Citrus Sinensis ID: 025685


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MASSVSKIDGEELVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
cccccccccHHHHHHcccccccccccccccccccccccccccccccEEcccccccccccEEccccccccHHHHHHHHccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcc
cccEEEEEccHHHcccccccEcccccccccccccccccccccccEEEEEEccccHHHcccccccccHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHccHHHHHHHHHHHHHccccccccccccHHHHHHccccccccccHHHHHccccccEEEcccccccccEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHEccc
massvskidgeelvkgldnlsisdqgemqskadnremgfgnhggvcaicldktvLQETALVKGCEHAYCATCILRWasyvrnptcpqckhpfeflhvhrsldgsisdyMFEESVCLLLRAtwfkplivEDHVVvqddleddysyedeeddldevyfrsssslrignrrwgdngyvragrqearpvcrpnsqdvgasssrepkkkeVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
massvskidgeelvkgldnlsiSDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSyedeeddldevyfrsssslrignrrwgdnGYVRAgrqearpvcrpnsqdvgasssrepkkkevakvttgrrakRALKREAADKAAASKHQQHLARLGRNLEARCSQ
MASSVSKIDGEELVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQddleddysyedeeddldeVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGrrakralkreaadkaaaskHQQHLARLGRNLEARCSQ
**************************************FGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSY******LDEVYFR****LRIGNRRWGDNGYV**************************************************************************
*********************************************CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYM********************************YSY*DEEDDLDEVYFRSSSSL**************************************************************************ARLGRNL******
********DGEELVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGR*********************************************************ARLGRNLEARCSQ
**SSVSKIDGEELVKGLDNLSIS******************HGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAG**E********************************************K**********ARLGRNLEA*C**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSVSKIDGEELVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLARLGRNLEARCSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q99590 1463 Protein SCAF11 OS=Homo sa yes no 0.232 0.039 0.333 8e-06
P29836 676 E3 ubiquitin-protein liga no no 0.240 0.088 0.434 3e-05
P29128 676 E3 ubiquitin-protein liga no no 0.240 0.088 0.434 3e-05
P84445 532 E3 ubiquitin-protein liga no no 0.176 0.082 0.479 0.0001
P28990 532 E3 ubiquitin-protein liga no no 0.176 0.082 0.479 0.0001
Q9V8P9 1038 E3 ubiquitin-protein liga yes no 0.485 0.116 0.270 0.0003
Q09268 610 Uncharacterized RING fing no no 0.196 0.080 0.313 0.0007
Q8TDB6740 E3 ubiquitin-protein liga no no 0.168 0.056 0.434 0.0008
>sp|Q99590|SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens GN=SCAF11 PE=1 SV=2 Back     alignment and function desciption
 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 46  CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSI 105
           C ICL+  + +E    + C H +C TCIL+WA  +   +CP  + PF+ +    +L+G +
Sbjct: 41  CPICLNCLLEKEVGFPESCNHVFCMTCILKWAETLA--SCPIDRKPFQAVFKFSALEGYV 98




Plays a role in pre-mRNA alternative splicing by regulating spliceosome assembly.
Homo sapiens (taxid: 9606)
>sp|P29836|ICP0_BHV1K E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.2 (strain K22) GN=BICP0 PE=3 SV=1 Back     alignment and function description
>sp|P29128|ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) GN=BICP0 PE=3 SV=1 Back     alignment and function description
>sp|P84445|ICP0_EHV1V E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain V592) GN=ICP0 PE=3 SV=1 Back     alignment and function description
>sp|P28990|ICP0_EHV1B E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain Ab4p) GN=63 PE=1 SV=1 Back     alignment and function description
>sp|Q9V8P9|TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster GN=Topors PE=1 SV=1 Back     alignment and function description
>sp|Q09268|YQDA_CAEEL Uncharacterized RING finger protein C32D5.10 OS=Caenorhabditis elegans GN=C32D5.10 PE=4 SV=2 Back     alignment and function description
>sp|Q8TDB6|DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens GN=DTX3L PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
224059734240 predicted protein [Populus trichocarpa] 0.939 0.975 0.728 1e-92
356577416247 PREDICTED: uncharacterized protein LOC10 0.967 0.975 0.711 3e-81
255580137253 protein binding protein, putative [Ricin 0.919 0.905 0.699 6e-81
363807078251 uncharacterized protein LOC100777135 [Gl 0.971 0.964 0.701 7e-81
255646911247 unknown [Glycine max] 0.967 0.975 0.707 7e-81
224103949221 predicted protein [Populus trichocarpa] 0.859 0.968 0.754 6e-80
388503364244 unknown [Medicago truncatula] 0.947 0.967 0.681 1e-79
225436634241 PREDICTED: uncharacterized protein LOC10 0.939 0.970 0.658 5e-79
449444873244 PREDICTED: uncharacterized protein LOC10 0.959 0.979 0.647 4e-75
449444871276 PREDICTED: uncharacterized protein LOC10 0.959 0.865 0.647 4e-75
>gi|224059734|ref|XP_002299981.1| predicted protein [Populus trichocarpa] gi|222847239|gb|EEE84786.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 177/243 (72%), Positives = 199/243 (81%), Gaps = 9/243 (3%)

Query: 3   SSVSKIDGEELVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALVK 62
           +SV  IDG +L+      S+ DQGEM+SK ++ E   GNHGG+CAICLDK VLQETALVK
Sbjct: 2   TSVINIDGHQLLH-----SLQDQGEMESKVESSERACGNHGGICAICLDKIVLQETALVK 56

Query: 63  GCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRATW 122
           GCEHAYC TCILRW++Y +NPTCPQCKHPFEFL++HRSLDGSI DYMFEESVCLLLRA+W
Sbjct: 57  GCEHAYCVTCILRWSTYTKNPTCPQCKHPFEFLNIHRSLDGSIQDYMFEESVCLLLRASW 116

Query: 123 FKPLIVEDHVVVQDDLEDDYSY----EDEEDDLDEVYFRSSSSLRIGNRRWGDNGYVRAG 178
           F  L VEDH  V +D ED Y Y    ED++DDLDEVY  SSS+LRIGNRRWGDNGYVRAG
Sbjct: 117 FMTLTVEDHEDVYEDPEDYYPYEFEDEDDDDDLDEVYLSSSSNLRIGNRRWGDNGYVRAG 176

Query: 179 RQEARPVCRPNSQDVGASSSREPKKKEVAKVTTGRRAKRALKREAADKAAASKHQQHLAR 238
            QEARPV + + +D GA +SREPKKKE AK  TGRRAKR LKREAADKAAASKHQQHLAR
Sbjct: 177 HQEARPVYQADFKDSGACTSREPKKKEAAKDRTGRRAKRTLKREAADKAAASKHQQHLAR 236

Query: 239 LGR 241
           LGR
Sbjct: 237 LGR 239




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356577416|ref|XP_003556822.1| PREDICTED: uncharacterized protein LOC100785472 [Glycine max] Back     alignment and taxonomy information
>gi|255580137|ref|XP_002530900.1| protein binding protein, putative [Ricinus communis] gi|223529522|gb|EEF31476.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363807078|ref|NP_001242587.1| uncharacterized protein LOC100777135 [Glycine max] gi|255646984|gb|ACU23961.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255646911|gb|ACU23925.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224103949|ref|XP_002313256.1| predicted protein [Populus trichocarpa] gi|222849664|gb|EEE87211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388503364|gb|AFK39748.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225436634|ref|XP_002280104.1| PREDICTED: uncharacterized protein LOC100260248 [Vitis vinifera] gi|296083851|emb|CBI24239.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449444873|ref|XP_004140198.1| PREDICTED: uncharacterized protein LOC101206609 isoform 2 [Cucumis sativus] gi|449482546|ref|XP_004156316.1| PREDICTED: uncharacterized LOC101206609 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444871|ref|XP_004140197.1| PREDICTED: uncharacterized protein LOC101206609 isoform 1 [Cucumis sativus] gi|449482544|ref|XP_004156315.1| PREDICTED: uncharacterized LOC101206609 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2150310255 AT5G19430 [Arabidopsis thalian 0.959 0.937 0.482 3.3e-56
TAIR|locus:505006599254 AT5G12310 [Arabidopsis thalian 0.955 0.937 0.496 2.9e-55
UNIPROTKB|F8W6K1118 SCAF11 "Protein SCAF11" [Homo 0.232 0.491 0.333 1e-06
ZFIN|ZDB-GENE-091204-454155 si:ch1073-392o20.1 "si:ch1073- 0.305 0.490 0.317 5.4e-06
ZFIN|ZDB-GENE-030131-9441292 rnf41l "ring finger protein 41 0.232 0.198 0.365 4.8e-05
TAIR|locus:2064905296 AT2G39100 [Arabidopsis thalian 0.196 0.165 0.403 8.4e-05
UNIPROTKB|F1NJF6148 RNF122 "Uncharacterized protei 0.192 0.324 0.38 0.00016
UNIPROTKB|F1Q390359 RNF167 "Uncharacterized protei 0.257 0.178 0.384 0.00016
UNIPROTKB|I3LS90 1426 SCAF11 "Uncharacterized protei 0.373 0.065 0.300 0.00023
UNIPROTKB|A8MUK077 SCAF11 "Protein SCAF11" [Homo 0.140 0.454 0.432 0.00026
TAIR|locus:2150310 AT5G19430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 579 (208.9 bits), Expect = 3.3e-56, P = 3.3e-56
 Identities = 122/253 (48%), Positives = 153/253 (60%)

Query:     3 SSVSKIDGEE-LVKGLDNLSISDQGEMQSKADNREMGFGNHGGVCAICLDKTVLQETALV 61
             SSV++I  E+ ++ G+ +L++ +Q + + + +  E  FGNHGG CAICL +  LQETA+V
Sbjct:     2 SSVTEIVSEQQVIDGIQDLALQNQDKKKIQEEIHEPSFGNHGGCCAICLSEIPLQETAMV 61

Query:    62 KGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSISDYMFEESVCLLLRAT 121
             KGCEH YC TCILRWAS   +PTCPQCKHPF+FL VHR+LDGSI D++FEESVCLLLRA+
Sbjct:    62 KGCEHTYCVTCILRWASCKESPTCPQCKHPFDFLSVHRALDGSIEDFLFEESVCLLLRAS 121

Query:   122 WFKPL-IVEDHVVVQXXXXXXXXXXXXXXXXXXV--YFRSSSSLRIGNRRWGDNGYVRAG 178
             WF PL +VE                        +  ++   SSLRIGNRRWG NG+VR+G
Sbjct:   122 WFVPLDVVEQASYSHGYHDDFDIPYDYEDEDDDLDEFYLHGSSLRIGNRRWGGNGFVRSG 181

Query:   179 RQEARPVCR-----PNSQDVGASSSREPKKKEVAKV-TTGXXXXXX----XXXXXXXXXX 228
             RQEARPV R      +S     SSS EPK K+V    TTG                    
Sbjct:   182 RQEARPVQRYSGSGSSSSSSSGSSSSEPKDKQVKTTNTTGRRAKRAMKREAANKAAEVTA 241

Query:   229 XXXHQQHLARLGR 241
                H+ HL RLGR
Sbjct:   242 AAKHEAHLVRLGR 254




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:505006599 AT5G12310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F8W6K1 SCAF11 "Protein SCAF11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-454 si:ch1073-392o20.1 "si:ch1073-392o20.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9441 rnf41l "ring finger protein 41, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2064905 AT2G39100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJF6 RNF122 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q390 RNF167 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LS90 SCAF11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A8MUK0 SCAF11 "Protein SCAF11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-08
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 9e-07
smart0018440 smart00184, RING, Ring finger 2e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 1e-04
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
 Score = 49.0 bits (117), Expect = 2e-08
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 46 CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPF 92
          C ICL++   +E  ++  C H +C +CI +W       TCP C+ P 
Sbjct: 2  CPICLEE--FREPVVLLPCGHVFCRSCIDKWLKS-GKNTCPLCRTPI 45


Length = 45

>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.21
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.2
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.13
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.13
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.09
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.07
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.06
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.04
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.03
PHA02929238 N1R/p28-like protein; Provisional 99.03
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.02
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.0
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.98
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.95
PHA02926242 zinc finger-like protein; Provisional 98.93
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.9
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.87
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.85
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.82
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.78
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.77
PF1463444 zf-RING_5: zinc-RING finger domain 98.74
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.65
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.64
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.64
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.58
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.58
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.43
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.41
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.18
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 98.17
KOG2660 331 consensus Locus-specific chromosome binding protei 98.15
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.09
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 98.05
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.01
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.9
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.88
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.79
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.74
COG52191525 Uncharacterized conserved protein, contains RING Z 97.72
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.71
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.59
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.55
COG5152259 Uncharacterized conserved protein, contains RING a 97.52
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.4
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.38
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.36
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.35
COG5222427 Uncharacterized conserved protein, contains RING Z 97.28
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.24
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.99
KOG4739233 consensus Uncharacterized protein involved in syna 96.86
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.8
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.8
KOG1941518 consensus Acetylcholine receptor-associated protei 96.73
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.63
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.27
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 96.25
KOG4445368 consensus Uncharacterized conserved protein, conta 96.17
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.17
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.09
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.96
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.68
KOG1001674 consensus Helicase-like transcription factor HLTF/ 95.67
PHA02825162 LAP/PHD finger-like protein; Provisional 95.55
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.53
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.47
PF04641260 Rtf2: Rtf2 RING-finger 95.47
PHA03096284 p28-like protein; Provisional 95.46
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.45
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.42
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.31
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.3
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.23
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.19
PHA02862156 5L protein; Provisional 95.11
KOG3002299 consensus Zn finger protein [General function pred 95.02
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 95.02
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.79
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 94.75
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.75
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.7
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.7
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.7
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 94.53
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.12
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.12
KOG1940276 consensus Zn-finger protein [General function pred 94.12
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 93.82
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 93.72
KOG02981394 consensus DEAD box-containing helicase-like transc 93.64
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.44
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.42
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.63
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 91.41
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 90.15
KOG3899381 consensus Uncharacterized conserved protein [Funct 88.77
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 87.7
PLN02189 1040 cellulose synthase 87.61
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 86.01
PLN02400 1085 cellulose synthase 85.62
COG5109396 Uncharacterized conserved protein, contains RING Z 85.47
KOG3053293 consensus Uncharacterized conserved protein [Funct 84.54
PLN02436 1094 cellulose synthase A 83.63
KOG0825 1134 consensus PHD Zn-finger protein [General function 83.15
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 82.6
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 82.45
KOG3039303 consensus Uncharacterized conserved protein [Funct 81.77
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 81.61
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 81.07
PF1481281 PBP1_TM: Transmembrane domain of transglycosylase 80.19
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
Probab=99.21  E-value=5.1e-12  Score=82.21  Aligned_cols=43  Identities=33%  Similarity=0.831  Sum_probs=36.4

Q ss_pred             cccccccCccCCCceEecCCCCcccHHHHHHHHhcCCCCCCCCCc
Q 025685           45 VCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCK   89 (249)
Q Consensus        45 ~C~ICl~~~~~~~pv~~l~CgH~FC~~CI~~w~~~~~~~~CP~CR   89 (249)
                      .|+||++.|...+.+..++|||.||..||..|+..  +.+||+||
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~--~~~CP~CR   44 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKR--NNSCPVCR   44 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHHHHHHHH--SSB-TTTH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHHHHHHHh--CCcCCccC
Confidence            59999999755666778899999999999999984  56999997



...

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14812 PBP1_TM: Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 3e-05
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 3e-05, Method: Composition-based stats. Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 46 CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFE 93 C ICL+ AL C HA+C CI RW +NPTCP CK P E Sbjct: 8 CPICLEDPSNYSMAL--PCLHAFCYVCITRWIR--QNPTCPLCKVPVE 51

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-12
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-09
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 8e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 8e-09
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-08
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 9e-08
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 1e-07
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-06
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 7e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 9e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-05
3nw0_A238 Non-structural maintenance of chromosomes element 4e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 4e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 5e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 5e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 6e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 6e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 8e-05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 9e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-04
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 4e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 4e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 5e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 5e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 6e-04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 6e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 7e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 59.7 bits (145), Expect = 2e-12
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 46  CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSI 105
           C ICL+       ++   C HA+C  CI RW    +NPTCP CK P E +      D   
Sbjct: 8   CPICLED--PSNYSMALPCLHAFCYVCITRWIR--QNPTCPLCKVPVESVVHTIESDSEF 63

Query: 106 SDYM 109
            D +
Sbjct: 64  GDQL 67


>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.5
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.5
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.46
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.46
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.42
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.41
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.41
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.41
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.4
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.4
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.37
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.36
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.36
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.35
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.35
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.35
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.33
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.33
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.32
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.3
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
2ect_A78 Ring finger protein 126; metal binding protein, st 99.3
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.3
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.29
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.28
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.27
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.27
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.27
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.27
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.26
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.25
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.25
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.25
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.23
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.23
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.23
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.22
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.2
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.19
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.18
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.15
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.15
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.14
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.14
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.03
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.02
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.96
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.96
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.92
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.88
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.87
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.87
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.82
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.82
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.81
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.8
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.71
2ea5_A68 Cell growth regulator with ring finger domain prot 98.69
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.64
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.56
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.43
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.17
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.07
3nw0_A238 Non-structural maintenance of chromosomes element 97.48
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 96.62
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.57
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.02
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 92.5
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.65
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 88.67
2k16_A75 Transcription initiation factor TFIID subunit 3; p 87.37
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 86.5
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 82.69
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 80.66
1we9_A64 PHD finger family protein; structural genomics, PH 80.59
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
Probab=99.50  E-value=2.9e-14  Score=105.53  Aligned_cols=70  Identities=24%  Similarity=0.458  Sum_probs=57.8

Q ss_pred             CCCCcccccccccCccCCCceEecC-CCCcccHHHHHHHHhcCCCCCCCCCcccCcc---cccchhhhhHHHHhhhh
Q 025685           39 FGNHGGVCAICLDKTVLQETALVKG-CEHAYCATCILRWASYVRNPTCPQCKHPFEF---LHVHRSLDGSISDYMFE  111 (249)
Q Consensus        39 ~~~~~~~C~ICl~~~~~~~pv~~l~-CgH~FC~~CI~~w~~~~~~~~CP~CR~~~~~---~~~~~~l~~~i~~~~~e  111 (249)
                      ...+.+.|+||++.  +.+|+ +++ |||+||..||..|+...+...||+||..+..   +.+|..+.+++..+...
T Consensus         9 ~~~~~~~C~IC~~~--~~~p~-~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~~~   82 (92)
T 3ztg_A            9 PIPDELLCLICKDI--MTDAV-VIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNE   82 (92)
T ss_dssp             CCCTTTEETTTTEE--CSSCE-ECTTTCCEECHHHHHHHHHHCTTCCCTTTCCSSCCTTSCEECHHHHHHHHHHHHH
T ss_pred             cCCcCCCCCCCChh--hcCce-ECCCCCCHHHHHHHHHHHHhcCCCcCcCCCCcCCCccccCcCHHHHHHHHHHHHH
Confidence            34578999999999  78998 568 9999999999999975456799999999742   78888888888876543



>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-10
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 5e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-07
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 3e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 9e-04
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]
 Score = 52.6 bits (126), Expect = 4e-10
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 46  CAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEFLHVHRSLDGSI 105
           C ICL+       ++   C HA+C  CI RW    +NPTCP CK P E +      D   
Sbjct: 8   CPICLED--PSNYSMALPCLHAFCYVCITRWIR--QNPTCPLCKVPVESVVHTIESDSEF 63

Query: 106 SDYM 109
            D +
Sbjct: 64  GDQL 67


>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.49
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.49
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.4
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.4
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.39
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.36
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.34
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.31
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.29
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.28
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.27
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.15
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.07
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.07
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.95
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.7
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 90.18
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 85.52
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 85.49
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 84.53
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.08
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 83.98
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 81.64
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 81.18
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 81.08
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.49  E-value=1.3e-14  Score=103.67  Aligned_cols=65  Identities=12%  Similarity=0.124  Sum_probs=57.5

Q ss_pred             CCcccccccccCccCCCceEecCCCCcccHHHHHHHHhcCCCCCCCCCcccCcc--cccchhhhhHHHHhh
Q 025685           41 NHGGVCAICLDKTVLQETALVKGCEHAYCATCILRWASYVRNPTCPQCKHPFEF--LHVHRSLDGSISDYM  109 (249)
Q Consensus        41 ~~~~~C~ICl~~~~~~~pv~~l~CgH~FC~~CI~~w~~~~~~~~CP~CR~~~~~--~~~~~~l~~~i~~~~  109 (249)
                      .+.+.||||+++  +.+|+ +++|||+||..||..|+.. ....||.|+.++..  +.+|..+.++++.|.
T Consensus         5 P~~l~CpIc~~l--~~dPv-~~~cGhtfc~~ci~~~l~~-~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l   71 (80)
T d2c2la2           5 PDYLCGKISFEL--MREPC-ITPSGITYDRKDIEEHLQR-VGHFNPVTRSPLTQEQLIPNLAMKEVIDAFI   71 (80)
T ss_dssp             CSTTBCTTTCSB--CSSEE-ECSSCCEEETTHHHHHHHH-TCSSCTTTCCCCCGGGCEECHHHHHHHHHHH
T ss_pred             CccccCcCcCch--hhhhc-ccCCcCeecHHHHHHHHhc-CCccCCCccccccccccccHHHHHHHHHHHH
Confidence            578999999999  89998 6799999999999999974 56789999999876  888999998888864



>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure