Citrus Sinensis ID: 025645

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
cccccccEEEEEEcccccHHHHHHcccHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEccccccEEEEEEEEEccccccccccccccccccEEEEEEEEccccccccccEEEEEEcccccccEEEEccEEEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccc
cccccccEEEEEEEccccHHHEEHHccHHHHHHHHHHHHHHHcccEEEEccccccHHHHHcccEEEEEccccccccccHHHHccccccHHHHHccccEEEEEHHHHHHHHHHccEEEcccccccEcEEEEEEccccHHHHHHHHHcccccccEEEEEcccEEEEcccccEEEEEcccccEEEEEccccEEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccc
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAfgeegerwdlfrvvegdfpdfndlhkydgfvisgspydaygndnWILKLCFMLQTLDAMQKKVLGICFGHQVLCRAlggkvgkaytgwdiglrrvrivndlapcsfledlgeipgslsimechrdevwkvpigaevigfsdktgvEMFTIGDHilgiqghpeytKDILYNLIDRLLNNNSIEREFAENAKfgleiaepdRKCWEKICRNFLKGTL
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFgleiaepdrkcwEKICRNFLKGTL
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
*******RYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFL****
*****EK***LFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
****EEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICRNFLKGTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
Q12288251 Putative glutamine amidot yes no 0.764 0.760 0.300 3e-17
Q09686248 Putative glutamine amidot yes no 0.648 0.653 0.248 3e-12
Q8X239188 GMP synthase [glutamine-h no no 0.52 0.691 0.319 1e-10
Q4FMW8 521 GMP synthase [glutamine-h yes no 0.488 0.234 0.295 7e-10
O28949183 GMP synthase [glutamine-h yes no 0.628 0.857 0.337 4e-09
Q97VZ9188 GMP synthase [glutamine-h yes no 0.636 0.845 0.298 5e-09
Q974T4188 GMP synthase [glutamine-h yes no 0.508 0.675 0.345 7e-09
A6UQ90189 GMP synthase [glutamine-h yes no 0.376 0.497 0.346 8e-09
Q492E5 525 GMP synthase [glutamine-h yes no 0.512 0.243 0.310 1e-08
B3CPU7 520 GMP synthase [glutamine-h yes no 0.564 0.271 0.264 1e-08
>sp|Q12288|YL126_YEAST Putative glutamine amidotransferase YLR126C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR126C PE=1 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 109/213 (51%), Gaps = 22/213 (10%)

Query: 4   MEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGE--------EGERWDLFRVVEGDFPD 55
           M  K+ A+    +D+++  K +G + ++ +    +        E   +++F V +  FP 
Sbjct: 1   MTVKKIAILYTDEDNEWS-KPWGNFVDMAIKLLEQTRKLECIAEDVEYEVFHVQKNVFPQ 59

Query: 56  FNDLHK--YDGFVISGSPYDAYGND-NWILKL-CFMLQTLDAMQK--KVLGICFGHQVLC 109
            +DL K  Y G  I+GS YD++ N+  WI+KL  F+ + L +  +   V GICFGHQV+ 
Sbjct: 60  LSDLQKDEYLGIYITGSKYDSFDNEIEWIMKLRSFLNEMLTSKTEYPPVAGICFGHQVIA 119

Query: 110 RALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGA 169
            ALG  VG+   G++ G+  +++ N +    F          L++ E H D V+ VP G 
Sbjct: 120 AALGSSVGRNPKGFEGGVVSLKL-NSVGQKLFGAQ------ELNLSEVHSDCVFDVPEGY 172

Query: 170 EVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDI 202
           +    S+K   + F   + +L  QGHPE+  D+
Sbjct: 173 QNWASSEKCQNQGFYRQNRVLTFQGHPEFNSDV 205
May have a role in copper and iron homeostasis.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: -
>sp|Q09686|YA14_SCHPO Putative glutamine amidotransferase-like protein C13C5.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.04 PE=4 SV=1 Back     alignment and function description
>sp|Q8X239|GUAAA_SULAC GMP synthase [glutamine-hydrolyzing] subunit A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=guaAA PE=3 SV=3 Back     alignment and function description
>sp|Q4FMW8|GUAA_PELUB GMP synthase [glutamine-hydrolyzing] OS=Pelagibacter ubique (strain HTCC1062) GN=guaA PE=3 SV=1 Back     alignment and function description
>sp|O28949|GUAAA_ARCFU GMP synthase [glutamine-hydrolyzing] subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=guaAA PE=3 SV=1 Back     alignment and function description
>sp|Q97VZ9|GUAAA_SULSO GMP synthase [glutamine-hydrolyzing] subunit A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=guaAA PE=3 SV=1 Back     alignment and function description
>sp|Q974T4|GUAAA_SULTO GMP synthase [glutamine-hydrolyzing] subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=guaAA PE=3 SV=1 Back     alignment and function description
>sp|A6UQ90|GUAAA_METVS GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=guaAA PE=3 SV=1 Back     alignment and function description
>sp|Q492E5|GUAA_BLOPB GMP synthase [glutamine-hydrolyzing] OS=Blochmannia pennsylvanicus (strain BPEN) GN=guaA PE=3 SV=1 Back     alignment and function description
>sp|B3CPU7|GUAA_WOLPP GMP synthase [glutamine-hydrolyzing] OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=guaA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
255574952252 GMP synthase [glutamine-hydrolyzing] sub 0.992 0.984 0.838 1e-122
224142339249 predicted protein [Populus trichocarpa] 0.992 0.995 0.846 1e-122
225445761248 PREDICTED: putative glutamine amidotrans 0.984 0.991 0.849 1e-121
147811275 499 hypothetical protein VITISV_013737 [Viti 0.856 0.428 0.855 1e-107
449457859252 PREDICTED: putative glutamine amidotrans 0.964 0.956 0.681 3e-95
356562539249 PREDICTED: putative glutamine amidotrans 0.984 0.987 0.676 2e-91
357153700264 PREDICTED: putative glutamine amidotrans 0.952 0.901 0.605 3e-81
297821657251 predicted protein [Arabidopsis lyrata su 0.968 0.964 0.579 1e-80
15224079251 glutamine amidotransferase class-I domai 0.968 0.964 0.583 2e-80
15234767249 class I glutamine amidotransferase domai 0.976 0.979 0.573 4e-80
>gi|255574952|ref|XP_002528382.1| GMP synthase [glutamine-hydrolyzing] subunit A, putative [Ricinus communis] gi|223532170|gb|EEF33975.1| GMP synthase [glutamine-hydrolyzing] subunit A, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/248 (83%), Positives = 230/248 (92%)

Query: 1   MDLMEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLH 60
           MD+  EKRYAL LAA+DSDYV KVYGGYFNVFVAAFGEEGERWD FRVVEG+FPD N+LH
Sbjct: 1   MDVTSEKRYALLLAARDSDYVKKVYGGYFNVFVAAFGEEGERWDSFRVVEGEFPDMNELH 60

Query: 61  KYDGFVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAY 120
            YDGFV+SGSPYDAYGND WI++LCF+LQTLD+M+KKVLGICFGHQVLCRALGGKVGKA 
Sbjct: 61  NYDGFVVSGSPYDAYGNDCWIIRLCFLLQTLDSMEKKVLGICFGHQVLCRALGGKVGKAS 120

Query: 121 TGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGV 180
           TGWDIGLR+VRIV DL PCSFL DL EIP SLSI++CH+DEVW+VP+ AEVI FSDKTGV
Sbjct: 121 TGWDIGLRKVRIVKDLPPCSFLSDLSEIPSSLSIIKCHQDEVWEVPLEAEVIAFSDKTGV 180

Query: 181 EMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEK 240
           EMF+IGDHILGIQGHPEYTKDILY+LIDRLL++N IE++FAENAKFGLEIAEPDRKCWE 
Sbjct: 181 EMFSIGDHILGIQGHPEYTKDILYSLIDRLLDSNCIEKDFAENAKFGLEIAEPDRKCWES 240

Query: 241 ICRNFLKG 248
           ICRNFLKG
Sbjct: 241 ICRNFLKG 248

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class: N/A

Phylum: Streptophyta

Superkingdom:

>gi|224142339|ref|XP_002324516.1| predicted protein [Populus trichocarpa] gi|222865950|gb|EEF03081.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445761|ref|XP_002272592.1| PREDICTED: putative glutamine amidotransferase YLR126C [Vitis vinifera] gi|297743705|emb|CBI36588.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147811275|emb|CAN70015.1| hypothetical protein VITISV_013737 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457859|ref|XP_004146665.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356562539|ref|XP_003549527.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Glycine max] Back     alignment and taxonomy information
>gi|357153700|ref|XP_003576538.1| PREDICTED: putative glutamine amidotransferase YLR126C-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297821657|ref|XP_002878711.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324550|gb|EFH54970.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15224079|ref|NP_179975.1| glutamine amidotransferase class-I domain-containing protein [Arabidopsis thaliana] gi|3738324|gb|AAC63665.1| unknown protein [Arabidopsis thaliana] gi|67633536|gb|AAY78692.1| putative defense-related protein [Arabidopsis thaliana] gi|330252415|gb|AEC07509.1| glutamine amidotransferase class-I domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15234767|ref|NP_194784.1| class I glutamine amidotransferase domain-containing protein [Arabidopsis thaliana] gi|7269956|emb|CAB79773.1| putative protein [Arabidopsis thaliana] gi|332660379|gb|AEE85779.1| class I glutamine amidotransferase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2118831249 GGP3 "AT4G30550" [Arabidopsis 0.972 0.975 0.575 1e-77
TAIR|locus:2061496251 AT2G23970 [Arabidopsis thalian 0.968 0.964 0.583 1e-77
TAIR|locus:2118821250 GGP1 "AT4G30530" [Arabidopsis 0.976 0.976 0.542 3.7e-71
TAIR|locus:2118826248 AT4G30540 "AT4G30540" [Arabido 0.952 0.959 0.539 2.4e-69
TAIR|locus:2061481251 AT2G23960 [Arabidopsis thalian 0.972 0.968 0.512 5.1e-67
UNIPROTKB|Q884M5242 PSPTO_2063 "Uncharacterized pr 0.72 0.743 0.326 1e-22
TIGR_CMR|SPO_1301226 SPO_1301 "glutamine amidotrans 0.732 0.809 0.32 5.5e-22
TIGR_CMR|SPO_0763237 SPO_0763 "glutamine amidotrans 0.628 0.662 0.345 1.2e-19
SGD|S000004116251 YLR126C "Putative glutamine am 0.896 0.892 0.301 2.5e-19
ASPGD|ASPL0000054958252 AN0200 [Emericella nidulans (t 0.648 0.642 0.331 5.1e-19
TAIR|locus:2118831 GGP3 "AT4G30550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 782 (280.3 bits), Expect = 1.0e-77, P = 1.0e-77
 Identities = 141/245 (57%), Positives = 189/245 (77%)

Query:     5 EEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDG 64
             ++KR+ALFLA  DS++V K YGGYFNVFV+ FGEEGE+WDLFRV++G FPD NDL KYDG
Sbjct:     6 QKKRFALFLATCDSEFVKKTYGGYFNVFVSTFGEEGEQWDLFRVIDGQFPDENDLDKYDG 65

Query:    65 FVISGSPYDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWD 124
             FVISGSP+DA+G+ +WI+KLC + Q LD M+KKVLGICFGHQ++ R  GGK+G+A  G D
Sbjct:    66 FVISGSPHDAFGDADWIVKLCEVCQKLDHMKKKVLGICFGHQIITRVKGGKIGRALKGAD 125

Query:   125 IGLRRVRIVNDLAPC-SFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMF 183
             +GLR + I  D      +  D+ E+P SL+I++CH+DEV ++P  A ++  S+   VEMF
Sbjct:   126 MGLRSITIAKDNEKLRGYFGDV-EVPASLAIIKCHQDEVLELPESATLLASSEVCNVEMF 184

Query:   184 TIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKICR 243
             +IGDH   IQGHPEY K+IL+ ++DR+LN   +E+EFA+ AK  +E A+PDR  W+K+C+
Sbjct:   185 SIGDHFFCIQGHPEYNKEILFEIVDRVLNMKLMEQEFADKAKSTMETAQPDRILWQKLCK 244

Query:   244 NFLKG 248
             NFLKG
Sbjct:   245 NFLKG 249
GO:0003824 "catalytic activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016746 "transferase activity, transferring acyl groups" evidence=IEA
GO:0019281 "L-methionine biosynthetic process from homoserine via O-succinyl-L-homoserine and cystathionine" evidence=IEA
GO:0005829 "cytosol" evidence=IDA;RCA
GO:0008233 "peptidase activity" evidence=IDA
GO:0019760 "glucosinolate metabolic process" evidence=IMP
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
TAIR|locus:2061496 AT2G23970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118821 GGP1 "AT4G30530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118826 AT4G30540 "AT4G30540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061481 AT2G23960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q884M5 PSPTO_2063 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1301 SPO_1301 "glutamine amidotransferase, class I" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0763 SPO_0763 "glutamine amidotransferase, class I" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
SGD|S000004116 YLR126C "Putative glutamine amidotransferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000054958 AN0200 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00180919
hypothetical protein (249 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
cd01741188 cd01741, GATase1_1, Subgroup of proteins having th 1e-48
PRK05665240 PRK05665, PRK05665, amidotransferase; Provisional 6e-33
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 1e-32
PRK09065237 PRK09065, PRK09065, glutamine amidotransferase; Pr 8e-22
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 6e-21
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 2e-15
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Valida 3e-14
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 9e-13
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 1e-11
PRK07053234 PRK07053, PRK07053, glutamine amidotransferase; Pr 1e-10
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 8e-09
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 8e-09
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 1e-08
PRK07567242 PRK07567, PRK07567, glutamine amidotransferase; Pr 2e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 3e-08
PRK06490239 PRK06490, PRK06490, glutamine amidotransferase; Pr 2e-07
PLN02347 536 PLN02347, PLN02347, GMP synthetase 3e-07
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 7e-06
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 2e-04
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase s 3e-04
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt 5e-04
TIGR01823 742 TIGR01823, PabB-fungal, aminodeoxychorismate synth 7e-04
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small s 0.002
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase 0.002
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase argin 0.003
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information 
 Score =  158 bits (401), Expect = 1e-48
 Identities = 61/173 (35%), Positives = 82/173 (47%), Gaps = 6/173 (3%)

Query: 26  GGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDA-YGNDNWILKL 84
            G F   +   G E    D+  V  G+     DL  YDG VI G P      +  W+ KL
Sbjct: 13  PGLFEDLLREAGAETIEIDVVDVYAGELL--PDLDDYDGLVILGGPMSVDEDDYPWLKKL 70

Query: 85  CFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLED 144
             +++   A  K VLGIC GHQ+L RALGGKVG+   GW+IG   V +         L  
Sbjct: 71  KELIRQALAAGKPVLGICLGHQLLARALGGKVGRNPKGWEIGWFPVTLTEA-GKADPL-- 127

Query: 145 LGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPE 197
              +P    +   H D V ++P GA ++  S+    + F  GD  LG+Q HPE
Sbjct: 128 FAGLPDEFPVFHWHGDTVVELPPGAVLLASSEACPNQAFRYGDRALGLQFHPE 180

This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188
>gnl|CDD|168162 PRK05665, PRK05665, amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|235919 PRK07053, PRK07053, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181035 PRK07567, PRK07567, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|180590 PRK06490, PRK06490, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|233588 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>gnl|CDD|223579 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 100.0
PRK05665240 amidotransferase; Provisional 100.0
PRK09065237 glutamine amidotransferase; Provisional 100.0
PRK07567242 glutamine amidotransferase; Provisional 100.0
PRK06490239 glutamine amidotransferase; Provisional 100.0
PRK07053234 glutamine amidotransferase; Provisional 100.0
PRK08250235 glutamine amidotransferase; Provisional 100.0
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 100.0
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 100.0
PRK06895190 putative anthranilate synthase component II; Provi 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisio 100.0
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 100.0
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 100.0
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 100.0
PRK07765214 para-aminobenzoate synthase component II; Provisio 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 100.0
PRK05670189 anthranilate synthase component II; Provisional 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisio 100.0
PLN02347 536 GMP synthetase 100.0
PRK08857193 para-aminobenzoate synthase component II; Provisio 100.0
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
PRK00074 511 guaA GMP synthase; Reviewed 100.0
PLN02335222 anthranilate synthase 100.0
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.98
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.97
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.97
PRK05368302 homoserine O-succinyltransferase; Provisional 99.97
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.97
PRK13566720 anthranilate synthase; Provisional 99.97
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.97
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.97
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.97
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.97
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.97
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.97
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.97
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.97
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.96
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.96
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.96
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.96
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.96
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.96
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.96
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.96
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.96
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.95
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.95
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.95
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.95
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.95
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.95
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.95
COG2071243 Predicted glutamine amidotransferases [General fun 99.94
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.94
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.94
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.94
PRK06186229 hypothetical protein; Validated 99.93
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.93
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.93
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.91
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.91
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 99.91
PRK05380533 pyrG CTP synthetase; Validated 99.9
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.9
PLN02327557 CTP synthase 99.88
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.87
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 99.85
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.85
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.84
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 99.82
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.81
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.8
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.79
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 99.77
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 99.73
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.73
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.69
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 99.69
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.68
COG0311194 PDX2 Predicted glutamine amidotransferase involved 99.68
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.66
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 99.65
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.64
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 99.53
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.39
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 99.35
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 99.35
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 99.24
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 99.22
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 99.16
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 99.02
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 99.01
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 99.0
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 98.99
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.95
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.94
PRK00784488 cobyric acid synthase; Provisional 98.94
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 98.81
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 98.67
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.65
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 98.63
PHA033661304 FGAM-synthase; Provisional 98.6
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 98.59
TIGR00313475 cobQ cobyric acid synthase CobQ. 98.48
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 98.42
COG3442250 Predicted glutamine amidotransferase [General func 98.42
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 98.38
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 98.36
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 98.33
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 98.33
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 98.27
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 98.27
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 98.26
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 98.25
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 98.2
PRK04155287 chaperone protein HchA; Provisional 98.19
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 98.18
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 98.13
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 98.07
PRK11574196 oxidative-stress-resistance chaperone; Provisional 98.04
PRK11249752 katE hydroperoxidase II; Provisional 97.87
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 97.86
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 97.81
PRK09393322 ftrA transcriptional activator FtrA; Provisional 97.8
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 97.8
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 97.74
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 97.72
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 97.69
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 97.61
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 97.48
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 97.43
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 97.41
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 97.4
COG4285253 Uncharacterized conserved protein [Function unknow 97.38
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 97.13
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 97.0
KOG2764247 consensus Putative transcriptional regulator DJ-1 96.96
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 96.83
TIGR02069250 cyanophycinase cyanophycinase. This model describe 96.56
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 96.09
PRK03372306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.18
COG3155217 ElbB Uncharacterized protein involved in an early 95.16
COG3340224 PepE Peptidase E [Amino acid transport and metabol 94.92
COG4977328 Transcriptional regulator containing an amidase do 94.87
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 94.13
COG4090154 Uncharacterized protein conserved in archaea [Func 94.02
PRK01911292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 93.63
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 93.06
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.91
PRK03708277 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.67
PRK14076569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 92.28
PRK01231295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 91.65
PLN02929301 NADH kinase 91.35
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.86
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 90.4
PRK02155291 ppnK NAD(+)/NADH kinase family protein; Provisiona 90.35
PRK14077287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 90.19
PRK02645305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.92
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 89.85
PRK09271160 flavodoxin; Provisional 88.86
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 87.63
PRK01185271 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 87.24
COG4635175 HemG Flavodoxin [Energy production and conversion 87.17
COG4126230 Hydantoin racemase [Amino acid transport and metab 86.13
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 85.24
PRK01215264 competence damage-inducible protein A; Provisional 84.95
PF09897147 DUF2124: Uncharacterized protein conserved in arch 84.57
PLN02935508 Bifunctional NADH kinase/NAD(+) kinase 84.23
PF0369880 UPF0180: Uncharacterised protein family (UPF0180); 84.03
PLN02727986 NAD kinase 83.9
PF09822271 ABC_transp_aux: ABC-type uncharacterized transport 83.76
TIGR00177144 molyb_syn molybdenum cofactor synthesis domain. Th 83.69
cd03142215 GATase1_ThuA Type 1 glutamine amidotransferase (GA 82.95
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 82.76
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 82.17
PRK0309480 hypothetical protein; Provisional 81.98
PRK06756148 flavodoxin; Provisional 81.84
cd00886152 MogA_MoaB MogA_MoaB family. Members of this family 80.81
PRK09417193 mogA molybdenum cofactor biosynthesis protein MogA 80.4
PF00885144 DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synt 80.36
PRK14075256 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 80.08
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-52  Score=323.67  Aligned_cols=243  Identities=57%  Similarity=1.030  Sum_probs=227.2

Q ss_pred             cccceEEEEecCCCChhHHHhhCCHHHHHHHHHhcCCCceEEEEeecCCCCCCCCCCCcCEEEEcCCCCCCCCCChhHHH
Q 025645            4 MEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILK   83 (250)
Q Consensus         4 ~~~~riail~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~l~~~dglIi~Gg~~~~~~~~~~~~~   83 (250)
                      |..+|||++.+.++++++..+||+|.++++.+|.+.|..|+.+++..+++|+.++|++|||+||+|+..+++++.+|+..
T Consensus         2 ~~~kr~Alf~at~dsefvk~~yGgy~nvfvsllg~ege~wd~frV~~gefP~~~Dl~ky~gfvIsGS~~dAf~d~dWI~K   81 (245)
T KOG3179|consen    2 MEQKRIALFLATPDSEFVKKAYGGYFNVFVSLLGDEGEQWDLFRVIDGEFPQEEDLEKYDGFVISGSKHDAFSDADWIKK   81 (245)
T ss_pred             ccceeEEEEecCCchhhhhhhhcCHHHHHHHHhcccCceeEEEEEecCCCCChhhhhhhceEEEeCCcccccccchHHHH
Confidence            34579999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCcEEEEehHHHHHHHHcCceEEecCCCceeeEEEEEEecC-CCCCCcccccCCCCCceEEEeeecccc
Q 025645           84 LCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVND-LAPCSFLEDLGEIPGSLSIMECHRDEV  162 (250)
Q Consensus        84 ~~~~i~~~~~~~~PilGIC~G~Qlla~a~gg~v~~~~~~~~~g~~~i~~~~~-~~~~~l~~~~~~l~~~~~~~~~H~~~v  162 (250)
                      +..+++.....++||+|||+|||+||++.||+|.|++++++++...+++... .....+|+.   +|..+.+..+|+|+|
T Consensus        82 Lcs~~kkld~mkkkvlGICFGHQiiara~Gg~Vgra~KG~~~~lg~itivk~~~~~~~yFG~---~~~~l~IikcHqDev  158 (245)
T KOG3179|consen   82 LCSFVKKLDFMKKKVLGICFGHQIIARAKGGKVGRAPKGPDLGLGSITIVKDAEKPEKYFGE---IPKSLNIIKCHQDEV  158 (245)
T ss_pred             HHHHHHHHHhhccceEEEeccHHHHHHhhCCccccCCCCCcccccceEEEEecccchhhccc---chhhhhHHhhcccce
Confidence            9999999999999999999999999999999999999997777666655432 245678886   789999999999999


Q ss_pred             cccCCccEEEEEcCCCceEEEEECCcEEEEecCCCCCHHHHHHHHHHHhcCCCccHHHHHHHHhhccccCCcHHHHHHHH
Q 025645          163 WKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNNSIEREFAENAKFGLEIAEPDRKCWEKIC  242 (250)
Q Consensus       163 ~~lp~~~~~la~s~~~~v~~~~~~~~~~g~QfHPE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  242 (250)
                      ..+|++++++|+|+.|.+++|..+++++++|+||||+.+++...++.+.....+.++|.+.+++.++..++|+..+..||
T Consensus       159 le~PE~a~llasSe~ceve~fs~~~~~l~fQGHPEyn~eil~~ivdrv~~~k~~~eef~~~ak~~~En~~~d~~~~~~ic  238 (245)
T KOG3179|consen  159 LELPEGAELLASSEKCEVEMFSIEDHLLCFQGHPEYNKEILFEIVDRVLGTKLVEEEFAEKAKKTMENPEPDRQLAVSIC  238 (245)
T ss_pred             ecCCchhhhhccccccceEEEEecceEEEecCCchhhHHHHHHHHHHHhcchhhHHHHHHHHHHhhhCCCccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999888888999999999999999999999999999


Q ss_pred             HHHhccC
Q 025645          243 RNFLKGT  249 (250)
Q Consensus       243 ~~f~~~~  249 (250)
                      .+||+.|
T Consensus       239 KnfLkgr  245 (245)
T KOG3179|consen  239 KNFLKGR  245 (245)
T ss_pred             HHHhccC
Confidence            9999986

>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG4090 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02929 NADH kinase Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>PRK01215 competence damage-inducible protein A; Provisional Back     alignment and domain information
>PF09897 DUF2124: Uncharacterized protein conserved in archaea (DUF2124); InterPro: IPR009183 There are currently no experimental data for members of this group of archaeal proteins, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02935 Bifunctional NADH kinase/NAD(+) kinase Back     alignment and domain information
>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins Back     alignment and domain information
>TIGR00177 molyb_syn molybdenum cofactor synthesis domain Back     alignment and domain information
>cd03142 GATase1_ThuA Type 1 glutamine amidotransferase (GATase1)-like domain found in Sinorhizobium meliloti Rm1021 ThuA (SmThuA) Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK03094 hypothetical protein; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>cd00886 MogA_MoaB MogA_MoaB family Back     alignment and domain information
>PRK09417 mogA molybdenum cofactor biosynthesis protein MogA; Provisional Back     alignment and domain information
>PF00885 DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synthase; InterPro: IPR002180 6,7-dimethyl-8-ribityllumazine synthase (riboflavin synthase) catalyses the biosynthesis of riboflavin according to the reaction: 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine Back     alignment and domain information
>PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 6e-06
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 1e-05
2a9v_A212 Crystal Structure Of A Putative Gmp Synthase Subuni 2e-05
1gpm_A 525 Escherichia Coli Gmp Synthetase Complexed With Amp 4e-05
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 5e-05
3tqi_A 527 Structure Of The Gmp Synthase (Guaa) From Coxiella 5e-05
2vpi_A218 Human Gmp Synthetase - Glutaminase Domain Length = 6e-05
2ywc_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 2e-04
1o1y_A239 Crystal Structure Of A Glutamine Amidotransferase ( 2e-04
2ywb_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 3e-04
3m3p_A250 Crystal Structure Of Glutamine Amido Transferase Fr 4e-04
1qdl_B195 The Crystal Structure Of Anthranilate Synthase From 6e-04
>pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 60/137 (43%), Gaps = 15/137 (10%)
Query: 63  DGFVISGSP-YDAYGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYT 121
            G + SG P  +  GN   +L      +  D     +LGIC GHQ++ +  GGKVG+   
Sbjct: 45  KGIIFSGGPSLENTGNCEKVL------EHYDEFNVPILGICLGHQLIAKFFGGKVGR--- 95
Query: 122 GWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVWKVPIGAEVIGFSDKTGVE 181
           G       V I        F      +P  L + E H DEV ++P   +++  S+   +E
Sbjct: 96  GEKAEYSLVEIEIIDEXEIF----KGLPKRLKVWESHMDEVKELPPKFKILARSETXPIE 151
Query: 182 MFTIGD-HILGIQGHPE 197
                +  I G+Q HPE
Sbjct: 152 AMKHEELPIYGVQFHPE 168
>pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure
>pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45 A Resolution Length = 212 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>pdb|3TQI|A Chain A, Structure Of The Gmp Synthase (Guaa) From Coxiella Burnetii Length = 527 Back     alignment and structure
>pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 Back     alignment and structure
>pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>pdb|1O1Y|A Chain A, Crystal Structure Of A Glutamine Amidotransferase (tm1158) From Thermotoga Maritima At 1.70 A Resolution Length = 239 Back     alignment and structure
>pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>pdb|3M3P|A Chain A, Crystal Structure Of Glutamine Amido Transferase From Methylobacillus Flagellatus Length = 250 Back     alignment and structure
>pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
3m3p_A250 Glutamine amido transferase; structural genomics, 3e-47
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 1e-44
3l7n_A236 Putative uncharacterized protein; glutamine amidot 1e-41
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 3e-24
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 4e-16
2a9v_A212 GMP synthase; structural genomics, joint center fo 1e-12
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 6e-12
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 2e-11
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 3e-11
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 4e-11
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 6e-11
3uow_A 556 GMP synthetase; structural genomics consortium, SG 4e-10
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 6e-10
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 2e-09
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 3e-07
1i1q_B192 Anthranilate synthase component II; tryptophan bio 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 6e-04
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 6e-04
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 8e-04
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure
 Score =  156 bits (395), Expect = 3e-47
 Identities = 45/228 (19%), Positives = 83/228 (36%), Gaps = 19/228 (8%)

Query: 32  FVAAFGEEGERWDLFRVVEGD-FPDFNDLHKYDGFVISGSPYDAYGNDNWILKLCFMLQT 90
           F      E   + + R+   D  P   ++    G  + G P  A  +  W+  L  +++ 
Sbjct: 20  FGDFLAGEHIPFQVLRMDRSDPLPA--EIRDCSGLAMMGGPMSANDDLPWMPTLLALIRD 77

Query: 91  LDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPG 150
             A +  V+G C G Q+L +A+GG+V  +     IG  R    +      +L    E+  
Sbjct: 78  AVAQRVPVIGHCLGGQLLAKAMGGEVTDSPHAE-IGWVRAWPQHVPQALEWLGTWDELE- 135

Query: 151 SLSIMECHRDEVWKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDR- 209
              + E H    + +P GA  I  S+    + + + D  +G Q H E    ++       
Sbjct: 136 ---LFEWHYQ-TFSIPPGAVHILRSEHCANQAYVLDDLHIGFQCHIEMQAHMVREWCSIS 191

Query: 210 --LLNNNSIEREFAENAKFGLEIAEPD-------RKCWEKICRNFLKG 248
              L   +         +  +EI            +  E +   ++KG
Sbjct: 192 PEELKGGAEADPAQPMVQSAVEILRDLDVRIATLNRWAEHVYARWIKG 239
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Length = 301 Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Length = 312 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Length = 191 Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
3m3p_A250 Glutamine amido transferase; structural genomics, 100.0
3l7n_A236 Putative uncharacterized protein; glutamine amidot 100.0
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 100.0
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 100.0
2a9v_A212 GMP synthase; structural genomics, joint center fo 100.0
3uow_A 556 GMP synthetase; structural genomics consortium, SG 100.0
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 100.0
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 100.0
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 100.0
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 100.0
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 100.0
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.98
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.98
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.97
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.97
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.97
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.97
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.96
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.96
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.96
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.96
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.96
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.96
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.96
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.96
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.96
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.95
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.95
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.94
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.94
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.93
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.93
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.92
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.92
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.91
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.29
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 98.87
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 98.79
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 98.78
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 98.59
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 98.58
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 98.57
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 98.57
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 98.49
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 98.47
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 98.47
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 98.42
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 98.39
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 98.39
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 98.3
3cne_A175 Putative protease I; structural genomics, PSI-2, M 98.28
3er6_A209 Putative transcriptional regulator protein; struct 98.27
3gra_A202 Transcriptional regulator, ARAC family; transcript 98.26
1u9c_A224 APC35852; structural genomics, protein structure i 98.25
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 98.24
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 98.23
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 98.22
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 98.18
3n7t_A247 Macrophage binding protein; seattle structural gen 98.15
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 98.14
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 98.13
2fex_A188 Conserved hypothetical protein; structural genomic 98.08
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 98.03
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 97.99
3mgk_A211 Intracellular protease/amidase related enzyme (THI 97.98
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 97.95
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 97.92
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 97.9
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 97.89
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 97.59
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 97.23
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 97.12
4e5v_A281 Putative THUA-like protein; THUA-like proteins, tr 96.13
1t0b_A252 THUA-like protein; trehalose metabolism, NCS symme 96.05
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 94.48
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 93.52
2r47_A157 Uncharacterized protein MTH_862; unknown function, 91.8
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 91.05
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 89.9
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; A 89.53
1y5e_A169 Molybdenum cofactor biosynthesis protein B; struct 88.89
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 88.88
2pjk_A178 178AA long hypothetical molybdenum cofactor biosyn 88.37
3pzy_A164 MOG; ssgcid, seattle structural genomics center fo 88.14
2an1_A292 Putative kinase; structural genomics, PSI, protein 87.63
3l6u_A293 ABC-type sugar transport system periplasmic compo; 87.62
1mkz_A172 Molybdenum cofactor biosynthesis protein B; MAD, W 87.27
3iwt_A178 178AA long hypothetical molybdenum cofactor biosy 86.58
2zki_A199 199AA long hypothetical Trp repressor binding prot 85.87
3kbq_A172 Protein TA0487; structural genomics, CINA, protein 85.18
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 84.41
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 84.36
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 84.3
3rfq_A185 Pterin-4-alpha-carbinolamine dehydratase MOAB2; st 84.2
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 83.96
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 83.65
4gi5_A280 Quinone reductase; protein structure initiative, F 83.42
2zuv_A759 Lacto-N-biose phosphorylase; beta-alpha-barrel, TI 83.35
3h75_A 350 Periplasmic sugar-binding domain protein; protein 82.95
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 82.66
1di6_A195 MOGA, molybdenum cofactor biosynthetic enzyme; MOC 82.22
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 81.56
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 81.29
3qk7_A294 Transcriptional regulators; structural genomics, N 81.0
3gbv_A304 Putative LACI-family transcriptional regulator; NY 80.52
3pfn_A365 NAD kinase; structural genomics consortium, SNP, S 80.49
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 80.44
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
Probab=100.00  E-value=6.1e-40  Score=274.03  Aligned_cols=192  Identities=21%  Similarity=0.296  Sum_probs=164.6

Q ss_pred             cccceEEEEecCCCChhHHHhhCCHHHHHHHHHhcCCCceEEEEeecCCCCCCCCCCCcCEEEEcCCCCCCCCCChhHHH
Q 025645            4 MEEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGNDNWILK   83 (250)
Q Consensus         4 ~~~~riail~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~l~~~dglIi~Gg~~~~~~~~~~~~~   83 (250)
                      |+.++|+||.......         .+++.++|++.|.++.++++..++. .+.++.++|||||+||+.+++++.+|+..
T Consensus         1 m~~~~vliiqh~~~e~---------~~~i~~~l~~~G~~v~v~~~~~~~~-~p~~~~~~d~lIl~GGp~~~~d~~~~~~~   70 (250)
T 3m3p_A            1 MSLKPVMIIQFSASEG---------PGHFGDFLAGEHIPFQVLRMDRSDP-LPAEIRDCSGLAMMGGPMSANDDLPWMPT   70 (250)
T ss_dssp             -CCCCEEEEESSSSCC---------CHHHHHHHHHTTCCEEEEEGGGTCC-CCSCGGGSSEEEECCCSSCTTSCCTTHHH
T ss_pred             CCCCeEEEEECCCCCC---------HHHHHHHHHHCCCeEEEEeccCCCc-CcCccccCCEEEECCCCCcccccchHHHH
Confidence            4467899998654322         2557889999999999998876552 22357889999999999998888899999


Q ss_pred             HHHHHHHHHhcCCcEEEEehHHHHHHHHcCceEEecCCCceeeEEEEEEecCCCCCCcccccCCCCCceEEEeeeccccc
Q 025645           84 LCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEVW  163 (250)
Q Consensus        84 ~~~~i~~~~~~~~PilGIC~G~Qlla~a~gg~v~~~~~~~~~g~~~i~~~~~~~~~~l~~~~~~l~~~~~~~~~H~~~v~  163 (250)
                      +.++++.+.+.++|+||||+|||+|+.++||+|.+.+. ++.||.+|++++.+..+++| +   +++.+.++++|++.| 
T Consensus        71 ~~~~i~~~~~~~~PvlGIC~G~Qll~~~lGG~V~~~~~-~e~G~~~v~~~~~~~~~~l~-g---~~~~~~v~~~H~~~v-  144 (250)
T 3m3p_A           71 LLALIRDAVAQRVPVIGHCLGGQLLAKAMGGEVTDSPH-AEIGWVRAWPQHVPQALEWL-G---TWDELELFEWHYQTF-  144 (250)
T ss_dssp             HHHHHHHHHHHTCCEEEETHHHHHHHHHTTCCEEEEEE-EEEEEEEEEECSSHHHHHHH-S---CSSCEEEEEEEEEEE-
T ss_pred             HHHHHHHHHHcCCCEEEECHHHHHHHHHhCCEEEeCCC-CceeeEEEEEecCCCCcccc-c---CCCccEEEEEcccee-
Confidence            99999999999999999999999999999999999865 78999999987532235788 6   788999999999998 


Q ss_pred             ccCCccEEEEEcCCCceEEEEECCcEEEEecCCCCCHHHHHHHHHHHh
Q 025645          164 KVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLL  211 (250)
Q Consensus       164 ~lp~~~~~la~s~~~~v~~~~~~~~~~g~QfHPE~~~~~~~~~~~~~~  211 (250)
                      .+|++++++|++++|.+++++++++++|+|||||++.+++..|++...
T Consensus       145 ~lp~~~~vlA~s~~~~~~a~~~~~~~~GvQfHPE~~~~~~~~~l~~~~  192 (250)
T 3m3p_A          145 SIPPGAVHILRSEHCANQAYVLDDLHIGFQCHIEMQAHMVREWCSISP  192 (250)
T ss_dssp             CCCTTEEEEEEETTEEEEEEEETTTEEEESSCTTCCHHHHHHHHHHCG
T ss_pred             ecCCCCEEEEEeCCCCEEEEEECCeeEEEEeCCcCCHHHHHHHHHhhH
Confidence            799999999999999999999988999999999999999999998653
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>2r47_A Uncharacterized protein MTH_862; unknown function, structural genomics, APC5901, PSI-2; 1.88A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B Back     alignment and structure
>3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3rfq_A Pterin-4-alpha-carbinolamine dehydratase MOAB2; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: B3P; 2.25A {Mycobacterium marinum} PDB: 3tcr_A Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2zuv_A Lacto-N-biose phosphorylase; beta-alpha-barrel, TIM barrel, glycosyltransferase, transferase; HET: NDG; 1.85A {Bifidobacterium longum} PDB: 2zus_A* 2zuu_A* 2zut_A* 2zuw_A* Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>1di6_A MOGA, molybdenum cofactor biosynthetic enzyme; MOCO, MOCO biosynthesis, gephyrin function; 1.45A {Escherichia coli} SCOP: c.57.1.1 PDB: 1di7_A Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d2ghra1281 c.23.16.8 (A:17-297) Homoserine O-succinyltransfer 4e-25
d1o1ya_230 c.23.16.1 (A:) Hypothetical protein TM1158 {Thermo 1e-17
d2nv0a1195 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac 3e-12
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 2e-10
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 6e-09
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 7e-08
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 1e-06
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 2e-05
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 2e-05
d2abwa1218 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protei 7e-05
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 0.001
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 0.002
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: HTS-like
domain: Homoserine O-succinyltransferase HTS (MetA)
species: Bacillus cereus [TaxId: 1396]

 Score = 98.2 bits (244), Expect = 4e-25
 Identities = 27/167 (16%), Positives = 56/167 (33%), Gaps = 7/167 (4%)

Query: 52  DFPDFNDLHKYDGFVISGSPYDA--YGNDNWILKLCFMLQTLDAMQKKVLGICFGHQVLC 109
            F D  +  K+DG +I+G+P +   +   ++  +L  +++         L IC+G Q   
Sbjct: 75  TFRDIEN-EKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGL 133

Query: 110 RALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLS--IMECHRDEVWKVPI 167
               G           G+    +         L+   E+  +      E    ++ +V  
Sbjct: 134 YHHYGVQKYPLKEKMFGVFEHEVREQHVK--LLQGFDELFFAPHSRHTEVRESDIREVKE 191

Query: 168 GAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLLNNN 214
              +    +     +       +   GH EY+ D L    +R  +  
Sbjct: 192 LTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKG 238
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Length = 230 Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 218 Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 100.0
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 100.0
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 100.0
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 100.0
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.98
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.97
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.97
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.97
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.96
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.95
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.95
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.92
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.91
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.91
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.9
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.89
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.89
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.4
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 98.72
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 98.54
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 98.52
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 98.51
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 98.46
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 98.44
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 98.2
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 98.14
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 97.96
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 97.84
d1t0ba_240 GK2113 homologue {Bacillus stearothermophilus [Tax 95.48
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 94.71
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.36
d1u0ta_302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob 93.73
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.77
d2gk3a1246 Putative cytoplasmic protein STM3548 {Salmonella t 91.35
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa 90.41
d1eiwa_111 Hypothetical protein MTH538 {Archaeon Methanobacte 85.34
d1tjya_316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 83.91
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 82.37
d1mkza_170 MoaB {Escherichia coli [TaxId: 562]} 81.83
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 81.04
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 80.91
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 80.84
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Hypothetical protein TM1158
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=5.3e-41  Score=275.90  Aligned_cols=189  Identities=23%  Similarity=0.334  Sum_probs=163.8

Q ss_pred             ccceEEEEecCCCChhHHHhhCCHHHHHHHHHhcCCCceEEEEeecCCCCCCCCCCCcCEEEEcCCCCCCCCC--ChhHH
Q 025645            5 EEKRYALFLAAKDSDYVLKVYGGYFNVFVAAFGEEGERWDLFRVVEGDFPDFNDLHKYDGFVISGSPYDAYGN--DNWIL   82 (250)
Q Consensus         5 ~~~riail~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~l~~~dglIi~Gg~~~~~~~--~~~~~   82 (250)
                      +.|||+||...+...         .+.+.++|++.|++++++++...+. .+++++++|||||+|||.+++++  .+|+.
T Consensus         2 ~~mrvli~qh~~~e~---------~G~~~~~l~~~g~~~~~~~~~~~~~-~p~~l~~~d~iii~Ggp~~~~d~~~~~~~~   71 (230)
T d1o1ya_           2 HHVRVLAIRHVEIED---------LGMMEDIFREKNWSFDYLDTPKGEK-LERPLEEYSLVVLLGGYMGAYEEEKYPFLK   71 (230)
T ss_dssp             CCCEEEEECSSTTSS---------CTHHHHHHHHTTCEEEEECGGGTCC-CSSCGGGCSEEEECCCSCCTTCTTTCTHHH
T ss_pred             CceEEEEEECCCCCC---------cHHHHHHHHHCCCEEEEEECCCCCc-CCcchhhCCEEEEcCCCcccccchhhhhhH
Confidence            358999998554322         2457889999999999998776542 23457889999999999999876  48999


Q ss_pred             HHHHHHHHHHhcCCcEEEEehHHHHHHHHcCceEEecCCCceeeEEEEEEecCCCCCCcccccCCCCCceEEEeeecccc
Q 025645           83 KLCFMLQTLDAMQKKVLGICFGHQVLCRALGGKVGKAYTGWDIGLRRVRIVNDLAPCSFLEDLGEIPGSLSIMECHRDEV  162 (250)
Q Consensus        83 ~~~~~i~~~~~~~~PilGIC~G~Qlla~a~gg~v~~~~~~~~~g~~~i~~~~~~~~~~l~~~~~~l~~~~~~~~~H~~~v  162 (250)
                      .+.++++.+.+.++|+||||+|||+|+.++||+|.+++.+++.|+..+...   ..+++|++   +|+.+.++++|++. 
T Consensus        72 ~~~~~i~~~~~~~~PilGIC~G~Qlla~alGg~V~~~~~~~~~~~~~~~~~---~~~~l~~~---~~~~~~~~~~H~d~-  144 (230)
T d1o1ya_          72 YEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNGEEIGWYFVEKV---SDNKFFRE---FPDRLRVFQWHGDT-  144 (230)
T ss_dssp             HHHHHHHHHHHHTCCEEEETHHHHHHHHHTTCCEEECTTCCEEEEEEEEEC---CCCGGGTT---SCSEEEEEEEESEE-
T ss_pred             HHHHHHHHHHHhcceEEEeecCHHHHHHHhccccccccccccccccccccc---cchhhhcc---CCccceEEEeccee-
Confidence            999999999999999999999999999999999999988889999888776   36789998   89999999999995 


Q ss_pred             cccCCccEEEEEcCCCceEEEEECCcEEEEecCCCCCHHHHHHHHHHHh
Q 025645          163 WKVPIGAEVIGFSDKTGVEMFTIGDHILGIQGHPEYTKDILYNLIDRLL  211 (250)
Q Consensus       163 ~~lp~~~~~la~s~~~~v~~~~~~~~~~g~QfHPE~~~~~~~~~~~~~~  211 (250)
                      .++|++++++|+++.|.+++|+.+ ++||+|||||++.+++++|++..+
T Consensus       145 ~~lp~~~~~la~s~~~~~qa~~~~-~~~g~QfHPE~~~~~~~~~i~~~~  192 (230)
T d1o1ya_         145 FDLPRRATRVFTSEKYENQGFVYG-KAVGLQFHIEVGARTMKRWIEAYK  192 (230)
T ss_dssp             ECCCTTCEEEEECSSCSCSEEEET-TEEEESSBSSCCHHHHHHHHHHTH
T ss_pred             eeeccchhhhhhhcCCceEEEEec-CEeEEEeCCCCCHHHHHHHHHHhH
Confidence            679999999999999999999986 699999999999999999987654
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gk3a1 c.23.16.9 (A:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1eiwa_ c.23.3.1 (A:) Hypothetical protein MTH538 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure