Citrus Sinensis ID: 025657
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| 147789493 | 371 | hypothetical protein VITISV_005886 [Viti | 0.947 | 0.636 | 0.877 | 1e-117 | |
| 145333373 | 314 | (S)-2-hydroxy-acid oxidase [Arabidopsis | 0.947 | 0.751 | 0.864 | 1e-117 | |
| 15236857 | 368 | (S)-2-hydroxy-acid oxidase [Arabidopsis | 0.947 | 0.641 | 0.864 | 1e-117 | |
| 366984550 | 367 | glycolate oxidase [Gossypium hirsutum] | 0.947 | 0.643 | 0.906 | 1e-116 | |
| 168033163 | 368 | predicted protein [Physcomitrella patens | 0.955 | 0.646 | 0.836 | 1e-116 | |
| 297800234 | 368 | hypothetical protein ARALYDRAFT_914854 [ | 0.947 | 0.641 | 0.860 | 1e-116 | |
| 189418957 | 369 | glycolate oxidase [Mikania micrantha] | 0.943 | 0.636 | 0.855 | 1e-116 | |
| 168002982 | 368 | predicted protein [Physcomitrella patens | 0.951 | 0.644 | 0.831 | 1e-115 | |
| 228403 | 371 | glycolate oxidase | 0.947 | 0.636 | 0.898 | 1e-115 | |
| 302754346 | 371 | hypothetical protein SELMODRAFT_266585 [ | 0.967 | 0.649 | 0.821 | 1e-115 |
| >gi|147789493|emb|CAN67413.1| hypothetical protein VITISV_005886 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 428 bits (1100), Expect = e-117, Method: Compositional matrix adjust.
Identities = 207/236 (87%), Positives = 221/236 (93%)
Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65
EITNV EYEA+AK+KLPKMV+DYYASGAEDQWTL +NR+AFS+ILFRPRIL DVSKIDMT
Sbjct: 2 EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61
Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP 125
TTVLGF ISMPIMIAPTA QKMAHPEGE ATARAASA GTIMTLSSWATSSVEEV+STGP
Sbjct: 62 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASATGTIMTLSSWATSSVEEVASTGP 121
Query: 126 GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLK 185
GIRFFQLYV K R+V AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRF LPP LTLK
Sbjct: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181
Query: 186 NYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAED 241
N+EGL +GKMDK DDSGLASYVA QIDR+L+WKDVKWLQTIT+LPILVKGVLTAED
Sbjct: 182 NFEGLDLGKMDKADDSGLASYVAGQIDRTLSWKDVKWLQTITNLPILVKGVLTAED 237
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|145333373|ref|NP_001078406.1| (S)-2-hydroxy-acid oxidase [Arabidopsis thaliana] gi|332658632|gb|AEE84032.1| (S)-2-hydroxy-acid oxidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15236857|ref|NP_193570.1| (S)-2-hydroxy-acid oxidase [Arabidopsis thaliana] gi|75318383|sp|O49506.1|GLO5_ARATH RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO5; AltName: Full=Glycolate oxidase 3; Short=AtGLO5; Short=GOX 3; AltName: Full=Short chain alpha-hydroxy acid oxidase GLO5 gi|2832641|emb|CAA16716.1| glycolate oxidase - like protein [Arabidopsis thaliana] gi|7268629|emb|CAB78838.1| glycolate oxidase-like protein [Arabidopsis thaliana] gi|25054935|gb|AAN71944.1| putative glycolate oxidase [Arabidopsis thaliana] gi|332658631|gb|AEE84031.1| (S)-2-hydroxy-acid oxidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|366984550|gb|AEX09184.1| glycolate oxidase [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|168033163|ref|XP_001769086.1| predicted protein [Physcomitrella patens subsp. patens] gi|162679720|gb|EDQ66164.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|297800234|ref|XP_002868001.1| hypothetical protein ARALYDRAFT_914854 [Arabidopsis lyrata subsp. lyrata] gi|297313837|gb|EFH44260.1| hypothetical protein ARALYDRAFT_914854 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|189418957|gb|ACD93720.1| glycolate oxidase [Mikania micrantha] | Back alignment and taxonomy information |
|---|
| >gi|168002982|ref|XP_001754192.1| predicted protein [Physcomitrella patens subsp. patens] gi|162694746|gb|EDQ81093.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|228403|prf||1803516A glycolate oxidase | Back alignment and taxonomy information |
|---|
| >gi|302754346|ref|XP_002960597.1| hypothetical protein SELMODRAFT_266585 [Selaginella moellendorffii] gi|302771644|ref|XP_002969240.1| hypothetical protein SELMODRAFT_270767 [Selaginella moellendorffii] gi|300162716|gb|EFJ29328.1| hypothetical protein SELMODRAFT_270767 [Selaginella moellendorffii] gi|300171536|gb|EFJ38136.1| hypothetical protein SELMODRAFT_266585 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| TAIR|locus:2091642 | 367 | GOX1 "glycolate oxidase 1" [Ar | 0.947 | 0.643 | 0.826 | 6.9e-102 | |
| TAIR|locus:2124499 | 368 | GOX3 "glycolate oxidase 3" [Ar | 0.947 | 0.641 | 0.830 | 1.4e-101 | |
| UNIPROTKB|B8AKX6 | 369 | GLO1 "Peroxisomal (S)-2-hydrox | 0.955 | 0.644 | 0.810 | 6.2e-101 | |
| UNIPROTKB|Q10CE4 | 369 | GLO1 "Peroxisomal (S)-2-hydrox | 0.955 | 0.644 | 0.810 | 6.2e-101 | |
| UNIPROTKB|B8B7C5 | 369 | GLO5 "Peroxisomal (S)-2-hydrox | 0.955 | 0.644 | 0.810 | 1.7e-100 | |
| UNIPROTKB|Q6YT73 | 369 | GLO5 "Peroxisomal (S)-2-hydrox | 0.955 | 0.644 | 0.810 | 1.7e-100 | |
| UNIPROTKB|B8AUI3 | 367 | GLO3 "Peroxisomal (S)-2-hydrox | 0.943 | 0.640 | 0.804 | 4.5e-98 | |
| UNIPROTKB|Q7FAS1 | 367 | GLO3 "Peroxisomal (S)-2-hydrox | 0.943 | 0.640 | 0.804 | 4.5e-98 | |
| UNIPROTKB|Q01KC2 | 368 | GLO2 "Peroxisomal (S)-2-hydrox | 0.943 | 0.638 | 0.663 | 1e-82 | |
| UNIPROTKB|Q7XPR4 | 368 | GLO2 "Peroxisomal (S)-2-hydrox | 0.943 | 0.638 | 0.663 | 1e-82 |
| TAIR|locus:2091642 GOX1 "glycolate oxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1010 (360.6 bits), Expect = 6.9e-102, P = 6.9e-102
Identities = 195/236 (82%), Positives = 213/236 (90%)
Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65
EITNV EY+A+AK+KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DVSKIDMT
Sbjct: 2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT 61
Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECXXXXXXXXXGTIMTLSSWATSSVEEVSSTGP 125
TTVLGF ISMPIM+APTA QKMAHP+GE GTIMTLSSWATSSVEEV+STGP
Sbjct: 62 TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121
Query: 126 GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLK 185
GIRFFQLYV K+RNV QLV+RAERAGFKAIALTVDTPRLGRRE+DIKNRF LPP+LTLK
Sbjct: 122 GIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLK 181
Query: 186 NYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAED 241
N+EGL +GKMD+ +DSGLASYVA QIDR+L+WKDV+WLQTIT LPILVKGVLT ED
Sbjct: 182 NFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGED 237
|
|
| TAIR|locus:2124499 GOX3 "glycolate oxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B8AKX6 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q10CE4 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B8B7C5 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6YT73 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B8AUI3 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7FAS1 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q01KC2 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XPR4 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| PLN02493 | 367 | PLN02493, PLN02493, probable peroxisomal (S)-2-hyd | 1e-144 | |
| PLN02979 | 366 | PLN02979, PLN02979, glycolate oxidase | 1e-117 | |
| PLN02535 | 364 | PLN02535, PLN02535, glycolate oxidase | 1e-117 | |
| cd02809 | 299 | cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom | 2e-95 | |
| pfam01070 | 302 | pfam01070, FMN_dh, FMN-dependent dehydrogenase | 4e-94 | |
| cd02922 | 344 | cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-b | 2e-86 | |
| COG1304 | 360 | COG1304, idi, Isopentenyl diphosphate isomerase (B | 2e-71 | |
| cd04737 | 351 | cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN | 6e-67 | |
| cd04736 | 361 | cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li | 1e-61 | |
| cd03332 | 383 | cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) | 2e-60 | |
| TIGR02708 | 367 | TIGR02708, L_lactate_ox, L-lactate oxidase | 3e-46 | |
| TIGR03966 | 385 | TIGR03966, actino_HemFlav, heme/flavin dehydrogena | 4e-40 | |
| PRK11197 | 381 | PRK11197, lldD, L-lactate dehydrogenase; Provision | 1e-38 |
| >gnl|CDD|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
Score = 408 bits (1050), Expect = e-144
Identities = 204/237 (86%), Positives = 222/237 (93%)
Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65
EITNV EY+A+AK+KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DVSKIDMT
Sbjct: 2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT 61
Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP 125
TTVLGF ISMPIM+APTA QKMAHP+GE ATARAASAAGTIMTLSSWATSSVEEV+STGP
Sbjct: 62 TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121
Query: 126 GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLK 185
GIRFFQLYV K+RNV QLV+RAERAGFKAIALTVDTPRLGRRE+DIKNRF LPP+LTLK
Sbjct: 122 GIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLK 181
Query: 186 NYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDG 242
N+EGL +GKMD+ +DSGLASYVA QIDR+L+WKDV+WLQTIT LPILVKGVLT ED
Sbjct: 182 NFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDA 238
|
Length = 367 |
| >gnl|CDD|166620 PLN02979, PLN02979, glycolate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215294 PLN02535, PLN02535, glycolate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239238 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240088 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239448 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|131755 TIGR02708, L_lactate_ox, L-lactate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|188481 TIGR03966, actino_HemFlav, heme/flavin dehydrogenase, mycofactocin system | Back alignment and domain information |
|---|
| >gnl|CDD|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| KOG0538 | 363 | consensus Glycolate oxidase [Energy production and | 100.0 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 100.0 | |
| PLN02535 | 364 | glycolate oxidase | 100.0 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 100.0 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 100.0 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 100.0 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 100.0 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 100.0 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 100.0 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 100.0 | |
| PLN02979 | 366 | glycolate oxidase | 100.0 | |
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 100.0 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 100.0 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 99.71 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 99.67 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 99.6 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 99.39 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 99.21 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 98.82 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 98.74 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 98.47 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 98.41 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 98.1 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 97.46 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 97.28 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 97.28 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 97.19 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 97.17 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.13 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 97.08 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.07 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 97.0 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 96.81 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.78 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 96.64 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 96.55 | |
| KOG2335 | 358 | consensus tRNA-dihydrouridine synthase [Translatio | 96.41 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 96.37 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 96.36 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.31 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 96.05 | |
| PRK06801 | 286 | hypothetical protein; Provisional | 95.95 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 95.9 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 95.75 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 95.66 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 95.65 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 95.62 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 95.59 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 95.36 | |
| cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a | 95.35 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 95.24 | |
| PRK07998 | 283 | gatY putative fructose-1,6-bisphosphate aldolase; | 95.0 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 95.0 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 94.92 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 94.73 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 94.71 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 94.63 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 94.61 | |
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 94.61 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 94.51 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 94.41 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 94.36 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 94.33 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 94.31 | |
| TIGR01858 | 282 | tag_bisphos_ald class II aldolase, tagatose bispho | 94.28 | |
| PRK06806 | 281 | fructose-bisphosphate aldolase; Provisional | 94.27 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 94.16 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 94.11 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 93.96 | |
| PRK12738 | 286 | kbaY tagatose-bisphosphate aldolase; Reviewed | 93.92 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 93.78 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 93.65 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 93.58 | |
| PRK09195 | 284 | gatY tagatose-bisphosphate aldolase; Reviewed | 93.42 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 93.35 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 93.24 | |
| PRK12857 | 284 | fructose-1,6-bisphosphate aldolase; Reviewed | 93.22 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 93.07 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 92.93 | |
| PRK07315 | 293 | fructose-bisphosphate aldolase; Provisional | 92.63 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 92.55 | |
| TIGR00167 | 288 | cbbA ketose-bisphosphate aldolases. fructose-bisph | 92.55 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 92.36 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 92.27 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 92.19 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 92.11 | |
| cd00947 | 276 | TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a | 92.04 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 91.84 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 91.79 | |
| PRK07084 | 321 | fructose-bisphosphate aldolase; Provisional | 91.74 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 91.7 | |
| PRK05835 | 307 | fructose-bisphosphate aldolase; Provisional | 91.64 | |
| PRK12737 | 284 | gatY tagatose-bisphosphate aldolase; Reviewed | 91.56 | |
| PRK07709 | 285 | fructose-bisphosphate aldolase; Provisional | 91.15 | |
| PRK09196 | 347 | fructose-1,6-bisphosphate aldolase; Reviewed | 91.04 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 90.9 | |
| PRK08610 | 286 | fructose-bisphosphate aldolase; Reviewed | 90.59 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 90.59 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 90.53 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 90.38 | |
| PRK13399 | 347 | fructose-1,6-bisphosphate aldolase; Provisional | 90.31 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 90.31 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 90.29 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 90.18 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 90.03 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 89.97 | |
| PRK08185 | 283 | hypothetical protein; Provisional | 89.81 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 89.41 | |
| TIGR01521 | 347 | FruBisAldo_II_B fructose-bisphosphate aldolase, cl | 89.04 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 88.94 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 88.38 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 88.1 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 88.08 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 87.73 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 87.68 | |
| TIGR01859 | 282 | fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, | 87.6 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 87.49 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 87.42 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 87.35 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 87.29 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 86.51 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 85.63 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 85.1 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 84.57 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 84.17 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 84.12 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 83.81 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 83.77 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 82.74 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 81.81 | |
| PLN02591 | 250 | tryptophan synthase | 81.47 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 81.21 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 81.1 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 80.85 |
| >KOG0538 consensus Glycolate oxidase [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.1e-83 Score=565.27 Aligned_cols=243 Identities=70% Similarity=1.080 Sum_probs=234.0
Q ss_pred CCChHHHHHHHHHhCChhhhhhhccCccchHHHHHHHHhhcccceeccccCCCCCCccceeecCcccccceeeccccccc
Q 025657 7 ITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMTTTVLGFNISMPIMIAPTAFQK 86 (249)
Q Consensus 7 ~~~i~d~e~~A~~~Lp~~~~~Y~~gGa~de~t~~~N~~af~~~~l~pr~l~~v~~~d~st~llG~~~~~Pi~iaP~g~~~ 86 (249)
++|++|||+.|+++||+++||||.|||+|++|+++|++||.||.|+||+|+||+.+|+||++||+++++||+|||||+++
T Consensus 1 lv~~~dfe~~A~~~L~K~a~dyy~sgA~d~~Tl~~N~~AF~ri~~rPr~L~dVs~iD~sTtvlG~~i~~Pi~iapTa~qk 80 (363)
T KOG0538|consen 1 LVNVDDFEALAKQQLPKMAYDYYESGAEDQETLDENINAFRRILFRPRILRDVSKIDTSTTVLGQKISAPIMIAPTAMQK 80 (363)
T ss_pred CccHHHHHHHHHHhhhHHHHHHHhcCCcchhhHHHHHHHHHhhhccchhheecccccccceeccccccceeEEcchHHHh
Confidence 47999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCChhhHHHHHHHHhcCCcEEecCCCCCCHHHHHhcCC-CceeEEEccccChHHHHHHHHHHHHcCCcEEEEeecCCCC
Q 025657 87 MAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRL 165 (249)
Q Consensus 87 l~h~~gE~~~AraA~~~gi~~~lss~ss~sleeia~~~~-~~~wfQlY~~~d~~~~~~li~rA~~aG~~alvvTvD~p~~ 165 (249)
|+|||||.++||||+++|++|++||.|++|+|||++++| +.+|||||+++||+++++|++|||++||+||+||||+|++
T Consensus 81 ma~pdGE~~taraa~~~~~~~i~Ss~at~S~EdI~~aap~~~rwfQLYvykdr~It~~Lv~raEk~GfkAlvlTvDtP~l 160 (363)
T KOG0538|consen 81 MAHPDGELATARAAQAAGTIMILSSWATCSVEDIASAAPPGIRWFQLYVYKDRDITEQLVKRAEKAGFKALVLTVDTPRL 160 (363)
T ss_pred ccCCcccHHHHHHHHhcCCcEEEechhcCCHHHHHhhCCCCcEEEEEEecCchHHHHHHHHHHHHcCceEEEEEeccccc
Confidence 999999999999999999999999999999999998885 8999999999999999999999999999999999999999
Q ss_pred CCchhhhhccCCCCCccccccccccccCCCCCCCCchhhhHhhhhcCCCCCHHHHHHHHHhCCCCEEEEccCCHHHHHHH
Q 025657 166 GRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDGSKL 245 (249)
Q Consensus 166 g~Re~d~r~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tW~dl~wlr~~~~lPivlKGIl~~eDA~~A 245 (249)
|+|+.|+||+|.+|+.++++|+.+....+..+.+.++...+...++|++++|+||+|||+.|+|||||||||+.|||++|
T Consensus 161 G~R~~D~~n~f~lp~~l~lknfe~~~~~~v~~~~~sg~~~~~~~~id~Sl~W~Di~wLr~~T~LPIvvKGilt~eDA~~A 240 (363)
T KOG0538|consen 161 GRRESDIKNKFSLPKNLTLKNFEGLKLTEVEEAGDSGLAAYVSSQIDPSLSWKDIKWLRSITKLPIVVKGVLTGEDARKA 240 (363)
T ss_pred cCchhhhhhcccCCcccccccccccccccCCcccchhhhhhhhcCCCCCCChhhhHHHHhcCcCCeEEEeecccHHHHHH
Confidence 99999999999999999999998875555555567788889999999999999999999999999999999999999999
Q ss_pred hhCC
Q 025657 246 LSKE 249 (249)
Q Consensus 246 ~~~~ 249 (249)
++||
T Consensus 241 ve~G 244 (363)
T KOG0538|consen 241 VEAG 244 (363)
T ss_pred HHhC
Confidence 9997
|
|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PRK06801 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family | Back alignment and domain information |
|---|
| >PRK06806 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PRK07315 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >TIGR00167 cbbA ketose-bisphosphate aldolases | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >PRK07084 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PRK05835 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK07709 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK08610 fructose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >PRK13399 fructose-1,6-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >PRK08185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 249 | ||||
| 1gox_A | 370 | Refined Structure Of Spinach Glycolate Oxidase At 2 | 1e-116 | ||
| 1al7_A | 359 | Three-Dimensional Structures Of Glycolate Oxidase W | 1e-116 | ||
| 1gyl_A | 369 | Involvement Of Tyr24 And Trp108 In Substrate Bindin | 1e-115 | ||
| 2rdt_A | 387 | Crystal Structure Of Human Glycolate Oxidase (Go) I | 9e-65 | ||
| 2nzl_A | 392 | Crystal Structure Of Human Hydroxyacid Oxidase 1 Le | 1e-64 | ||
| 2w0u_A | 370 | Crystal Structure Of Human Glycolate Oxidase In Com | 2e-64 | ||
| 2a7n_A | 380 | Crystal Structure Of The G81a Mutant Of The Active | 2e-48 | ||
| 1huv_A | 380 | Crystal Structure Of A Soluble Mutant Of The Membra | 5e-48 | ||
| 1tb3_A | 352 | Crystal Structure Analysis Of Recombinant Rat Kidne | 3e-42 | ||
| 3sgz_A | 352 | High Resolution Crystal Structure Of Rat Long Chain | 1e-39 | ||
| 2cdh_0 | 226 | Architecture Of The Thermomyces Lanuginosus Fungal | 6e-39 | ||
| 2cdh_0 | 226 | Architecture Of The Thermomyces Lanuginosus Fungal | 1e-07 | ||
| 1kbj_A | 412 | Crystallographic Study Of The Recombinant Flavin-Bi | 3e-38 | ||
| 2oz0_A | 511 | Mechanistic And Structural Studies Of H373q Flavocy | 5e-38 | ||
| 1qcw_A | 410 | Flavocytochrome B2, Arg289lys Mutant Length = 410 | 5e-38 | ||
| 1ltd_A | 506 | The 2.6 Angstroms Refined Structure Of The Escheric | 5e-38 | ||
| 1fcb_A | 511 | Molecular Structure Of Flavocytochrome B2 At 2.4 An | 5e-38 | ||
| 1sze_A | 511 | L230a Mutant Flavocytochrome B2 With Benzoylformate | 6e-38 | ||
| 1ldc_A | 511 | X-Ray Structure Of Two Complexes Of The Y143f Flavo | 1e-37 | ||
| 1szf_A | 511 | A198g:l230a Mutant Flavocytochrome B2 With Pyruvate | 2e-37 | ||
| 2j6x_A | 374 | The Crystal Structure Of Lactate Oxidase Length = 3 | 7e-27 | ||
| 2du2_A | 374 | Crystal Structure Analysis Of The L-Lactate Oxidase | 8e-27 | ||
| 2nli_A | 368 | Crystal Structure Of The Complex Between L-Lactate | 9e-27 |
| >pdb|1GOX|A Chain A, Refined Structure Of Spinach Glycolate Oxidase At 2 Angstroms Resolution Length = 370 | Back alignment and structure |
|
| >pdb|1AL7|A Chain A, Three-Dimensional Structures Of Glycolate Oxidase With Bound Active- Site Inhibitors Length = 359 | Back alignment and structure |
| >pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase Length = 369 | Back alignment and structure |
| >pdb|2RDT|A Chain A, Crystal Structure Of Human Glycolate Oxidase (Go) In Complex With Cdst Length = 387 | Back alignment and structure |
| >pdb|2NZL|A Chain A, Crystal Structure Of Human Hydroxyacid Oxidase 1 Length = 392 | Back alignment and structure |
| >pdb|2W0U|A Chain A, Crystal Structure Of Human Glycolate Oxidase In Complex With The Inhibitor 5-[(4-Chlorophenyl)sulfanyl]- 1,2,3-Thiadiazole-4-Carboxylate. Length = 370 | Back alignment and structure |
| >pdb|2A7N|A Chain A, Crystal Structure Of The G81a Mutant Of The Active Chimera Of (S)- Mandelate Dehydrogenase Length = 380 | Back alignment and structure |
| >pdb|1HUV|A Chain A, Crystal Structure Of A Soluble Mutant Of The Membrane-Associated (S)- Mandelate Dehydrogenase From Pseudomonas Putida At 2.15a Resolution Length = 380 | Back alignment and structure |
| >pdb|1TB3|A Chain A, Crystal Structure Analysis Of Recombinant Rat Kidney Long- Chain Hydroxy Acid Oxidase Length = 352 | Back alignment and structure |
| >pdb|3SGZ|A Chain A, High Resolution Crystal Structure Of Rat Long Chain Hydroxy Acid Oxidase In Complex With The Inhibitor 4-Carboxy-5-[(4-Chiorophenyl) Sulfanyl]-1, 2, 3-Thiadiazole. Length = 352 | Back alignment and structure |
| >pdb|2CDH|0 Chain 0, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 226 | Back alignment and structure |
| >pdb|2CDH|0 Chain 0, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 226 | Back alignment and structure |
| >pdb|1KBJ|A Chain A, Crystallographic Study Of The Recombinant Flavin-Binding Domain Of Baker's Yeast Flavocytochrome B2: Comparison With The Intact Wild- Type Enzyme Length = 412 | Back alignment and structure |
| >pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 | Back alignment and structure |
| >pdb|1QCW|A Chain A, Flavocytochrome B2, Arg289lys Mutant Length = 410 | Back alignment and structure |
| >pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 | Back alignment and structure |
| >pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 | Back alignment and structure |
| >pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 | Back alignment and structure |
| >pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 | Back alignment and structure |
| >pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 | Back alignment and structure |
| >pdb|2J6X|A Chain A, The Crystal Structure Of Lactate Oxidase Length = 374 | Back alignment and structure |
| >pdb|2DU2|A Chain A, Crystal Structure Analysis Of The L-Lactate Oxidase Length = 374 | Back alignment and structure |
| >pdb|2NLI|A Chain A, Crystal Structure Of The Complex Between L-Lactate Oxidase And A Substrate Analogue At 1.59 Angstrom Resolution Length = 368 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 1e-144 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 1e-135 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 1e-133 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 1e-131 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 1e-129 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 1e-118 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 5e-47 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 6e-36 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 5e-28 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 3e-20 |
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Length = 370 | Back alignment and structure |
|---|
Score = 406 bits (1047), Expect = e-144
Identities = 208/236 (88%), Positives = 221/236 (93%)
Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65
EITNV EYEA+AK+KLPKMVYDYYASGAEDQWTL ENRNAFSRILFRPRIL DV+ IDMT
Sbjct: 3 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT 62
Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP 125
TT+LGF ISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+STGP
Sbjct: 63 TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 122
Query: 126 GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLK 185
GIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LTLK
Sbjct: 123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLK 182
Query: 186 NYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAED 241
N+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAED
Sbjct: 183 NFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAED 238
|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Length = 392 | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Length = 380 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Length = 352 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Length = 368 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Length = 365 | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349 | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Length = 368 | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 100.0 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 100.0 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 100.0 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 100.0 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 100.0 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 100.0 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 99.95 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 99.91 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 99.86 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 99.85 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 99.85 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 99.76 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 99.75 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 99.67 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 99.63 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 99.0 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 98.85 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 98.72 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 98.7 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 98.42 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.38 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 98.38 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 98.17 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.14 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 97.9 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 97.66 | |
| 1ea0_A | 1479 | Glutamate synthase [NADPH] large chain; oxidoreduc | 97.59 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 97.56 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 97.38 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 96.96 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 96.69 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 96.64 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 96.57 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 96.56 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 96.51 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.43 | |
| 1ofd_A | 1520 | Ferredoxin-dependent glutamate synthase 2; oxidore | 96.31 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 95.44 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 95.42 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 95.22 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 94.64 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 94.61 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 94.37 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 94.37 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 94.1 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 93.82 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 93.29 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 92.99 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 92.97 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 92.91 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 92.89 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 92.7 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 92.15 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 92.1 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 92.09 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 92.07 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 91.92 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 91.45 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 91.37 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 91.05 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 90.7 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 89.87 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 89.78 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 89.69 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 89.47 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 89.24 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 89.12 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 89.06 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 89.03 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 88.96 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 88.81 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 88.65 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 88.61 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 88.58 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 88.49 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 88.06 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 88.0 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 87.74 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 87.51 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 87.34 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 87.27 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 86.7 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 86.67 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 86.24 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 86.02 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 86.0 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 85.39 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 85.29 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 84.32 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 84.15 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 83.95 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 83.86 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 83.64 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 83.26 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 83.17 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 83.06 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 83.06 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 83.03 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 82.98 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 82.55 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 82.54 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 82.29 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 82.14 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 82.09 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 81.96 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 81.58 | |
| 2r91_A | 286 | 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM | 80.63 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 80.17 |
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-72 Score=518.36 Aligned_cols=236 Identities=39% Similarity=0.646 Sum_probs=215.7
Q ss_pred CCChHHHHHHHHHhCChhhhhhhccCccchHHHHHHHHhhcccceeccccCCCCCCccceeecCcccccceeeccccccc
Q 025657 7 ITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMTTTVLGFNISMPIMIAPTAFQK 86 (249)
Q Consensus 7 ~~~i~d~e~~A~~~Lp~~~~~Y~~gGa~de~t~~~N~~af~~~~l~pr~l~~v~~~d~st~llG~~~~~Pi~iaP~g~~~ 86 (249)
++|++|||++||++||+.+|+||+|||+||.|+++|++||++|+|+||+|+||+++||+|+|||+++++||+|||+|+++
T Consensus 2 ~~~~~d~~~~A~~~lp~~~~~Y~~~ga~~e~t~~~N~~af~~~~l~prvl~dv~~~d~~t~llG~~~~~P~~iaP~g~~~ 81 (352)
T 3sgz_A 2 LVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHS 81 (352)
T ss_dssp CCSHHHHHHHHHHTSCHHHHHHHHCCCTTCHHHHHHHHHHHTCCBCCCCSSCCSSCBCCEEETTEEESSSEEECCCSCGG
T ss_pred CCCHHHHHHHHHHHCCHHHHHHHhcCCcchHHHHHHHHHHHhceeeccccCCCCCCCCceEECCcccCCcceechHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCChhhHHHHHHHHhcCCcEEecCCCCCCHHHHHhcCC-CceeEEEccccChHHHHHHHHHHHHcCCcEEEEeecCCCC
Q 025657 87 MAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRL 165 (249)
Q Consensus 87 l~h~~gE~~~AraA~~~gi~~~lss~ss~sleeia~~~~-~~~wfQlY~~~d~~~~~~li~rA~~aG~~alvvTvD~p~~ 165 (249)
|+||+||+++||||+++||||++||.|++|+|||+++.+ ++.|||||+++|++.++++|+||+++||+|||||||+|+.
T Consensus 82 l~~~~ge~~~araa~~~gi~~~lSt~ss~s~e~v~~~~~~~~~wfQlY~~~d~~~~~~l~~ra~~aG~~alvlTvD~p~~ 161 (352)
T 3sgz_A 82 IAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVL 161 (352)
T ss_dssp GTCTTHHHHHHHHHHHHTCEEEECTTCSSCHHHHHHHSTTCEEEEECCCCSCHHHHHHHHHHHHHTTCCCEEEECSCSSC
T ss_pred hcCccHHHHHHHHHHHcCCCeEeCCCCCCCHHHHHHhccCccceeccccCCCHHHHHHHHHHHHHcCCCEEEEEeCCCCC
Confidence 999999999999999999999999999999999998877 6899999999999999999999999999999999999999
Q ss_pred CCchhhhhccCCCCCccccccccccccCCCCCCCCchhhhHhhhhcCCCCCHHHHHHHHHhCCCCEEEEccCCHHHHHHH
Q 025657 166 GRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDGSKL 245 (249)
Q Consensus 166 g~Re~d~r~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tW~dl~wlr~~~~lPivlKGIl~~eDA~~A 245 (249)
|+||+|+||+|.+|++++++++.... ......+ .....+++.++|++|+|||+.|++||++|||+++|||++|
T Consensus 162 g~R~~d~r~~~~~p~~~~~~~~~~~~----~~~~~~~---~~~~~~d~~~~w~~i~~lr~~~~~PvivK~v~~~e~A~~a 234 (352)
T 3sgz_A 162 GNRRRDKRNQLNLEANILKAALRALK----EEKPTQS---VPVLFPKASFCWNDLSLLQSITRLPIILKGILTKEDAELA 234 (352)
T ss_dssp CCCHHHHHHHHHSCHHHHTTCC----------------------CCCTTCCHHHHHHHHHHCCSCEEEEEECSHHHHHHH
T ss_pred CcchhhhhcCCCCCcccchhhhcccc----cccccch---hhhhccCCCCCHHHHHHHHHhcCCCEEEEecCcHHHHHHH
Confidence 99999999999999888877765421 0001111 1225678999999999999999999999999999999999
Q ss_pred hhCC
Q 025657 246 LSKE 249 (249)
Q Consensus 246 ~~~~ 249 (249)
+++|
T Consensus 235 ~~~G 238 (352)
T 3sgz_A 235 MKHN 238 (352)
T ss_dssp HHTT
T ss_pred HHcC
Confidence 9987
|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 249 | ||||
| d1goxa_ | 359 | c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia | 1e-69 | |
| d1p4ca_ | 353 | c.1.4.1 (A:) Membrane-associated (S)-mandelate deh | 6e-60 | |
| d1kbia1 | 414 | c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal | 2e-56 | |
| d1tb3a1 | 349 | c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus | 1e-55 | |
| d1vcfa1 | 310 | c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i | 7e-28 | |
| d1p0ka_ | 329 | c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera | 4e-26 |
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 359 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Glycolate oxidase species: Spinach (Spinacia oleracea) [TaxId: 3562]
Score = 215 bits (549), Expect = 1e-69
Identities = 208/239 (87%), Positives = 221/239 (92%)
Query: 6 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMT 65
EITNV EYEA+AK+KLPKMVYDYYASGAEDQWTL ENRNAFSRILFRPRIL DV+ IDMT
Sbjct: 2 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT 61
Query: 66 TTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP 125
TT+LGF ISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+STGP
Sbjct: 62 TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121
Query: 126 GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLK 185
GIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LTLK
Sbjct: 122 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLK 181
Query: 186 NYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDGSK 244
N+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAED
Sbjct: 182 NFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARL 240
|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 353 | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414 | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 349 | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 100.0 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 100.0 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 100.0 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 100.0 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 99.94 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 99.91 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 97.73 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 97.11 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 97.05 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 96.87 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 96.77 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 96.39 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 96.36 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 95.94 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 95.16 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 94.75 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 94.19 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 93.0 | |
| d1wv2a_ | 243 | Thiazole biosynthesis protein ThiG {Pseudomonas ae | 92.97 | |
| d1gvfa_ | 284 | Tagatose-1,6-bisphosphate aldolase {Escherichia co | 92.93 | |
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 87.79 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 87.16 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 87.12 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 83.79 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 83.76 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 83.47 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 82.27 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 81.86 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 81.18 |
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Hydroxyacid oxidase species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=1.3e-60 Score=437.57 Aligned_cols=236 Identities=41% Similarity=0.658 Sum_probs=208.8
Q ss_pred CCChHHHHHHHHHhCChhhhhhhccCccchHHHHHHHHhhcccceeccccCCCCCCccceeecCcccccceeeccccccc
Q 025657 7 ITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKIDMTTTVLGFNISMPIMIAPTAFQK 86 (249)
Q Consensus 7 ~~~i~d~e~~A~~~Lp~~~~~Y~~gGa~de~t~~~N~~af~~~~l~pr~l~~v~~~d~st~llG~~~~~Pi~iaP~g~~~ 86 (249)
++||+|||++||++||+.+|+||+|||+||.|+++|+++|++|+|+||+|+|++++||+|+|||+++++||+|+||++++
T Consensus 2 ~~~i~d~~~~A~~~lp~~~~~y~~~ga~de~t~~~N~~aFd~i~l~pr~L~d~~~idlst~~lG~~l~~P~~Iapmtgg~ 81 (349)
T d1tb3a1 2 LVCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHS 81 (349)
T ss_dssp CCSHHHHHHHHHHTSCHHHHHHHHCCCTTCHHHHHHHHHHHHCCBCCCCSSCCSSCBCCEEETTEEESSSEEECCCSCGG
T ss_pred cccHHHHHHHHHHHCCHHHHHHHhccccccHHHHHHHHHHHhccEEcccccCCCCCCCceeECCcCccceEEEcchhccc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCChhhHHHHHHHHhcCCcEEecCCCCCCHHHHHhcCC-CceeEEEccccChHHHHHHHHHHHHcCCcEEEEeecCCCC
Q 025657 87 MAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRL 165 (249)
Q Consensus 87 l~h~~gE~~~AraA~~~gi~~~lss~ss~sleeia~~~~-~~~wfQlY~~~d~~~~~~li~rA~~aG~~alvvTvD~p~~ 165 (249)
+.|+++|.++|++|+++|++|++||+++.++|+|.++.+ ++.|||+|+++|++.+.++++|++++|++++++|||.|+.
T Consensus 82 ~~~~~~~~~lA~aA~~~g~~~~~~s~s~~~~e~v~~~~~~~~~~~ql~~~~~~~~~~~~i~~~~~~g~~a~~~tvd~~~~ 161 (349)
T d1tb3a1 82 IAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVL 161 (349)
T ss_dssp GTCTTTHHHHHHHHHHHTCCEEECTTCSSCHHHHHHHSTTCCEEEECCCCSCTTHHHHHHHHHHHHTCCCEEEECSCSSC
T ss_pred ccccchhhHHHHhhhhcccceeecccccccchhhhhhccCCCeeeeeecccCHHHHHHHHHHHHhcCCcccccccCchhh
Confidence 999999999999999999999999999999999987665 7899999999999999999999999999999999999999
Q ss_pred CCchhhhhccCCCCCccccccccccccCCCCCCCCchhhhHhhhhcCCCCCHHHHHHHHHhCCCCEEEEccCCHHHHHHH
Q 025657 166 GRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDGSKL 245 (249)
Q Consensus 166 g~Re~d~r~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~tW~dl~wlr~~~~lPivlKGIl~~eDA~~A 245 (249)
|+|++|+|++|.+|+.+...++...... ...........++.++|++++|||+.|++|+++|||++++||.+|
T Consensus 162 ~~~~~d~r~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~i~~l~~~~~~pii~Kgi~~~~da~~a 234 (349)
T d1tb3a1 162 GNRRRDKRNQLNLEANILLKDLRALKEE-------KPTQSVPVSFPKASFCWNDLSLLQSITRLPIILKGILTKEDAELA 234 (349)
T ss_dssp CCCHHHHHTTCCCCC----CCSCCCCC--------------------CCCCHHHHHHHHTTCCSCEEEEEECSHHHHHHH
T ss_pred cchhhhhhccccCCcccchhhhhhhhhc-------cccccccccccCCCCCHHHHHHHHHhcCCCcccchhhhhHHHHHH
Confidence 9999999999999876655444322100 000111223346789999999999999999999999999999999
Q ss_pred hhCC
Q 025657 246 LSKE 249 (249)
Q Consensus 246 ~~~~ 249 (249)
+++|
T Consensus 235 ~~~G 238 (349)
T d1tb3a1 235 MKHN 238 (349)
T ss_dssp HHTT
T ss_pred HHhh
Confidence 9987
|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|