Citrus Sinensis ID: 025807
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 248 | 2.2.26 [Sep-21-2011] | |||||||
| Q6XZ79 | 323 | Fructokinase-1 OS=Zea may | N/A | no | 0.774 | 0.594 | 0.75 | 2e-81 | |
| Q0JGZ6 | 323 | Fructokinase-1 OS=Oryza s | yes | no | 0.774 | 0.594 | 0.744 | 3e-81 | |
| A2WXV8 | 323 | Fructokinase-1 OS=Oryza s | N/A | no | 0.774 | 0.594 | 0.739 | 1e-80 | |
| Q42896 | 328 | Fructokinase-2 OS=Solanum | N/A | no | 0.774 | 0.585 | 0.713 | 9e-80 | |
| Q7XJ81 | 328 | Fructokinase-2 OS=Solanum | N/A | no | 0.774 | 0.585 | 0.713 | 2e-79 | |
| Q9M1B9 | 326 | Probable fructokinase-4 O | no | no | 0.786 | 0.598 | 0.702 | 3e-79 | |
| O82616 | 324 | Putative fructokinase-5 O | no | no | 0.774 | 0.592 | 0.713 | 4e-79 | |
| Q9SID0 | 325 | Probable fructokinase-1 O | no | no | 0.774 | 0.590 | 0.718 | 5e-79 | |
| Q9LNE4 | 345 | Probable fructokinase-3 O | no | no | 0.774 | 0.556 | 0.708 | 2e-78 | |
| Q9LNE3 | 329 | Probable fructokinase-2 O | no | no | 0.814 | 0.613 | 0.683 | 5e-78 |
| >sp|Q6XZ79|SCRK1_MAIZE Fructokinase-1 OS=Zea mays GN=FRK1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 301 bits (772), Expect = 2e-81, Method: Compositional matrix adjust.
Identities = 144/192 (75%), Positives = 164/192 (85%)
Query: 30 LVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGISRLGGSSAFVGKLGDDEF 89
LVV FGEMLIDFVPTV GVSLAEAPAF KAPGGAPANVA+ +SRLGG +AFVGKLGDDEF
Sbjct: 7 LVVSFGEMLIDFVPTVAGVSLAEAPAFLKAPGGAPANVAIAVSRLGGGAAFVGKLGDDEF 66
Query: 90 GYMLANILKENNVDTSGVRYDSTARTALAFVTLRADGEREFLFFRHPSADMLLCESELDK 149
G MLA IL++N VD GV +DS ARTALAFVTLRADGEREF+F+R+PSADMLL EL+
Sbjct: 67 GRMLAAILRDNGVDDGGVVFDSGARTALAFVTLRADGEREFMFYRNPSADMLLTADELNV 126
Query: 150 NLIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGSILSYDPNLRLPLWPSEEAAREGI 209
LIK+ ++FHYGSISLIAEPCR+ L AM +AKE+G++LSYDPNLR LWPS E AR I
Sbjct: 127 ELIKRAAVFHYGSISLIAEPCRTAHLRAMEIAKEAGALLSYDPNLREALWPSREEARTQI 186
Query: 210 MSIWDQADIIKV 221
+SIWDQADI+KV
Sbjct: 187 LSIWDQADIVKV 198
|
May play an important role in maintaining the flux of carbon towards starch formation in endosperm. May also be involved in a sugar-sensing pathway. Zea mays (taxid: 4577) EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4 |
| >sp|Q0JGZ6|SCRK1_ORYSJ Fructokinase-1 OS=Oryza sativa subsp. japonica GN=FRK1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A2WXV8|SCRK1_ORYSI Fructokinase-1 OS=Oryza sativa subsp. indica GN=FRK1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q42896|SCRK2_SOLLC Fructokinase-2 OS=Solanum lycopersicum GN=FRK2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q7XJ81|SCRK2_SOLHA Fructokinase-2 OS=Solanum habrochaites GN=FRK2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9M1B9|SCRK4_ARATH Probable fructokinase-4 OS=Arabidopsis thaliana GN=At3g59480 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O82616|SCRK5_ARATH Putative fructokinase-5 OS=Arabidopsis thaliana GN=At4g10260 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SID0|SCRK1_ARATH Probable fructokinase-1 OS=Arabidopsis thaliana GN=At2g31390 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LNE4|SCRK3_ARATH Probable fructokinase-3 OS=Arabidopsis thaliana GN=At1g06020 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LNE3|SCRK2_ARATH Probable fructokinase-2 OS=Arabidopsis thaliana GN=At1g06030 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 248 | ||||||
| 45550051 | 350 | fructokinase [Citrus unshiu] | 0.887 | 0.628 | 0.981 | 1e-121 | |
| 339896185 | 336 | fructokinase [Dimocarpus longan] | 0.822 | 0.607 | 0.811 | 3e-97 | |
| 224134627 | 349 | predicted protein [Populus trichocarpa] | 0.891 | 0.633 | 0.785 | 3e-96 | |
| 224122496 | 351 | predicted protein [Populus trichocarpa] | 0.830 | 0.586 | 0.825 | 5e-96 | |
| 118486108 | 299 | unknown [Populus trichocarpa] | 0.879 | 0.729 | 0.785 | 9e-95 | |
| 297792499 | 343 | pfkB-type carbohydrate kinase family pro | 0.782 | 0.565 | 0.835 | 5e-92 | |
| 356574458 | 341 | PREDICTED: putative fructokinase-5-like | 0.850 | 0.618 | 0.794 | 9e-92 | |
| 350535657 | 375 | fructokinase [Solanum lycopersicum] gi|2 | 0.782 | 0.517 | 0.829 | 1e-91 | |
| 15242193 | 343 | fructokinase [Arabidopsis thaliana] gi|1 | 0.782 | 0.565 | 0.829 | 2e-91 | |
| 356559893 | 345 | PREDICTED: putative fructokinase-5-like | 0.858 | 0.617 | 0.768 | 4e-91 |
| >gi|45550051|gb|AAS67872.1| fructokinase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 438 bits (1127), Expect = e-121, Method: Compositional matrix adjust.
Identities = 217/221 (98%), Positives = 217/221 (98%), Gaps = 1/221 (0%)
Query: 1 MADNHNPTSGAGSKDLSASMDGGSGAYDRLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAP 60
MADNHNPTSGAGSKDLSASMDGGSGAYDRLVVCFGEMLIDFVPTVGGVSLAEAPAFKK
Sbjct: 1 MADNHNPTSGAGSKDLSASMDGGSGAYDRLVVCFGEMLIDFVPTVGGVSLAEAPAFKKLL 60
Query: 61 GGAPANVAVGISRLGGSSAFVGKLGDDEFGYMLANILKENNVDTSGVRYDSTARTALAFV 120
APANVAVGISRLGGSSAFVGKLGDDEFGYMLANILKENNVDTSGVRYDSTARTALAFV
Sbjct: 61 C-APANVAVGISRLGGSSAFVGKLGDDEFGYMLANILKENNVDTSGVRYDSTARTALAFV 119
Query: 121 TLRADGEREFLFFRHPSADMLLCESELDKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNL 180
TLRADGEREFLFFRHPSADMLLCESELDKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNL
Sbjct: 120 TLRADGEREFLFFRHPSADMLLCESELDKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNL 179
Query: 181 AKESGSILSYDPNLRLPLWPSEEAAREGIMSIWDQADIIKV 221
AKESGSILSYDPNLRLPLWPSEEAAREGIMSIWDQADIIKV
Sbjct: 180 AKESGSILSYDPNLRLPLWPSEEAAREGIMSIWDQADIIKV 220
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|339896185|gb|AEK21796.1| fructokinase [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|224134627|ref|XP_002321869.1| predicted protein [Populus trichocarpa] gi|222868865|gb|EEF05996.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224122496|ref|XP_002318851.1| predicted protein [Populus trichocarpa] gi|222859524|gb|EEE97071.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118486108|gb|ABK94897.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297792499|ref|XP_002864134.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297309969|gb|EFH40393.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356574458|ref|XP_003555364.1| PREDICTED: putative fructokinase-5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|350535657|ref|NP_001234206.1| fructokinase [Solanum lycopersicum] gi|23476263|gb|AAM44084.1| fructokinase [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|15242193|ref|NP_199996.1| fructokinase [Arabidopsis thaliana] gi|13878053|gb|AAK44104.1|AF370289_1 putative fructokinase 1 [Arabidopsis thaliana] gi|10177882|dbj|BAB11252.1| fructokinase 1 [Arabidopsis thaliana] gi|17104645|gb|AAL34211.1| putative fructokinase 1 [Arabidopsis thaliana] gi|332008749|gb|AED96132.1| fructokinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356559893|ref|XP_003548230.1| PREDICTED: putative fructokinase-5-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 248 | ||||||
| TAIR|locus:2165361 | 343 | AT5G51830 [Arabidopsis thalian | 0.782 | 0.565 | 0.726 | 1.8e-71 | |
| TAIR|locus:2028987 | 384 | AT1G66430 [Arabidopsis thalian | 0.866 | 0.559 | 0.611 | 9.7e-64 | |
| TAIR|locus:2122789 | 324 | AT4G10260 [Arabidopsis thalian | 0.774 | 0.592 | 0.640 | 2.3e-62 | |
| TAIR|locus:2198831 | 329 | AT1G06030 [Arabidopsis thalian | 0.814 | 0.613 | 0.618 | 3.8e-62 | |
| TAIR|locus:2097553 | 326 | AT3G59480 [Arabidopsis thalian | 0.786 | 0.598 | 0.625 | 6.2e-62 | |
| TAIR|locus:2198821 | 345 | AT1G06020 [Arabidopsis thalian | 0.806 | 0.579 | 0.617 | 1.6e-61 | |
| TAIR|locus:2061320 | 325 | AT2G31390 [Arabidopsis thalian | 0.774 | 0.590 | 0.635 | 2.7e-61 | |
| TAIR|locus:2080270 | 471 | FLN1 "AT3G54090" [Arabidopsis | 0.596 | 0.314 | 0.36 | 5.1e-24 | |
| UNIPROTKB|Q481A7 | 336 | CPS_2648 "Carbohydrate kinase, | 0.782 | 0.577 | 0.353 | 1.1e-23 | |
| TIGR_CMR|CPS_2648 | 336 | CPS_2648 "carbohydrate kinase, | 0.782 | 0.577 | 0.353 | 1.1e-23 |
| TAIR|locus:2165361 AT5G51830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 723 (259.6 bits), Expect = 1.8e-71, P = 1.8e-71
Identities = 141/194 (72%), Positives = 158/194 (81%)
Query: 28 DRLVVCFGEMLIDFVPTVGGVSLXXXXXXXXXXXXXXXXXXXXISRLGGSSAFVGKLGDD 87
+ LVVCFGEMLIDFVPTVGGVSL +SRLGGSSAF+GK+GDD
Sbjct: 21 ETLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGVSRLGGSSAFIGKVGDD 80
Query: 88 EFGYMLANILKENNVDTSGVRYDSTARTALAFVTLRADGEREFLFFRHPSADMLLCESEL 147
EFG MLA+IL+ NNVD SG+R+D ARTALAFVTLR DGEREFLFFRHPSADMLL ESEL
Sbjct: 81 EFGRMLADILRLNNVDNSGMRFDHNARTALAFVTLRGDGEREFLFFRHPSADMLLLESEL 140
Query: 148 DKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGSILSYDPNLRLPLWPSEEAARE 207
DKNLI++ IFHYGSISLI EPCRSTQL AM +AK +GS+LSYDPNLRLPLWPSEEAAR+
Sbjct: 141 DKNLIQKAKIFHYGSISLIEEPCRSTQLVAMKIAKAAGSLLSYDPNLRLPLWPSEEAARK 200
Query: 208 GIMSIWDQADIIKV 221
IMSIW+ AD+IK+
Sbjct: 201 EIMSIWNLADVIKI 214
|
|
| TAIR|locus:2028987 AT1G66430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122789 AT4G10260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198831 AT1G06030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097553 AT3G59480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198821 AT1G06020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061320 AT2G31390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080270 FLN1 "AT3G54090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q481A7 CPS_2648 "Carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2648 CPS_2648 "carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q0JGZ6 | SCRK1_ORYSJ | 2, ., 7, ., 1, ., 4 | 0.7447 | 0.7741 | 0.5944 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 2.7.1.4 | 0.914 |
| 3rd Layer | 2.7.1 | 0.921 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | eugene3.00151131 | SubName- Full=Putative uncharacterized protein; (350 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | gw1.VIII.2574.1 | • | • | 0.905 | |||||||
 | gw1.XIX.1506.1 | • | 0.899 | ||||||||
 | gw1.XII.1035.1 | • | 0.899 | ||||||||
 | gw1.XI.1644.1 | • | 0.899 | ||||||||
 | gw1.VII.4031.1 | • | 0.899 | ||||||||
 | gw1.VI.935.1 | • | 0.899 | ||||||||
 | gw1.II.3030.1 | • | 0.899 | ||||||||
 | gw1.263.13.1 | • | 0.899 | ||||||||
 | gw1.137.65.1 | • | 0.899 | ||||||||
 | grail3.0003059501 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 248 | |||
| PLN02323 | 330 | PLN02323, PLN02323, probable fructokinase | 1e-154 | |
| cd01167 | 295 | cd01167, bac_FRK, Fructokinases (FRKs) mainly from | 6e-85 | |
| cd01166 | 294 | cd01166, KdgK, 2-keto-3-deoxygluconate kinase (Kdg | 1e-55 | |
| PRK09434 | 304 | PRK09434, PRK09434, aminoimidazole riboside kinase | 2e-52 | |
| COG0524 | 311 | COG0524, RbsK, Sugar kinases, ribokinase family [C | 4e-44 | |
| PLN02543 | 496 | PLN02543, PLN02543, pfkB-type carbohydrate kinase | 1e-43 | |
| pfam00294 | 298 | pfam00294, PfkB, pfkB family carbohydrate kinase | 1e-42 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 7e-34 | |
| cd01942 | 279 | cd01942, ribokinase_group_A, Ribokinase-like subgr | 2e-19 | |
| cd01174 | 292 | cd01174, ribokinase, Ribokinase catalyses the phos | 3e-18 | |
| TIGR02152 | 293 | TIGR02152, D_ribokin_bact, ribokinase | 3e-17 | |
| cd01168 | 312 | cd01168, adenosine_kinase, Adenosine kinase (AK) c | 5e-13 | |
| cd01940 | 264 | cd01940, Fructoselysine_kinase_like, Fructoselysin | 2e-11 | |
| PTZ00292 | 326 | PTZ00292, PTZ00292, ribokinase; Provisional | 6e-11 | |
| PRK09813 | 260 | PRK09813, PRK09813, fructoselysine 6-kinase; Provi | 1e-10 | |
| cd01945 | 284 | cd01945, ribokinase_group_B, Ribokinase-like subgr | 2e-10 | |
| cd01172 | 304 | cd01172, RfaE_like, RfaE encodes a bifunctional AD | 5e-08 | |
| PRK11142 | 306 | PRK11142, PRK11142, ribokinase; Provisional | 1e-07 | |
| TIGR02198 | 315 | TIGR02198, rfaE_dom_I, rfaE bifunctional protein, | 2e-07 | |
| PRK11316 | 473 | PRK11316, PRK11316, bifunctional heptose 7-phospha | 5e-07 | |
| cd01947 | 265 | cd01947, Guanosine_kinase_like, Guanosine kinase-l | 3e-06 | |
| cd01941 | 288 | cd01941, YeiC_kinase_like, YeiC-like sugar kinase | 2e-05 | |
| cd01944 | 289 | cd01944, YegV_kinase_like, YegV-like sugar kinase | 3e-05 | |
| COG2870 | 467 | COG2870, RfaE, ADP-heptose synthase, bifunctional | 7e-05 | |
| PLN02341 | 470 | PLN02341, PLN02341, pfkB-type carbohydrate kinase | 2e-04 |
| >gnl|CDD|215183 PLN02323, PLN02323, probable fructokinase | Back alignment and domain information |
|---|
Score = 431 bits (1110), Expect = e-154
Identities = 162/203 (79%), Positives = 181/203 (89%)
Query: 19 SMDGGSGAYDRLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGISRLGGSS 78
SM S A LVVCFGEMLIDFVPTV GVSLAEAPAFKKAPGGAPANVAVGISRLGGSS
Sbjct: 1 SMTAPSTAESSLVVCFGEMLIDFVPTVSGVSLAEAPAFKKAPGGAPANVAVGISRLGGSS 60
Query: 79 AFVGKLGDDEFGYMLANILKENNVDTSGVRYDSTARTALAFVTLRADGEREFLFFRHPSA 138
AF+GK+GDDEFG+MLA+ILK+N V+ GVR+D ARTALAFVTLR+DGEREF+F+R+PSA
Sbjct: 61 AFIGKVGDDEFGHMLADILKKNGVNNEGVRFDPGARTALAFVTLRSDGEREFMFYRNPSA 120
Query: 139 DMLLCESELDKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGSILSYDPNLRLPL 198
DMLL ESELD +LI++ IFHYGSISLI EPCRS LAAM +AKE+G++LSYDPNLRLPL
Sbjct: 121 DMLLRESELDLDLIRKAKIFHYGSISLITEPCRSAHLAAMKIAKEAGALLSYDPNLRLPL 180
Query: 199 WPSEEAAREGIMSIWDQADIIKV 221
WPS EAAREGIMSIWD+ADIIKV
Sbjct: 181 WPSAEAAREGIMSIWDEADIIKV 203
|
Length = 330 |
| >gnl|CDD|238572 cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|238571 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) | Back alignment and domain information |
|---|
| >gnl|CDD|236514 PRK09434, PRK09434, aminoimidazole riboside kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215299 PLN02543, PLN02543, pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|238917 cd01942, ribokinase_group_A, Ribokinase-like subgroup A | Back alignment and domain information |
|---|
| >gnl|CDD|238579 cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP | Back alignment and domain information |
|---|
| >gnl|CDD|233751 TIGR02152, D_ribokin_bact, ribokinase | Back alignment and domain information |
|---|
| >gnl|CDD|238573 cd01168, adenosine_kinase, Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor | Back alignment and domain information |
|---|
| >gnl|CDD|238915 cd01940, Fructoselysine_kinase_like, Fructoselysine kinase-like | Back alignment and domain information |
|---|
| >gnl|CDD|185541 PTZ00292, PTZ00292, ribokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182090 PRK09813, PRK09813, fructoselysine 6-kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238920 cd01945, ribokinase_group_B, Ribokinase-like subgroup B | Back alignment and domain information |
|---|
| >gnl|CDD|238577 cd01172, RfaE_like, RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose | Back alignment and domain information |
|---|
| >gnl|CDD|236858 PRK11142, PRK11142, ribokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233776 TIGR02198, rfaE_dom_I, rfaE bifunctional protein, domain I | Back alignment and domain information |
|---|
| >gnl|CDD|183085 PRK11316, PRK11316, bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238922 cd01947, Guanosine_kinase_like, Guanosine kinase-like sugar kinases | Back alignment and domain information |
|---|
| >gnl|CDD|238916 cd01941, YeiC_kinase_like, YeiC-like sugar kinase | Back alignment and domain information |
|---|
| >gnl|CDD|238919 cd01944, YegV_kinase_like, YegV-like sugar kinase | Back alignment and domain information |
|---|
| >gnl|CDD|225425 COG2870, RfaE, ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215195 PLN02341, PLN02341, pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 248 | |||
| PLN02543 | 496 | pfkB-type carbohydrate kinase family protein | 100.0 | |
| PLN02323 | 330 | probable fructokinase | 100.0 | |
| PLN02967 | 581 | kinase | 100.0 | |
| PRK15074 | 434 | inosine/guanosine kinase; Provisional | 99.97 | |
| cd01167 | 295 | bac_FRK Fructokinases (FRKs) mainly from bacteria | 99.97 | |
| cd01166 | 294 | KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho | 99.97 | |
| PRK09434 | 304 | aminoimidazole riboside kinase; Provisional | 99.97 | |
| cd01168 | 312 | adenosine_kinase Adenosine kinase (AK) catalyzes t | 99.96 | |
| PRK11142 | 306 | ribokinase; Provisional | 99.96 | |
| PTZ00292 | 326 | ribokinase; Provisional | 99.96 | |
| PLN02813 | 426 | pfkB-type carbohydrate kinase family protein | 99.96 | |
| cd01944 | 289 | YegV_kinase_like YegV-like sugar kinase. Found onl | 99.96 | |
| cd01174 | 292 | ribokinase Ribokinase catalyses the phosphorylatio | 99.96 | |
| PLN02341 | 470 | pfkB-type carbohydrate kinase family protein | 99.96 | |
| COG0524 | 311 | RbsK Sugar kinases, ribokinase family [Carbohydrat | 99.96 | |
| cd01942 | 279 | ribokinase_group_A Ribokinase-like subgroup A. Fou | 99.96 | |
| PTZ00247 | 345 | adenosine kinase; Provisional | 99.95 | |
| PLN02379 | 367 | pfkB-type carbohydrate kinase family protein | 99.94 | |
| KOG2855 | 330 | consensus Ribokinase [Carbohydrate transport and m | 99.94 | |
| PF00294 | 301 | PfkB: pfkB family carbohydrate kinase; InterPro: I | 99.94 | |
| cd01945 | 284 | ribokinase_group_B Ribokinase-like subgroup B. Fou | 99.94 | |
| cd01939 | 290 | Ketohexokinase Ketohexokinase (fructokinase, KHK) | 99.94 | |
| PRK09850 | 313 | pseudouridine kinase; Provisional | 99.93 | |
| cd01947 | 265 | Guanosine_kinase_like Guanosine kinase-like sugar | 99.93 | |
| TIGR02152 | 293 | D_ribokin_bact ribokinase. This model describes ri | 99.93 | |
| cd01940 | 264 | Fructoselysine_kinase_like Fructoselysine kinase-l | 99.93 | |
| PRK09954 | 362 | putative kinase; Provisional | 99.92 | |
| TIGR02198 | 315 | rfaE_dom_I rfaE bifunctional protein, domain I. Rf | 99.92 | |
| cd01941 | 288 | YeiC_kinase_like YeiC-like sugar kinase. Found in | 99.92 | |
| cd01943 | 328 | MAK32 MAK32 kinase. MAK32 is a protein found prima | 99.91 | |
| PRK09813 | 260 | fructoselysine 6-kinase; Provisional | 99.91 | |
| cd01172 | 304 | RfaE_like RfaE encodes a bifunctional ADP-heptose | 99.91 | |
| TIGR03828 | 304 | pfkB 1-phosphofructokinase. This enzyme acts in co | 99.89 | |
| cd01164 | 289 | FruK_PfkB_like 1-phosphofructokinase (FruK), minor | 99.89 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 99.88 | |
| PLN02548 | 332 | adenosine kinase | 99.88 | |
| TIGR03168 | 303 | 1-PFK hexose kinase, 1-phosphofructokinase family. | 99.88 | |
| PRK09513 | 312 | fruK 1-phosphofructokinase; Provisional | 99.87 | |
| TIGR01231 | 309 | lacC tagatose-6-phosphate kinase. This enzyme is p | 99.87 | |
| PRK13508 | 309 | tagatose-6-phosphate kinase; Provisional | 99.87 | |
| KOG2854 | 343 | consensus Possible pfkB family carbohydrate kinase | 99.87 | |
| PRK10294 | 309 | 6-phosphofructokinase 2; Provisional | 99.86 | |
| cd01937 | 254 | ribokinase_group_D Ribokinase-like subgroup D. Fou | 99.85 | |
| PLN02630 | 335 | pfkB-type carbohydrate kinase family protein | 99.85 | |
| cd01946 | 277 | ribokinase_group_C Ribokinase-like subgroup C. Fou | 99.83 | |
| KOG2947 | 308 | consensus Carbohydrate kinase [Carbohydrate transp | 99.82 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 99.78 | |
| COG1105 | 310 | FruK Fructose-1-phosphate kinase and related fruct | 99.77 | |
| cd00287 | 196 | ribokinase_pfkB_like ribokinase/pfkB superfamily: | 99.7 | |
| KOG3009 | 614 | consensus Predicted carbohydrate kinase, contains | 98.5 | |
| cd01173 | 254 | pyridoxal_pyridoxamine_kinase Pyridoxal kinase pla | 97.84 | |
| PRK07105 | 284 | pyridoxamine kinase; Validated | 97.68 | |
| cd01938 | 445 | ADPGK_ADPPFK ADP-dependent glucokinase (ADPGK) and | 97.6 | |
| PRK14039 | 453 | ADP-dependent glucokinase; Provisional | 97.59 | |
| PRK12413 | 253 | phosphomethylpyrimidine kinase; Provisional | 97.53 | |
| TIGR00687 | 286 | pyridox_kin pyridoxal kinase. ThiD and related pro | 97.37 | |
| PRK05756 | 286 | pyridoxamine kinase; Validated | 97.36 | |
| cd01169 | 242 | HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrim | 97.29 | |
| PLN02978 | 308 | pyridoxal kinase | 97.25 | |
| PRK08176 | 281 | pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpy | 97.24 | |
| PF04587 | 444 | ADP_PFK_GK: ADP-specific Phosphofructokinase/Gluco | 97.22 | |
| TIGR02045 | 446 | P_fruct_ADP ADP-specific phosphofructokinase. Phos | 97.17 | |
| PTZ00344 | 296 | pyridoxal kinase; Provisional | 97.14 | |
| TIGR00097 | 254 | HMP-P_kinase phosphomethylpyrimidine kinase. This | 97.06 | |
| PRK06427 | 266 | bifunctional hydroxy-methylpyrimidine kinase/ hydr | 96.99 | |
| cd01170 | 242 | THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (T | 96.93 | |
| PRK08573 | 448 | phosphomethylpyrimidine kinase; Provisional | 96.91 | |
| PRK12412 | 268 | pyridoxal kinase; Reviewed | 96.82 | |
| PRK14038 | 453 | ADP-dependent glucokinase; Provisional | 96.79 | |
| PRK03979 | 463 | ADP-specific phosphofructokinase; Provisional | 96.69 | |
| PF08543 | 246 | Phos_pyr_kin: Phosphomethylpyrimidine kinase; Inte | 96.4 | |
| PRK09355 | 263 | hydroxyethylthiazole kinase; Validated | 96.03 | |
| PRK12616 | 270 | pyridoxal kinase; Reviewed | 95.92 | |
| TIGR00196 | 272 | yjeF_cterm yjeF C-terminal region, hydroxyethylthi | 95.64 | |
| COG2240 | 281 | PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coe | 95.42 | |
| cd01171 | 254 | YXKO-related B.subtilis YXKO protein of unknown fu | 95.29 | |
| TIGR00694 | 249 | thiM hydroxyethylthiazole kinase. This model repre | 95.28 | |
| COG0351 | 263 | ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidi | 94.74 | |
| PF02110 | 246 | HK: Hydroxyethylthiazole kinase family; InterPro: | 94.71 | |
| PLN02898 | 502 | HMP-P kinase/thiamin-monophosphate pyrophosphoryla | 94.7 | |
| PRK14713 | 530 | multifunctional hydroxymethylpyrimidine phosphokin | 94.35 | |
| PTZ00347 | 504 | phosphomethylpyrimidine kinase; Provisional | 94.01 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 93.75 | |
| COG2145 | 265 | ThiM Hydroxyethylthiazole kinase, sugar kinase fam | 93.53 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 93.35 | |
| KOG4184 | 478 | consensus Predicted sugar kinase [Carbohydrate tra | 92.14 | |
| PTZ00493 | 321 | phosphomethylpyrimidine kinase; Provisional | 91.71 | |
| COG1180 | 260 | PflA Pyruvate-formate lyase-activating enzyme [Pos | 89.83 | |
| KOG2599 | 308 | consensus Pyridoxal/pyridoxine/pyridoxamine kinase | 89.3 | |
| KOG3974 | 306 | consensus Predicted sugar kinase [Carbohydrate tra | 82.48 |
| >PLN02543 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-32 Score=241.69 Aligned_cols=205 Identities=37% Similarity=0.640 Sum_probs=175.3
Q ss_pred CccEEEEcceeeeeccCCCCc--cc------------ccCCCccccCCChHHHHHHHHHHcCCceeEEEeeCCCHHHHHH
Q 025807 28 DRLVVCFGEMLIDFVPTVGGV--SL------------AEAPAFKKAPGGAPANVAVGISRLGGSSAFVGKLGDDEFGYML 93 (248)
Q Consensus 28 ~~~ilviG~~~vD~~~~~~~~--p~------------~~~~~~~~~~GG~a~N~a~ala~lG~~v~l~~~vG~D~~g~~i 93 (248)
.+.|+|+|++.+|+++..... +. .....+...+||+++|+|++|++||.++.|+|.||+|.+|+++
T Consensus 125 ~~~v~~~Ge~liDf~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~GGa~aNVAvaLARLG~~vafIG~VGdD~fG~~l 204 (496)
T PLN02543 125 PPLVCCFGAVQKEFVPTVRVHDNQMHPDMYSQWKMLQWDPPEFARAPGGPPSNVAISHVRLGGRAAFMGKVGDDDFGEEL 204 (496)
T ss_pred CCeEEEeChhhhhhcCCCcccccccccccccccccccccCCeeEeccCcHHHHHHHHHHHCCCCEEEEEEeCCCHHHHHH
Confidence 355999999999999864321 10 1456678899999999999999999999999999999999999
Q ss_pred HHHHHHCCCCccceEEcCCCCceEEEEEEe-cCCCceEEEecCCCcccccCcccchHhhhcCccEEEEcccccccchhHH
Q 025807 94 ANILKENNVDTSGVRYDSTARTALAFVTLR-ADGEREFLFFRHPSADMLLCESELDKNLIKQGSIFHYGSISLIAEPCRS 172 (248)
Q Consensus 94 ~~~L~~~gI~~~~v~~~~~~~T~~~~i~i~-~~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~~~~~ 172 (248)
++.|+++||+++++.+.++.+|+++++.++ .++.+.+.+++..+++..+.+++++...+++++++|++++.+.++...+
T Consensus 205 ~~~L~~~GVDts~v~~~~~~~Tgla~V~v~~~~~gr~~~~~~~~gA~~~L~~~di~~~~l~~a~ilh~~~~~l~~~~~~~ 284 (496)
T PLN02543 205 VLMMNKERVQTRAVKFDENAKTACSRMKIKFRDGGKMVAETVKEAAEDSLLASELNLAVLKEARMFHFNSEVLTSPSMQS 284 (496)
T ss_pred HHHHHHcCCcccceEecCCCCCceEEEEEEeCCCCCEEEEecCCCHHHhCChhhcCHhHhCCCceEEECChhhcCchHHH
Confidence 999999999999999988889999999985 2333555544446677778888887778899999999998766665678
Q ss_pred HHHHHHHHHHHCCCeEEEeCCCCCCCCCCHHHHHHHHHHhhhhCCEEEeCHHHHHHhHHH
Q 025807 173 TQLAAMNLAKESGSILSYDPNLRLPLWPSEEAAREGIMSIWDQADIIKVKFETRYSCIQK 232 (248)
Q Consensus 173 ~~~~~~~~a~~~g~~v~~D~~~~~~~w~~~~~~~~~~~~~l~~~dil~~N~~E~~~l~g~ 232 (248)
....+++.++++|++|+||++.|+.+|.+.+..++.+.++++++||+++|++|++.|+|.
T Consensus 285 a~~~al~~Ak~~G~~VsfDpN~R~~LW~~~~~~~~~i~~~l~~aDIl~~SeeEa~~Ltg~ 344 (496)
T PLN02543 285 TLFRAIELSKKFGGLIFFDLNLPLPLWRSRDETRELIKKAWNEADIIEVSRQELEFLLDE 344 (496)
T ss_pred HHHHHHHHHHHCCCEEEEeCCCCccccCCHHHHHHHHHHHHHhCCEEEecHHHHHHHhCC
Confidence 889999999999999999999999999888788888999999999999999999999874
|
|
| >PLN02323 probable fructokinase | Back alignment and domain information |
|---|
| >PLN02967 kinase | Back alignment and domain information |
|---|
| >PRK15074 inosine/guanosine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate | Back alignment and domain information |
|---|
| >cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) | Back alignment and domain information |
|---|
| >PRK09434 aminoimidazole riboside kinase; Provisional | Back alignment and domain information |
|---|
| >cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor | Back alignment and domain information |
|---|
| >PRK11142 ribokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00292 ribokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02813 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >cd01944 YegV_kinase_like YegV-like sugar kinase | Back alignment and domain information |
|---|
| >cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP | Back alignment and domain information |
|---|
| >PLN02341 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd01942 ribokinase_group_A Ribokinase-like subgroup A | Back alignment and domain information |
|---|
| >PTZ00247 adenosine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02379 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases | Back alignment and domain information |
|---|
| >cd01945 ribokinase_group_B Ribokinase-like subgroup B | Back alignment and domain information |
|---|
| >cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose | Back alignment and domain information |
|---|
| >PRK09850 pseudouridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases | Back alignment and domain information |
|---|
| >TIGR02152 D_ribokin_bact ribokinase | Back alignment and domain information |
|---|
| >cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I | Back alignment and domain information |
|---|
| >cd01941 YeiC_kinase_like YeiC-like sugar kinase | Back alignment and domain information |
|---|
| >cd01943 MAK32 MAK32 kinase | Back alignment and domain information |
|---|
| >PRK09813 fructoselysine 6-kinase; Provisional | Back alignment and domain information |
|---|
| >cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose | Back alignment and domain information |
|---|
| >TIGR03828 pfkB 1-phosphofructokinase | Back alignment and domain information |
|---|
| >cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02548 adenosine kinase | Back alignment and domain information |
|---|
| >TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family | Back alignment and domain information |
|---|
| >PRK09513 fruK 1-phosphofructokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01231 lacC tagatose-6-phosphate kinase | Back alignment and domain information |
|---|
| >PRK13508 tagatose-6-phosphate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10294 6-phosphofructokinase 2; Provisional | Back alignment and domain information |
|---|
| >cd01937 ribokinase_group_D Ribokinase-like subgroup D | Back alignment and domain information |
|---|
| >PLN02630 pfkB-type carbohydrate kinase family protein | Back alignment and domain information |
|---|
| >cd01946 ribokinase_group_C Ribokinase-like subgroup C | Back alignment and domain information |
|---|
| >KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group | Back alignment and domain information |
|---|
| >KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd01173 pyridoxal_pyridoxamine_kinase Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP | Back alignment and domain information |
|---|
| >PRK07105 pyridoxamine kinase; Validated | Back alignment and domain information |
|---|
| >cd01938 ADPGK_ADPPFK ADP-dependent glucokinase (ADPGK) and phosphofructokinase (ADPPFK) | Back alignment and domain information |
|---|
| >PRK14039 ADP-dependent glucokinase; Provisional | Back alignment and domain information |
|---|
| >PRK12413 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00687 pyridox_kin pyridoxal kinase | Back alignment and domain information |
|---|
| >PRK05756 pyridoxamine kinase; Validated | Back alignment and domain information |
|---|
| >cd01169 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 | Back alignment and domain information |
|---|
| >PLN02978 pyridoxal kinase | Back alignment and domain information |
|---|
| >PRK08176 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed | Back alignment and domain information |
|---|
| >PF04587 ADP_PFK_GK: ADP-specific Phosphofructokinase/Glucokinase conserved region; InterPro: IPR007666 Although ATP is the most common phosphoryl group donor for kinases, certain hyperthermophilic archaea, such as Thermococcus litoralis and Pyrococcus furiosus, utilise unusual ADP-dependent glucokinases (ADPGKs) and phosphofructokinases (ADPPKKs) in their glycolytic pathways [, , ] | Back alignment and domain information |
|---|
| >TIGR02045 P_fruct_ADP ADP-specific phosphofructokinase | Back alignment and domain information |
|---|
| >PTZ00344 pyridoxal kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase | Back alignment and domain information |
|---|
| >PRK06427 bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01170 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz | Back alignment and domain information |
|---|
| >PRK08573 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12412 pyridoxal kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14038 ADP-dependent glucokinase; Provisional | Back alignment and domain information |
|---|
| >PRK03979 ADP-specific phosphofructokinase; Provisional | Back alignment and domain information |
|---|
| >PF08543 Phos_pyr_kin: Phosphomethylpyrimidine kinase; InterPro: IPR013749 This enzyme 2 | Back alignment and domain information |
|---|
| >PRK09355 hydroxyethylthiazole kinase; Validated | Back alignment and domain information |
|---|
| >PRK12616 pyridoxal kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00196 yjeF_cterm yjeF C-terminal region, hydroxyethylthiazole kinase-related | Back alignment and domain information |
|---|
| >COG2240 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01171 YXKO-related B | Back alignment and domain information |
|---|
| >TIGR00694 thiM hydroxyethylthiazole kinase | Back alignment and domain information |
|---|
| >COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02110 HK: Hydroxyethylthiazole kinase family; InterPro: IPR000417 Thiamine pyrophosphate (TPP), a required cofactor for many enzymes in the cell, is synthesised de novo in Salmonella typhimurium [] | Back alignment and domain information |
|---|
| >PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00347 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4184 consensus Predicted sugar kinase [Carbohydrate transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00493 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2599 consensus Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3974 consensus Predicted sugar kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 248 | ||||
| 3ljs_A | 338 | Crystal Structure Of Fructokinase From Xylella Fast | 4e-21 | ||
| 3hj6_A | 327 | Structure Of Halothermothrix Orenii Fructokinase (F | 2e-20 | ||
| 1tz6_A | 339 | Crystal Structure Of Aminoimidazole Riboside Kinase | 7e-20 | ||
| 1tyy_A | 339 | Crystal Structure Of Aminoimidazole Riboside Kinase | 1e-19 | ||
| 3ewm_A | 313 | Crystal Structure Of An Uncharacterized Sugar Kinas | 2e-14 | ||
| 3gbu_A | 313 | Crystal Structure Of An Uncharacterized Sugar Kinas | 2e-14 | ||
| 2dcn_A | 311 | Crystal Structure Of 2-Keto-3-Deoxygluconate Kinase | 2e-13 | ||
| 2v78_A | 313 | Crystal Structure Of Sulfolobus Solfataricus 2-Keto | 6e-12 | ||
| 2qcv_A | 332 | Crystal Structure Of A Putative 5-Dehydro-2-Deoxygl | 1e-11 | ||
| 3iq0_A | 330 | Crystal Structure Of A Putative Ribokinase Ii In Co | 5e-11 | ||
| 1v19_A | 309 | 2-Keto-3-Deoxygluconate Kinase From Thermus Thermop | 3e-10 | ||
| 4e69_A | 328 | Crystal Structure Of A Sugar Kinase (Target Efi-502 | 9e-08 | ||
| 4du5_A | 336 | Crystal Structure Of Pfkb Protein From Polaromonas | 4e-07 | ||
| 3pl2_A | 319 | Crystal Structure Of A 5-Keto-2-Deoxygluconokinase | 5e-07 | ||
| 3lhx_A | 319 | Crystal Structure Of A Ketodeoxygluconokinase (Kdgk | 6e-06 | ||
| 2rbc_A | 343 | Crystal Structure Of A Putative Ribokinase From Agr | 4e-05 |
| >pdb|3LJS|A Chain A, Crystal Structure Of Fructokinase From Xylella Fastidiosa Length = 338 | Back alignment and structure |
|
| >pdb|3HJ6|A Chain A, Structure Of Halothermothrix Orenii Fructokinase (Frk) Length = 327 | Back alignment and structure |
| >pdb|1TZ6|A Chain A, Crystal Structure Of Aminoimidazole Riboside Kinase From Salmonella Enterica Complexed With Aminoimidazole Riboside And Atp Analog Length = 339 | Back alignment and structure |
| >pdb|1TYY|A Chain A, Crystal Structure Of Aminoimidazole Riboside Kinase From Salmonella Enterica Length = 339 | Back alignment and structure |
| >pdb|3EWM|A Chain A, Crystal Structure Of An Uncharacterized Sugar Kinase Ph1459 From Pyrococcus Horikoshii Length = 313 | Back alignment and structure |
| >pdb|3GBU|A Chain A, Crystal Structure Of An Uncharacterized Sugar Kinase Ph1459 From Pyrococcus Horikoshii In Complex With Atp Length = 313 | Back alignment and structure |
| >pdb|2DCN|A Chain A, Crystal Structure Of 2-Keto-3-Deoxygluconate Kinase From Sulfolobus Tokodaii Complexed With 2-Keto-6-Phosphogluconate (Alpha-Furanose Form) Length = 311 | Back alignment and structure |
| >pdb|2V78|A Chain A, Crystal Structure Of Sulfolobus Solfataricus 2-Keto-3- Deoxygluconate Kinase Length = 313 | Back alignment and structure |
| >pdb|2QCV|A Chain A, Crystal Structure Of A Putative 5-Dehydro-2-Deoxygluconokinase (Iolc) From Bacillus Halodurans C-125 At 1.90 A Resolution Length = 332 | Back alignment and structure |
| >pdb|3IQ0|A Chain A, Crystal Structure Of A Putative Ribokinase Ii In Complex With Atp And Mg+2 From E.Coli Length = 330 | Back alignment and structure |
| >pdb|1V19|A Chain A, 2-Keto-3-Deoxygluconate Kinase From Thermus Thermophilus Length = 309 | Back alignment and structure |
| >pdb|4E69|A Chain A, Crystal Structure Of A Sugar Kinase (Target Efi-502132) From Oceanicola Granulosus, Unliganded Structure Length = 328 | Back alignment and structure |
| >pdb|4DU5|A Chain A, Crystal Structure Of Pfkb Protein From Polaromonas Sp. Js666 Length = 336 | Back alignment and structure |
| >pdb|3PL2|A Chain A, Crystal Structure Of A 5-Keto-2-Deoxygluconokinase (Ncgl0155, Cgl0158) From Corynebacterium Glutamicum Atcc 13032 Kitasato At 1.89 A Resolution Length = 319 | Back alignment and structure |
| >pdb|3LHX|A Chain A, Crystal Structure Of A Ketodeoxygluconokinase (Kdgk) From Shigella Flexneri Length = 319 | Back alignment and structure |
| >pdb|2RBC|A Chain A, Crystal Structure Of A Putative Ribokinase From Agrobacterium Tumefaciens Length = 343 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} PDB: 3lki_A* Length = 338 | Back alignment and structure |
|---|
Score = 298 bits (764), Expect = e-101
Identities = 77/191 (40%), Positives = 101/191 (52%), Gaps = 1/191 (0%)
Query: 31 VVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGISRLGGSSAFVGKLGDDEFG 90
++CFGE LID + V AF + GGAPANVAV ++RLGG+ FVG LG D FG
Sbjct: 7 ILCFGEALIDMLAQ-PLVKKGMPRAFLQCAGGAPANVAVAVARLGGAVQFVGMLGSDMFG 65
Query: 91 YMLANILKENNVDTSGVRYDSTARTALAFVTLRADGEREFLFFRHPSADMLLCESELDKN 150
L + E V T G+ STA+TALAFV L A GER F F+R P+AD+L
Sbjct: 66 DFLFDSFAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDA 125
Query: 151 LIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGSILSYDPNLRLPLWPSEEAAREGIM 210
IFH S S+ M A+ +G+I+S+D N R LWP+ E +
Sbjct: 126 SFSDALIFHACSNSMTDADIAEVTFEGMRRAQAAGAIVSFDLNFRPMLWPNGENPASRLW 185
Query: 211 SIWDQADIIKV 221
AD++K+
Sbjct: 186 KGLSLADVVKL 196
|
| >3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} Length = 319 | Back alignment and structure |
|---|
| >2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Length = 332 | Back alignment and structure |
|---|
| >4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Length = 336 | Back alignment and structure |
|---|
| >3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} PDB: 3k9e_A Length = 330 | Back alignment and structure |
|---|
| >3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Length = 327 | Back alignment and structure |
|---|
| >1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Length = 339 | Back alignment and structure |
|---|
| >3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Length = 313 | Back alignment and structure |
|---|
| >2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Length = 313 | Back alignment and structure |
|---|
| >1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Length = 309 | Back alignment and structure |
|---|
| >4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Length = 328 | Back alignment and structure |
|---|
| >2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Length = 311 | Back alignment and structure |
|---|
| >3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Length = 319 | Back alignment and structure |
|---|
| >2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Length = 296 | Back alignment and structure |
|---|
| >3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Length = 325 | Back alignment and structure |
|---|
| >2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Length = 351 | Back alignment and structure |
|---|
| >3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Length = 346 | Back alignment and structure |
|---|
| >2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Length = 302 | Back alignment and structure |
|---|
| >2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Length = 312 | Back alignment and structure |
|---|
| >1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 | Back alignment and structure |
|---|
| >2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Length = 334 | Back alignment and structure |
|---|
| >3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Length = 326 | Back alignment and structure |
|---|
| >3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Length = 313 | Back alignment and structure |
|---|
| >3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Length = 306 | Back alignment and structure |
|---|
| >2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Length = 343 | Back alignment and structure |
|---|
| >1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Length = 309 | Back alignment and structure |
|---|
| >2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Length = 331 | Back alignment and structure |
|---|
| >3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Length = 328 | Back alignment and structure |
|---|
| >3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Length = 304 | Back alignment and structure |
|---|
| >4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Length = 352 | Back alignment and structure |
|---|
| >3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Length = 310 | Back alignment and structure |
|---|
| >3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Length = 299 | Back alignment and structure |
|---|
| >1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Length = 311 | Back alignment and structure |
|---|
| >2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Length = 317 | Back alignment and structure |
|---|
| >2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Length = 383 | Back alignment and structure |
|---|
| >3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Length = 365 | Back alignment and structure |
|---|
| >3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Length = 347 | Back alignment and structure |
|---|
| >1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Length = 345 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 248 | |||
| 3ljs_A | 338 | Fructokinase; fructokianse, PSI2, NYSGXRC, structu | 100.0 | |
| 3pl2_A | 319 | Sugar kinase, ribokinase family; PFKB PFAM motif, | 100.0 | |
| 4gm6_A | 351 | PFKB family carbohydrate kinase; enzyme function i | 100.0 | |
| 3hj6_A | 327 | Fructokinase, FRK; fructose, transferase, carbohyd | 100.0 | |
| 1v1a_A | 309 | 2-keto-3-deoxygluconate kinase; ATP, structural ge | 100.0 | |
| 4du5_A | 336 | PFKB; structural genomics, PSI-biology, NEW YORK s | 100.0 | |
| 2qcv_A | 332 | Putative 5-dehydro-2-deoxygluconokinase; structura | 100.0 | |
| 3iq0_A | 330 | Putative ribokinase II; transferase,kinase,SAD,rib | 100.0 | |
| 1tyy_A | 339 | Putative sugar kinase; ribokinase fold, alpha/beta | 99.98 | |
| 3ewm_A | 313 | Uncharacterized sugar kinase PH1459; carbohydrate | 99.98 | |
| 3ktn_A | 346 | Carbohydrate kinase, PFKB family; PFKB family,ribo | 99.98 | |
| 4e69_A | 328 | 2-dehydro-3-deoxygluconokinase; putative sugar kin | 99.98 | |
| 4e3a_A | 352 | Sugar kinase protein; structural genomics, protein | 99.97 | |
| 2v78_A | 313 | Fructokinase; transferase, PFKB family carbohydrat | 99.97 | |
| 3lhx_A | 319 | Ketodeoxygluconokinase; structural genomics, PSI-2 | 99.97 | |
| 3go6_A | 310 | Ribokinase RBSK; phosphofructokinase, carbohydrate | 99.97 | |
| 3vas_A | 370 | Putative adenosine kinase; ribokinase, enzyme, tra | 99.97 | |
| 2dcn_A | 311 | Hypothetical fructokinase; 2-keto-3-deoxygluconate | 99.97 | |
| 3h49_A | 325 | Ribokinase; transferase,PFKB family,sugar kinase Y | 99.97 | |
| 3ry7_A | 304 | Ribokinase; transferase; 2.15A {Staphylococcus aur | 99.97 | |
| 2c4e_A | 302 | Sugar kinase MJ0406; transferase, nucleoside kinas | 99.97 | |
| 2fv7_A | 331 | Ribokinase; structural genomics, structural genomi | 99.97 | |
| 2rbc_A | 343 | Sugar kinase, AGR_C_4560P; ribokinase family, ATP- | 99.97 | |
| 1rkd_A | 309 | Ribokinase; carbohydrate kinase, ribose, nucleotid | 99.97 | |
| 3ikh_A | 299 | Carbohydrate kinase; transferase,kinase,SAD,ribose | 99.96 | |
| 3otx_A | 347 | Adenosine kinase, putative; AP5A, transferase-tran | 99.96 | |
| 2pkf_A | 334 | Adenosine kinase; transferase, S genomics, TB stru | 99.96 | |
| 3b1n_A | 326 | Ribokinase, putative; rossmann fold, ATP binding, | 99.96 | |
| 3loo_A | 365 | Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad | 99.96 | |
| 2qhp_A | 296 | Fructokinase; NP_810670.1, PFKB family carbohydrat | 99.96 | |
| 3kzh_A | 328 | Probable sugar kinase; NYSGXRC, PSI-II, protein st | 99.96 | |
| 3uq6_A | 372 | Adenosine kinase, putative; ribokinase, transferas | 99.96 | |
| 2nwh_A | 317 | AGR_C_3442P, carbohydrate kinase; structural genom | 99.95 | |
| 2hlz_A | 312 | Ketohexokinase; non-protein kinase, creatine kinas | 99.95 | |
| 1vm7_A | 311 | Ribokinase; TM0960, structural genomics, JCSG, pro | 99.95 | |
| 2abs_A | 383 | Adenosine kinase, AK; ribokinase fold, alpha/beta, | 99.95 | |
| 1bx4_A | 345 | Protein (adenosine kinase); human adenosine kinase | 99.95 | |
| 2afb_A | 351 | 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- | 99.95 | |
| 3bf5_A | 306 | Ribokinase related protein; 10640157, putative rib | 99.95 | |
| 3ie7_A | 320 | LIN2199 protein; phosphofructokinases, transferase | 99.93 | |
| 4e84_A | 352 | D-beta-D-heptose 7-phosphate kinase; LPS-heptose b | 99.93 | |
| 2jg1_A | 330 | Tagatose-6-phosphate kinase; phosphoryl transfer, | 99.93 | |
| 2f02_A | 323 | Tagatose-6-phosphate kinase; LACC, structural geno | 99.93 | |
| 2ajr_A | 331 | Sugar kinase, PFKB family; TM0828, possible 1-phos | 99.92 | |
| 3umo_A | 309 | 6-phosphofructokinase isozyme 2; glycolysis, trans | 99.92 | |
| 3cqd_A | 309 | 6-phosphofructokinase isozyme 2; phosphofructokina | 99.92 | |
| 2abq_A | 306 | Fructose 1-phosphate kinase; dimer, structural gen | 99.91 | |
| 3kd6_A | 313 | Carbohydrate kinase, PFKB family; nucleoside kinas | 99.9 | |
| 2jg5_A | 306 | Fructose 1-phosphate kinase; 1-phosphofructokinase | 99.9 | |
| 1vk4_A | 298 | PFKB carbohydrate kinase TM0415; structural genomi | 99.84 | |
| 2yxt_A | 312 | Pyridoxal kinase; beta sheet with alpha helix, met | 98.96 | |
| 2ddm_A | 283 | Pyridoxine kinase; pyridoxal kinase, ribokinase, p | 98.82 | |
| 1jxh_A | 288 | Phosphomethylpyrimidine kinase; THID, ribokinase f | 98.2 | |
| 3drw_A | 474 | ADP-specific phosphofructokinase; AMP, GLYC kinase | 98.11 | |
| 1ub0_A | 258 | THID, phosphomethylpyrimidine kinase; thiamin bios | 97.97 | |
| 3mbh_A | 291 | Putative phosphomethylpyrimidine kinase; structura | 97.8 | |
| 1ua4_A | 455 | Glucokinase, ADP-dependent glucokinase; transferas | 97.78 | |
| 2i5b_A | 271 | Phosphomethylpyrimidine kinase; ADP complex, PDXK, | 97.69 | |
| 1gc5_A | 467 | ADP-dependent glucokinase; ALFA/beta sandwichs, in | 97.6 | |
| 1l2l_A | 457 | ADP-dependent glucokinase; ADP glucokinase APO, tr | 97.55 | |
| 3pzs_A | 289 | PM kinase, pyridoxamine kinase; structural genomic | 97.53 | |
| 3zs7_A | 300 | Pyridoxal kinase; transferase, sleeping sickness; | 97.5 | |
| 3h74_A | 282 | Pyridoxal kinase; PSI-II, structural genomics, pro | 97.47 | |
| 1ekq_A | 272 | Hydroxyethylthiazole kinase; alpha-beta, transfera | 97.08 | |
| 3rm5_A | 550 | Hydroxymethylpyrimidine/phosphomethylpyrimidine K | 96.56 | |
| 1v8a_A | 265 | Hydroxyethylthiazole kinase; alpha-beta, ATP bindi | 96.23 | |
| 3dzv_A | 273 | 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_ | 95.08 | |
| 3hpd_A | 265 | Hydroxyethylthiazole kinase; alpha-beta, ATP bindi | 94.08 | |
| 3nl6_A | 540 | Thiamine biosynthetic bifunctional enzyme; thiamin | 92.72 | |
| 2r3b_A | 310 | YJEF-related protein; putative kinase in the ribok | 90.14 | |
| 3bgk_A | 311 | SMU.573, putative uncharacterized protein; alpha/b | 87.46 |
| >3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-34 Score=246.63 Aligned_cols=205 Identities=38% Similarity=0.573 Sum_probs=184.0
Q ss_pred CCccEEEEcceeeeeccCCCCcccccCCCccccCCChHHHHHHHHHHcCCceeEEEeeCCCHHHHHHHHHHHHCCCCccc
Q 025807 27 YDRLVVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGISRLGGSSAFVGKLGDDEFGYMLANILKENNVDTSG 106 (248)
Q Consensus 27 ~~~~ilviG~~~vD~~~~~~~~p~~~~~~~~~~~GG~a~N~a~ala~lG~~v~l~~~vG~D~~g~~i~~~L~~~gI~~~~ 106 (248)
++++|+|+|++++|++...++.|.. +..+...+||+++|+|.+|++||.++.++|.||+|.+|+.+++.|+++||++++
T Consensus 3 ~~~~v~viG~~~iD~~~~~~~~~~~-~~~~~~~~GG~~~NvA~~la~LG~~~~~ig~vG~D~~g~~l~~~l~~~gV~~~~ 81 (338)
T 3ljs_A 3 LKKTILCFGEALIDMLAQPLVKKGM-PRAFLQCAGGAPANVAVAVARLGGAVQFVGMLGSDMFGDFLFDSFAEAGVVTDG 81 (338)
T ss_dssp -CCEEEEESCCEEEEEECCCSSTTS-CCCEEEEEECHHHHHHHHHHHHTCCEEEESEEESSHHHHHHHHHHHHHTCBCTT
T ss_pred CCCCEEEEChhhhheeccCCCCccc-hhceeecCCChHHHHHHHHHhCCCCEEEEeeccCCHHHHHHHHHHHHcCCCcee
Confidence 3678999999999999988876654 667789999999999999999999999999999999999999999999999999
Q ss_pred eEEcCCCCceEEEEEEecCCCceEEEecCCCcccccCcccchHhhhcCccEEEEcccccccchhHHHHHHHHHHHHHCCC
Q 025807 107 VRYDSTARTALAFVTLRADGEREFLFFRHPSADMLLCESELDKNLIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGS 186 (248)
Q Consensus 107 v~~~~~~~T~~~~i~i~~~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~g~~~~~~~~~~~~~~~~~~a~~~g~ 186 (248)
+.+.++.+|+++++.++++|+|++.+++.++++..++++++..+.+++++++|++++.+..+.+.+.+.++++.++++|+
T Consensus 82 v~~~~~~~T~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~a~~~g~ 161 (338)
T 3ljs_A 82 IVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSMTDADIAEVTFEGMRRAQAAGA 161 (338)
T ss_dssp CEEESSSCCCEEEEECCSTTCCEEEEECSSCGGGGCCGGGCCHHHHHTEEEEEEEGGGGSSHHHHHHHHHHHHHHHHTTC
T ss_pred EEEcCCCCceEEEEEECCCCCeEEEEeCCCChhHhCCHhhcCHhHhcCCCEEEECChHhcCchHHHHHHHHHHHHHHcCC
Confidence 98877889999999999889999887766677777888888777788999999999877777788999999999999999
Q ss_pred eEEEeCCCCCCCCCCHHHHHHHHHHhhhhCCEEEeCHHHHHHhHHH
Q 025807 187 ILSYDPNLRLPLWPSEEAAREGIMSIWDQADIIKVKFETRYSCIQK 232 (248)
Q Consensus 187 ~v~~D~~~~~~~w~~~~~~~~~~~~~l~~~dil~~N~~E~~~l~g~ 232 (248)
++++||+.+..+|.+.+..++.+.++++++|++++|++|++.|+|.
T Consensus 162 ~v~~Dp~~~~~~~~~~~~~~~~~~~ll~~~dil~~N~~E~~~l~g~ 207 (338)
T 3ljs_A 162 IVSFDLNFRPMLWPNGENPASRLWKGLSLADVVKLSSEELDYLANT 207 (338)
T ss_dssp EEEEECCCCGGGSCTTCCTHHHHHHHHHTCSEEEEEHHHHHHHHHH
T ss_pred EEEEECCCChhhcCCHHHHHHHHHHHHhhCCEEEecHHHHHHHhCC
Confidence 9999999988888655555778889999999999999999999985
|
| >3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 | Back alignment and structure |
|---|
| >4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} | Back alignment and structure |
|---|
| >3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A | Back alignment and structure |
|---|
| >4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A | Back alignment and structure |
|---|
| >1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* | Back alignment and structure |
|---|
| >3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* | Back alignment and structure |
|---|
| >3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* | Back alignment and structure |
|---|
| >4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* | Back alignment and structure |
|---|
| >2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* | Back alignment and structure |
|---|
| >3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} | Back alignment and structure |
|---|
| >3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* | Back alignment and structure |
|---|
| >3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* | Back alignment and structure |
|---|
| >2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* | Back alignment and structure |
|---|
| >3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* | Back alignment and structure |
|---|
| >3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A | Back alignment and structure |
|---|
| >2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* | Back alignment and structure |
|---|
| >3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* | Back alignment and structure |
|---|
| >3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* | Back alignment and structure |
|---|
| >2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* | Back alignment and structure |
|---|
| >3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* | Back alignment and structure |
|---|
| >3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} | Back alignment and structure |
|---|
| >3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* | Back alignment and structure |
|---|
| >2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A | Back alignment and structure |
|---|
| >1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* | Back alignment and structure |
|---|
| >1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* | Back alignment and structure |
|---|
| >2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A | Back alignment and structure |
|---|
| >4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* | Back alignment and structure |
|---|
| >2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* | Back alignment and structure |
|---|
| >2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* | Back alignment and structure |
|---|
| >2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* | Back alignment and structure |
|---|
| >3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* | Back alignment and structure |
|---|
| >2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 | Back alignment and structure |
|---|
| >2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* | Back alignment and structure |
|---|
| >2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* | Back alignment and structure |
|---|
| >1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* | Back alignment and structure |
|---|
| >3drw_A ADP-specific phosphofructokinase; AMP, GLYC kinase, magnesium, metal-binding, transferase, structural G PSI-2, protein structure initiative; HET: AMP; 1.90A {Pyrococcus horikoshii} PDB: 1u2x_A | Back alignment and structure |
|---|
| >1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 | Back alignment and structure |
|---|
| >3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* | Back alignment and structure |
|---|
| >1ua4_A Glucokinase, ADP-dependent glucokinase; transferase; HET: GLC BGC AMP; 1.90A {Pyrococcus furiosus} SCOP: c.72.1.3 | Back alignment and structure |
|---|
| >2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1gc5_A ADP-dependent glucokinase; ALFA/beta sandwichs, induced-fitting, transferase; HET: ADP; 2.30A {Thermococcus litoralis} SCOP: c.72.1.3 | Back alignment and structure |
|---|
| >1l2l_A ADP-dependent glucokinase; ADP glucokinase APO, transferase; 2.00A {Pyrococcus horikoshii} SCOP: c.72.1.3 | Back alignment and structure |
|---|
| >3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A* | Back alignment and structure |
|---|
| >3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* | Back alignment and structure |
|---|
| >1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* | Back alignment and structure |
|---|
| >3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} PDB: 3hpd_A | Back alignment and structure |
|---|
| >3dzv_A 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_816404.1, structural genomics, joint center for structural genomics, JCSG; HET: ADP; 2.57A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3hpd_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, ATP-binding, M metal-binding, nucleotide-binding, thiamine biosynthesis; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* | Back alignment and structure |
|---|
| >2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A | Back alignment and structure |
|---|
| >3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 248 | ||||
| d1tyya_ | 304 | c.72.1.1 (A:) Aminoimidazole riboside kinase {Salm | 1e-27 | |
| d2afba1 | 333 | c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase | 4e-25 | |
| d1v19a_ | 302 | c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Ther | 5e-23 | |
| d1vk4a_ | 288 | c.72.1.1 (A:) Hypothetical protein TM0415 {Thermot | 2e-21 | |
| d2dcna1 | 308 | c.72.1.1 (A:2-309) Hypothetical fructokinase ST247 | 3e-19 | |
| d2fv7a1 | 308 | c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapien | 8e-15 | |
| d2ajra1 | 319 | c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {T | 6e-14 | |
| d2abqa1 | 306 | c.72.1.1 (A:1-306) Fructose 1-phosphate kinase Fru | 1e-13 | |
| d2f02a1 | 313 | c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase Lac | 3e-13 | |
| d1rkda_ | 306 | c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: | 1e-12 | |
| d1vm7a_ | 299 | c.72.1.1 (A:) Ribokinase {Thermotoga maritima [Tax | 5e-12 | |
| d2absa1 | 350 | c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma g | 6e-07 | |
| d1bx4a_ | 342 | c.72.1.1 (A:) Adenosine kinase {Human (Homo sapien | 4e-05 |
| >d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Length = 304 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribokinase-like superfamily: Ribokinase-like family: Ribokinase-like domain: Aminoimidazole riboside kinase species: Salmonella typhimurium [TaxId: 90371]
Score = 105 bits (261), Expect = 1e-27
Identities = 69/210 (32%), Positives = 97/210 (46%), Gaps = 9/210 (4%)
Query: 31 VVCFGEMLIDFVPTVGGVSLAEAPAFKKAPGGAPANVAVGISRLGGSSAFVGKLGDDEFG 90
V G+ +D VP ++ K PGGA ANV V ++RLGG F+G LGDD+ G
Sbjct: 3 VWVIGDASVDLVPEKQN-------SYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAG 55
Query: 91 YMLANILKENNVDTSGVRYDSTARTALAFVTLRADGEREFLFFRHPSADMLLCESELDKN 150
L + ++N VD + +R D+ +A+ V L ADGER F + HP AD S D
Sbjct: 56 RFLRQVFQDNGVDVTFLRLDADLTSAVLIVNLTADGERSFTYLVHPGADT--YVSPQDLP 113
Query: 151 LIKQGSIFHYGSISLIAEPCRSTQLAAMNLAKESGSILSYDPNLRLPLWPSEEAAREGIM 210
+Q F++ SI L P R L +E+G + +D NLR +W + + E I
Sbjct: 114 PFRQYEWFYFSSIGLTDRPAREACLEGARRMREAGGYVLFDVNLRSKMWGNTDEIPELIA 173
Query: 211 SIWDQADIIKVKFETRYSCIQKMLLHWYRY 240
A I KV + RY
Sbjct: 174 RSAALASICKVSADELCQLSGASHWQDARY 203
|
| >d2afba1 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]} Length = 333 | Back information, alignment and structure |
|---|
| >d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Length = 288 | Back information, alignment and structure |
|---|
| >d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Length = 308 | Back information, alignment and structure |
|---|
| >d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Length = 319 | Back information, alignment and structure |
|---|
| >d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Length = 306 | Back information, alignment and structure |
|---|
| >d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Length = 313 | Back information, alignment and structure |
|---|
| >d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
| >d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Length = 299 | Back information, alignment and structure |
|---|
| >d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Length = 350 | Back information, alignment and structure |
|---|
| >d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 248 | |||
| d2afba1 | 333 | 2-keto-3-deoxygluconate kinase {Thermotoga maritim | 99.95 | |
| d1v19a_ | 302 | 2-keto-3-deoxygluconate kinase {Thermus thermophil | 99.93 | |
| d2absa1 | 350 | Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} | 99.92 | |
| d1bx4a_ | 342 | Adenosine kinase {Human (Homo sapiens) [TaxId: 960 | 99.9 | |
| d1vm7a_ | 299 | Ribokinase {Thermotoga maritima [TaxId: 2336]} | 99.9 | |
| d1tyya_ | 304 | Aminoimidazole riboside kinase {Salmonella typhimu | 99.9 | |
| d2fv7a1 | 308 | Ribokinase {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2dcna1 | 308 | Hypothetical fructokinase ST2478 {Sulfolobus tokod | 99.86 | |
| d1rkda_ | 306 | Ribokinase {Escherichia coli [TaxId: 562]} | 99.85 | |
| d2ajra1 | 319 | Putative sugar kinase TM0828 {Thermotoga maritima | 99.84 | |
| d2f02a1 | 313 | Tagatose-6-phosphate kinase LacC {Enterococcus fae | 99.82 | |
| d2abqa1 | 306 | Fructose 1-phosphate kinase FruB {Bacillus halodur | 99.81 | |
| d1vk4a_ | 288 | Hypothetical protein TM0415 {Thermotoga maritima [ | 99.7 | |
| d1u2xa_ | 450 | ADP-specific phosphofructokinase {Pyrococcus horik | 97.78 | |
| d1l2la_ | 451 | ADP-dependent glucokinase {Archaeon Thermococcus l | 97.09 | |
| d1ua4a_ | 454 | ADP-dependent glucokinase {Archaeon Pyrococcus fur | 97.07 | |
| d1gc5a_ | 467 | ADP-dependent glucokinase {Archaeon Thermococcus l | 97.04 | |
| d1vi9a_ | 288 | Pyridoxamine kinase {Escherichia coli [TaxId: 562] | 96.0 | |
| d1lhpa_ | 309 | Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940] | 95.69 | |
| d1ekqa_ | 269 | Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ba | 95.39 | |
| d1v8aa_ | 264 | Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ar | 95.29 | |
| d1jxha_ | 266 | 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha | 93.61 | |
| d1ub0a_ | 258 | 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha | 93.54 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 86.94 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 81.84 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.04 |
| >d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gc5a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|