Citrus Sinensis ID: 025513

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MLEFFFLNYHAYLLQKSLMVKMFFQDAKRAQQPSKTYIRYQTRHKRADAKRALKDLLFRSGSSNFSFQNEDPIWKFDGNCEGDIGSDRKGQSKSSARRFGKPDLKRKKRKFRRESFSEDFDDPETIFQERFGNRWYSWTYQKREESSFQYSTSGFEWRKHSNRTDHRTKDWENESDIESDDEQCTVGSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS
cccHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEHcHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccEEEEEEcccccccccccccccEEccccccccccccccccccccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHc
MLEFFFLNYHAYLLQKSLMVKMFFQDakraqqpsktyIRYQTRHKRADAKRALKDLLFrsgssnfsfqnedpiwkfdgncegdigsdrkgqskssarrfgkpdlkrkkrkfrresfsedfddpetifqerfgnrwyswtyqkreessfqystsgfewrkhsnrtdhrtkdwenesdiesddeqctvgsssdrtilglppsgplklddvKNAFRLSalkwhpdkhqgssqAMAEEKFKLCLNAYKSLCAALS
MLEFFFLNYHAYLLQKSLMVKMFFQDAKraqqpsktyiryqtrhkrADAKRALKDLLFRsgssnfsfqnedpiWKFDGNCEGdigsdrkgqskssarrfgkpdlkrkkrkfrresfsedfddpetifqerfgnrWYSWTYQKREEssfqystsgfewrkhsnrtdhrtkdwenesdiesddeqctvgsssdrtilglppsgplkLDDVKNAFRLSALkwhpdkhqgssQAMAEEKFKLCLNAYKSLCAALS
MLEFFFLNYHAYLLQKSLMVKMFFQDAKRAQQPSKTYIRYQTRHKRADAKRALKDLLFRSGSSNFSFQNEDPIWKFDGNCEGDIGSDRKGQSKSSARRFGKPDLkrkkrkfrresfseDFDDPETIFQERFGNRWYSWTYQKREESSFQYSTSGFEWRKHSNRTDHRTKDWENESDIESDDEQCTVGSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS
**EFFFLNYHAYLLQKSLMVKMFFQDA********TYIRYQ***********LKDLLFR*****FSFQNEDPIWKFDGNC********************************************TIFQERFGNRWYSWTYQK*******************************************************************NAFRLSALKW***************KFKLCLNAYKSLCA***
MLEFFFLNYHAYLLQKSLMVKMF***************************RALKDLLFRSGS************************************************FRRESFSEDFDDPETIFQERFGNRWYSWT****************************************************RTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGS**AMAEEKFKLCLNAYKSLCAAL*
MLEFFFLNYHAYLLQKSLMVKMFFQDAKRAQQPSKTYIRYQTRHKRADAKRALKDLLFRSGSSNFSFQNEDPIWKFDGNCEGDI***************GKPDLKRKKRKFRRESFSEDFDDPETIFQERFGNRWYSWTYQKREESSFQYSTSGFEW*********************************DRTILGLPPSGPLKLDDVKNAFRLSALKWH***********AEEKFKLCLNAYKSLCAALS
MLEFFFLNYHAYLLQKSLMVKMFFQDAKRAQQPSKTYIRYQTRHKRADAKRALKDLLFRSG************************************************KFRRESFSEDFDDPETIFQERFGNRWYSWTYQKR********************************************SSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEFFFLNYHAYLLQKSLMVKMFFQDAKRAQQPSKTYIRYQTRHKRADAKRALKDLLFRSGSSNFSFQNEDPIWKFDGNCEGDIGSDRKGQSKSSARRFGKPDLKRKKRKFRRESFSEDFDDPETIFQERFGNRWYSWTYQKREESSFQYSTSGFEWRKHSNRTDHRTKDWENESDIESDDEQCTVGSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
A1WAR7 376 Chaperone protein DnaJ OS yes no 0.203 0.135 0.433 0.0003
A9BNG6 380 Chaperone protein DnaJ OS yes no 0.163 0.107 0.512 0.0003
B9MDJ8 376 Chaperone protein DnaJ OS yes no 0.203 0.135 0.433 0.0006
>sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 194 ILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSL 246
           +LG+P +     D++K A+R  A+K+HPD++QG +   AEEKFK    AY+ L
Sbjct: 9   VLGVPKNA--SDDEIKKAYRKLAMKYHPDRNQGDAAKPAEEKFKEAKEAYEIL 59
Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Acidovorax sp. (strain JS42) (taxid: 232721)
>sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
255562395255 heat shock protein binding protein, puta 0.868 0.854 0.586 4e-71
225431605285 PREDICTED: uncharacterized protein LOC10 0.884 0.778 0.621 2e-68
356509006263 PREDICTED: uncharacterized protein LOC10 0.944 0.901 0.564 6e-65
356530728262 PREDICTED: uncharacterized protein LOC10 0.856 0.820 0.601 8e-65
388513353273 unknown [Medicago truncatula] 0.880 0.809 0.588 1e-61
357464517283 hypothetical protein MTR_3g095470 [Medic 0.880 0.780 0.572 2e-60
449459294275 PREDICTED: uncharacterized protein LOC10 0.928 0.847 0.534 3e-59
449511167283 PREDICTED: uncharacterized protein LOC10 0.892 0.791 0.540 4e-59
118483161268 unknown [Populus trichocarpa] 0.864 0.809 0.548 1e-58
224116654264 predicted protein [Populus trichocarpa] 0.864 0.821 0.548 2e-58
>gi|255562395|ref|XP_002522204.1| heat shock protein binding protein, putative [Ricinus communis] gi|223538575|gb|EEF40179.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 149/254 (58%), Positives = 176/254 (69%), Gaps = 36/254 (14%)

Query: 28  KRAQQPSK---------TYIRYQTRHKRADAKRALKDLLFRSGSSNFSFQ---------- 68
           +R QQPSK          YIRY  R KRADAKRALKDLLF+SG++  SFQ          
Sbjct: 8   RRFQQPSKFPDTEIFIQNYIRYAVRQKRADAKRALKDLLFKSGATKASFQSGQINYFIWV 67

Query: 69  -----------NEDPIWKFDGNCEGDIGSDRKGQSKSSARRFGKPDLKRKKRKFRRESFS 117
                      +E+PIW FD   E   G+D+K Q KSSAR   K +  + KRKFRRESF+
Sbjct: 68  VIHALLCTRTQDEEPIWSFDP--EQPKGTDKKRQPKSSARNSRKFNHNKMKRKFRRESFT 125

Query: 118 EDFDDPETIFQERFGNRWYSWTYQKREESSFQYSTSGFEWRKHSNRTDHRTKDWENESDI 177
           +D DDPET+FQ  FGNRWY+W++    ESSF+ ST GFEWR+H N+T HR K W   +D 
Sbjct: 126 DD-DDPETMFQATFGNRWYTWSFN---ESSFRSSTFGFEWREHPNQTHHRDKKWNFGTDT 181

Query: 178 ESDDEQCTVGSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFK 237
           ESD E C++GS  DRTILGLP SGPL+++DVKNAFR+SALKWHPDKHQG SQA AEEKFK
Sbjct: 182 ESDSESCSIGSYHDRTILGLPASGPLRIEDVKNAFRMSALKWHPDKHQGPSQAKAEEKFK 241

Query: 238 LCLNAYKSLCAALS 251
           LC+NAYKSLC ALS
Sbjct: 242 LCVNAYKSLCDALS 255

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431605|ref|XP_002282776.1| PREDICTED: uncharacterized protein LOC100267710 [Vitis vinifera] gi|296088617|emb|CBI37608.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356509006|ref|XP_003523243.1| PREDICTED: uncharacterized protein LOC100526896 [Glycine max] Back     alignment and taxonomy information
>gi|356530728|ref|XP_003533932.1| PREDICTED: uncharacterized protein LOC100787858 [Glycine max] Back     alignment and taxonomy information
>gi|388513353|gb|AFK44738.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357464517|ref|XP_003602540.1| hypothetical protein MTR_3g095470 [Medicago truncatula] gi|355491588|gb|AES72791.1| hypothetical protein MTR_3g095470 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449459294|ref|XP_004147381.1| PREDICTED: uncharacterized protein LOC101222821 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511167|ref|XP_004163882.1| PREDICTED: uncharacterized protein LOC101224255 [Cucumis sativus] Back     alignment and taxonomy information
>gi|118483161|gb|ABK93486.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116654|ref|XP_002331893.1| predicted protein [Populus trichocarpa] gi|222874642|gb|EEF11773.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:504955938268 AT2G18465 "AT2G18465" [Arabido 0.844 0.791 0.413 7.4e-34
TAIR|locus:2064622263 AT2G42080 "AT2G42080" [Arabido 0.525 0.501 0.442 3.8e-23
TAIR|locus:2095818254 AT3G58020 [Arabidopsis thalian 0.800 0.791 0.357 2.8e-18
GENEDB_PFALCIPARUM|PFE0055c 402 PFE0055c "heat shock protein, 0.390 0.243 0.339 0.00029
UNIPROTKB|Q8I489 402 PFE0055c "Heat shock protein, 0.390 0.243 0.339 0.00029
UNIPROTKB|Q5T657155 DNAJB5 "DnaJ homolog subfamily 0.191 0.309 0.490 0.00039
UNIPROTKB|B0CM59 277 DNAJB2 "DnaJ homolog, subfamil 0.199 0.180 0.452 0.00072
UNIPROTKB|Q58DD3 278 DNAJB2 "DnaJ (Hsp40) homolog, 0.199 0.179 0.452 0.00072
ZFIN|ZDB-GENE-040801-192 340 dnajb4 "DnaJ (Hsp40) homolog, 0.151 0.111 0.536 0.00081
UNIPROTKB|P25686 324 DNAJB2 "DnaJ homolog subfamily 0.199 0.154 0.452 0.00098
TAIR|locus:504955938 AT2G18465 "AT2G18465" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 95/230 (41%), Positives = 122/230 (53%)

Query:    26 DAKRAQQPSKTYIRYQTRHK-RADAKRALKDLLFRSGSSNFSFQNEDPIWKFDGNCEGDI 84
             + +R+ + S        + K R  AK+ +  LLF  G  N   QNE   W F  +    +
Sbjct:    53 EGERSSKNSSIRFTCTVKEKGRTSAKKTVDKLLFHRGI-NDPLQNE---WHFGPS---PL 105

Query:    85 GSDRKGQSKSSARRFGKPDLXXXXXXXXXXXXXXDFDDPETIFQERFGNRWYS-WTYQKR 143
               DR  + KS   R  KP                DF    T     F N+W   WT Q +
Sbjct:   106 IRDRHMKKKSPPGRGKKPRDKKTKRWHREGNPDDDFG---TDANNTFENKWRERWTAQSQ 162

Query:   144 EESSFQYSTSGFEWRKHSNRT--DHRTKDWENESDIESDDEQCTVGSSSDRTILGLPPSG 201
             + S  + ST+GFEWR+  + T    R+K W  ES     DE   V   S+R +LGLP  G
Sbjct:   163 KASYSKDSTAGFEWREGWSWTTQSQRSKSWNKESF----DEPLNVEFRSERIVLGLPLDG 218

Query:   202 PLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS 251
             P+K+DDVKNAFR SALKWHPDKHQG SQ  A+EKFKLC++AYKSLC+AL+
Sbjct:   219 PIKVDDVKNAFRSSALKWHPDKHQGPSQVAAQEKFKLCVDAYKSLCSALA 268
GO:0006457 "protein folding" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
TAIR|locus:2064622 AT2G42080 "AT2G42080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095818 AT3G58020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFE0055c PFE0055c "heat shock protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I489 PFE0055c "Heat shock protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T657 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0CM59 DNAJB2 "DnaJ homolog, subfamily B, member 2, isoform 1 (Predicted)" [Papio anubis (taxid:9555)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DD3 DNAJB2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-192 dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P25686 DNAJB2 "DnaJ homolog subfamily B member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 6e-10
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-07
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-07
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-06
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-06
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 4e-06
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-05
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-05
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 6e-05
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-04
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-04
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-04
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 0.001
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 0.002
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 0.002
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 0.002
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 0.003
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information 
 Score = 53.4 bits (129), Expect = 6e-10
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 194 ILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLC 247
           ILG+P    L  D++K A+R  ALK+HPDK+ G  +  AEEKFK    AY+ L 
Sbjct: 6   ILGVPRDASL--DEIKKAYRKLALKYHPDKNPG-DKEEAEEKFKEINEAYEVLS 56

Length = 60
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.77
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
PRK14288 369 chaperone protein DnaJ; Provisional 99.63
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.63
PRK14296 372 chaperone protein DnaJ; Provisional 99.63
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.6
PRK14279 392 chaperone protein DnaJ; Provisional 99.59
PRK14286 372 chaperone protein DnaJ; Provisional 99.59
PRK14282 369 chaperone protein DnaJ; Provisional 99.57
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.57
PRK14287 371 chaperone protein DnaJ; Provisional 99.56
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.55
PRK14297 380 chaperone protein DnaJ; Provisional 99.55
PRK14285 365 chaperone protein DnaJ; Provisional 99.55
PRK14283 378 chaperone protein DnaJ; Provisional 99.55
PRK14276 380 chaperone protein DnaJ; Provisional 99.55
PRK14277 386 chaperone protein DnaJ; Provisional 99.55
PRK14295 389 chaperone protein DnaJ; Provisional 99.54
PRK14294 366 chaperone protein DnaJ; Provisional 99.54
PRK14301 373 chaperone protein DnaJ; Provisional 99.54
PRK14299 291 chaperone protein DnaJ; Provisional 99.54
PRK10767 371 chaperone protein DnaJ; Provisional 99.53
PRK14280 376 chaperone protein DnaJ; Provisional 99.53
PRK14278 378 chaperone protein DnaJ; Provisional 99.53
PRK14298 377 chaperone protein DnaJ; Provisional 99.52
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
PRK14281 397 chaperone protein DnaJ; Provisional 99.51
PRK14291 382 chaperone protein DnaJ; Provisional 99.51
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.49
PRK14289 386 chaperone protein DnaJ; Provisional 99.48
PRK14290 365 chaperone protein DnaJ; Provisional 99.48
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
PRK14300 372 chaperone protein DnaJ; Provisional 99.44
PRK14293 374 chaperone protein DnaJ; Provisional 99.42
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.41
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.36
PRK05014 171 hscB co-chaperone HscB; Provisional 99.34
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.33
PRK00294 173 hscB co-chaperone HscB; Provisional 99.32
PHA03102153 Small T antigen; Reviewed 99.31
PRK01356 166 hscB co-chaperone HscB; Provisional 99.28
PRK03578 176 hscB co-chaperone HscB; Provisional 99.27
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.25
PTZ00100116 DnaJ chaperone protein; Provisional 99.24
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.13
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.11
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.07
PHA02624 647 large T antigen; Provisional 98.95
PRK01773 173 hscB co-chaperone HscB; Provisional 98.93
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 98.93
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.89
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.76
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 98.7
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 98.67
PRK14284 391 chaperone protein DnaJ; Provisional 98.63
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 98.54
PRK14292 371 chaperone protein DnaJ; Provisional 98.49
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.24
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.13
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.08
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 97.76
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.71
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.9
KOG0431453 consensus Auxilin-like protein and related protein 96.69
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.5
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.59
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 90.93
PF1344662 RPT: A repeated domain in UCH-protein 86.19
PF14687112 DUF4460: Domain of unknown function (DUF4460) 84.66
TIGR00714 157 hscB Fe-S protein assembly co-chaperone HscB. This 84.42
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.77  E-value=2.6e-19  Score=170.00  Aligned_cols=61  Identities=34%  Similarity=0.516  Sum_probs=57.4

Q ss_pred             CccccccccCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCchHHHHHHHHHHHHHHHHhcccCC
Q 025513          187 GSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAALS  251 (251)
Q Consensus       187 ~~~d~YeVLGL~~~a~~s~~eIKkAYRkLalk~HPDK~~~~~k~~AeekFq~I~eAYevLsDp~k  251 (251)
                      ...|||+||||+++|  +.+|||+|||+||++||||+|++.  ++|+++|++|++||+||+||+|
T Consensus         2 ~~~dyYeiLGV~k~A--s~~EIKkAYRkLA~kyHPD~n~g~--~~AeeKFKEI~eAYEVLsD~eK   62 (371)
T COG0484           2 AKRDYYEILGVSKDA--SEEEIKKAYRKLAKKYHPDRNPGD--KEAEEKFKEINEAYEVLSDPEK   62 (371)
T ss_pred             CccchhhhcCCCCCC--CHHHHHHHHHHHHHHhCCCCCCCC--HHHHHHHHHHHHHHHHhCCHHH
Confidence            357999999999999  999999999999999999999974  6999999999999999999975

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-04
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 4e-04
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 3/54 (5%)
Query: 194 ILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLC 247
           IL +P S     DD+K A+R  AL+WHPDK+   ++  AE+KFK    AY+ L 
Sbjct: 7   ILDVPRSA--SADDIKKAYRRKALQWHPDKNP-DNKEFAEKKFKEVAEAYEVLS 57
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-08
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 8e-08
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 8e-08
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-08
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-07
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-07
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-07
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-07
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-07
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-07
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 9e-07
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-06
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-06
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-06
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-06
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 7e-06
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 7e-06
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 8e-06
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 8e-06
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-05
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 1e-05
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-05
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 5e-05
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 6e-05
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 7e-05
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 1e-04
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-04
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 5e-04
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
 Score = 48.6 bits (116), Expect = 4e-08
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 3/53 (5%)

Query: 194 ILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSL 246
           ++       L   + K   R   LKWHPDK+   +  +A E FK   N    L
Sbjct: 21  VVEQAWK--LPESERKKIIRRLYLKWHPDKNPE-NHDIANEVFKHLQNEINRL 70
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.68
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.67
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.67
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.66
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.66
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.65
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.64
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.64
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.64
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.64
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.62
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.62
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.62
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.61
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.61
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.58
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.58
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.57
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.56
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.56
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.56
2guz_A71 Mitochondrial import inner membrane translocase su 99.56
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.54
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.52
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 99.5
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 99.5
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.49
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.49
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.47
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.46
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.37
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.29
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.2
2guz_B65 Mitochondrial import inner membrane translocase su 98.78
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.68
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 81.84
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.68  E-value=3.9e-17  Score=124.36  Aligned_cols=63  Identities=27%  Similarity=0.350  Sum_probs=56.9

Q ss_pred             CCccccccccCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC----chHHHHHHHHHHHHHHHHhcccC
Q 025513          186 VGSSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGS----SQAMAEEKFKLCLNAYKSLCAAL  250 (251)
Q Consensus       186 ~~~~d~YeVLGL~~~a~~s~~eIKkAYRkLalk~HPDK~~~~----~k~~AeekFq~I~eAYevLsDp~  250 (251)
                      +...++|+||||++++  +.++||+|||+|+++||||+++..    .++.++++|++|++||++|+||.
T Consensus        13 ~~~~~~y~iLgv~~~a--s~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~~~~~f~~i~~Ay~~L~d~~   79 (94)
T 1wjz_A           13 TLKKDWYSILGADPSA--NMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEE   79 (94)
T ss_dssp             SSCSCHHHHTTCCTTC--CHHHHHHHHHHTTSSSCSTTCCTTCCHHHHHHHHHHHHHHHHHHHHHSSSS
T ss_pred             CCCCChHHHcCCCCCC--CHHHHHHHHHHHHHHHCcCCCCCCCChhhhHHHHHHHHHHHHHHHHHCCHH
Confidence            4457999999999999  999999999999999999998742    24679999999999999999986
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-04
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSC20 (HSCB), N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 36.5 bits (84), Expect = 3e-04
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 3/56 (5%)

Query: 194 ILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAE---EKFKLCLNAYKSL 246
           + GLP    L    +   F+    ++HPDK    SQA      ++      A+++L
Sbjct: 6   LFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQTL 61

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.71
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.66
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.64
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.59
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.57
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.55
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.49
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.71  E-value=5.6e-18  Score=124.37  Aligned_cols=59  Identities=32%  Similarity=0.549  Sum_probs=54.8

Q ss_pred             ccccccccCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCchHHHHHHHHHHHHHHHHhcccC
Q 025513          188 SSSDRTILGLPPSGPLKLDDVKNAFRLSALKWHPDKHQGSSQAMAEEKFKLCLNAYKSLCAAL  250 (251)
Q Consensus       188 ~~d~YeVLGL~~~a~~s~~eIKkAYRkLalk~HPDK~~~~~k~~AeekFq~I~eAYevLsDp~  250 (251)
                      ..|||+||||++++  +.++||+|||+|+++||||++++.  +.+++.|++|++||+||+||.
T Consensus         2 k~dyY~vLgv~~~A--s~~eIk~aYr~l~~~~HPDk~~~~--~~~~~~f~~i~~Ay~vL~d~~   60 (75)
T d1xbla_           2 KQDYYEILGVSKTA--EEREIRKAYKRLAMKYHPDRNQGD--KEAEAKFKEIKEAYEVLTDSQ   60 (75)
T ss_dssp             CCCTTTTTCCSSSC--CHHHHHHHHHHHHHHTCCTTCTTT--CHHHHHHHHHHHHHHHTTSSH
T ss_pred             CCCHHHHcCCCCCc--CHHHHHHHHHHHHhhhhhhccCCC--hHHHHHHHHHHHHHHhcCCHH
Confidence            36899999999999  999999999999999999999875  468899999999999999985
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure