v~l~V~M~C~~Ca~~Ie~aL~~l-~GV~~v~vdl~~~~v~V~~~~~d~~~i~~~I~k~~G~~a~ 125 (252)
+.+++.|+|+|||++|+++|+++|.++ +||.++.+|+.+++++|.++. +++.|.+.|+ ++||.+.
T Consensus 2 ~~kt~~f~V~MtC~~C~~~Ie~~L~~l~~gV~~v~v~~~~~~v~V~~~~-~~~~i~~~i~-~~G~~~~ 67 (72)
T d1cc8a_ 2 EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTL-PYDFILEKIK-KTGKEVR 67 (72)
T ss_dssp CCEEEEEEECCCSHHHHHHHHHHHHTTTTSEEEEEEETTTTEEEEEESS-CHHHHHHHHH-TTSSCEE
T ss_pred CcEEEEEEECcCcHHHHHHHHHHHHcCcCceEEEEEECCCCEEEEeecC-CHHHHHHHHH-HHCCccC
Confidence 467899999999999999999999999 599999999999999999986 9999999999 7999874
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|