Citrus Sinensis ID: 025877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQADEAVS
ccccccccccccccEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHcHHHHcccccccccccccccHHHHcccccccccccccccccccccccEEEEEEEcHHHHHccEEEEEEEcccccccccccccccccccccccccccccEEEEEEEccccEEEEcccccccccccEEEEcccccccccccEEEEEEEEEEEEEEccccccccEEEEccccccccc
cccccccHcccccHHHEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHcHHccccccccccccccccHHHHHHHcccccccccccccccccccccEEEEEEEEHHHHHcccEEEEEEEcEEEccccccccccccccccccccccccEEEEEEccccccEEEEEccccccccccEEEcccccccccccccEEEEEEEEEEEEccccccccEEEEEcccccccc
mfgrtprrsnntkyYEILGVSKSATEDELKKAYRKAAMknhpdkggdpekFKELGQAYevlsdpekrdiyDQYGEDAlkegmggagaahnpfdifesffgggtfgaggssrgrrrkqgeDVVHTLKVSLEDLyngttkklslsrnilcpkckgkgsksgalgkcygcqgtgmkitTRQIGLGMIQQMQHVcpecrgageviserdkcpqckankvtqEKKVLEVHVEKGMQHgqkiafegqadeavs
mfgrtprrsnntkyyeilgvsksateDELKKAYRKAAmknhpdkggdpekFKELGQAYevlsdpekrDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAggssrgrrrkqgedVVHTLKVSledlyngttkklslsrnilcpkckgkgsksgalgkcygCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEViserdkcpqckankvtqekKVLEVHVEKGmqhgqkiafegqadeavs
MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFEsffgggtfgaggssrgrrrKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPkckgkgsksgalgkcYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQADEAVS
**************YEIL***************************************************Y**Y*********GGAGAAHNPFDIFESFFGGGTFG***************VVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKC**C*************************************
*************YYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGED***************FDIFESFF*************************LKVSLEDLYNGTTKKLSLSRNILCPKCKG*****G***KCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIA***Q******
********SNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGA*************DVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQADEAVS
*********NNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGG*******KQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQ******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQADEAVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
P42825 419 Chaperone protein dnaJ 2 yes no 0.991 0.584 0.739 1e-94
P43644 417 DnaJ protein homolog ANJ1 N/A no 0.991 0.587 0.746 3e-93
Q04960 413 DnaJ protein homolog OS=C N/A no 0.983 0.588 0.755 4e-92
P42824 418 DnaJ protein homolog 2 OS N/A no 0.991 0.586 0.771 1e-91
Q94AW8 420 Chaperone protein dnaJ 3 no no 0.987 0.580 0.752 1e-89
Q03363 397 DnaJ protein homolog 1 (F N/A no 0.906 0.564 0.754 7e-82
Q9JMC3 397 DnaJ homolog subfamily A yes no 0.914 0.569 0.568 1e-68
Q8WW22 397 DnaJ homolog subfamily A yes no 0.914 0.569 0.564 7e-68
Q2HJ94 412 DnaJ homolog subfamily A no no 0.939 0.563 0.558 8e-67
Q95JF4 397 DnaJ homolog subfamily A N/A no 0.910 0.566 0.547 1e-66
>sp|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2 Back     alignment and function desciption
 Score =  346 bits (887), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 182/246 (73%), Positives = 206/246 (83%), Gaps = 1/246 (0%)

Query: 1   MFGRTP-RRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYE 59
           MFGR P R+S+NTK+YEILGV K+A  ++LKKAY+KAA+KNHPDKGGDPEKFKEL QAYE
Sbjct: 1   MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE 60

Query: 60  VLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGE 119
           VLSDPEKR+IYDQYGEDALKEGMGG G  H+PFDIF SFFG G    G  SRGRR+++GE
Sbjct: 61  VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE 120

Query: 120 DVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQI 179
           DVVH LKVSLED+Y GTTKKLSLSR  LC KC GKGSKSGA  KC GCQG+GMKI+ RQ 
Sbjct: 121 DVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQF 180

Query: 180 GLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFE 239
           G GM+QQ+QH C +C+G GE I++RD+CPQCK  KV  EKKVLEV+VEKGMQH QKI F 
Sbjct: 181 GPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKVLEVNVEKGMQHNQKITFS 240

Query: 240 GQADEA 245
           GQADEA
Sbjct: 241 GQADEA 246
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|P43644|DNJH_ATRNU DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1 Back     alignment and function description
>sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 Back     alignment and function description
>sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 Back     alignment and function description
>sp|Q94AW8|DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2 Back     alignment and function description
>sp|Q03363|DNJH1_ALLPO DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 Back     alignment and function description
>sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 Back     alignment and function description
>sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
357512883 423 DnaJ protein-like protein [Medicago trun 0.987 0.576 0.838 1e-111
356520802 420 PREDICTED: chaperone protein dnaJ 2-like 0.991 0.583 0.853 1e-111
2370312 423 DnaJ-like protein [Medicago sativa] gi|3 0.983 0.574 0.838 1e-110
255647771 420 unknown [Glycine max] 0.991 0.583 0.853 1e-110
388521409 423 unknown [Medicago truncatula] 0.987 0.576 0.834 1e-110
356504601 420 PREDICTED: chaperone protein dnaJ 2-like 0.991 0.583 0.853 1e-110
217072316 423 unknown [Medicago truncatula] 0.987 0.576 0.834 1e-110
219363395 422 putative dnaJ chaperone family protein [ 0.991 0.580 0.782 1e-106
242073922 418 hypothetical protein SORBIDRAFT_06g02452 0.987 0.583 0.775 1e-105
224284516 421 unknown [Picea sitchensis] 0.991 0.581 0.774 1e-105
>gi|357512883|ref|XP_003626730.1| DnaJ protein-like protein [Medicago truncatula] gi|355520752|gb|AET01206.1| DnaJ protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/248 (83%), Positives = 228/248 (91%), Gaps = 4/248 (1%)

Query: 1   MFGRTP-RRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYE 59
           MFGR P R+S+NTKYY+ILGVSKSA+EDE+KKAYRKAAMKNHPDKGGDPEKFKELGQAYE
Sbjct: 1   MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE 60

Query: 60  VLSDPEKRDIYDQYGEDALKEGMGG-AGAA-HNPFDIFESFFGGGTFGAGGSSRGRRRKQ 117
           VLSDPEK+++YDQYGEDALKEGMGG AG++ HNPFDIFESFFG G  G GG SR RR+KQ
Sbjct: 61  VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDIFESFFGAGF-GGGGPSRARRQKQ 119

Query: 118 GEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTR 177
           GEDVVH++KVSLED+YNGTTKKLSLSRN LC KCKGKGSKSG  G+C+GCQGTGMKIT R
Sbjct: 120 GEDVVHSIKVSLEDVYNGTTKKLSLSRNALCSKCKGKGSKSGTAGRCFGCQGTGMKITRR 179

Query: 178 QIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIA 237
           QIGLGMIQQMQHVCP+C+G GEVISERD+CPQCK NK+TQEKKVLEVHVEKGMQ G KI 
Sbjct: 180 QIGLGMIQQMQHVCPDCKGTGEVISERDRCPQCKGNKITQEKKVLEVHVEKGMQQGHKIV 239

Query: 238 FEGQADEA 245
           FEGQADEA
Sbjct: 240 FEGQADEA 247

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356520802|ref|XP_003529049.1| PREDICTED: chaperone protein dnaJ 2-like [Glycine max] Back     alignment and taxonomy information
>gi|2370312|emb|CAA04447.1| DnaJ-like protein [Medicago sativa] gi|3202020|gb|AAC19391.1| DnaJ-like protein MsJ1 [Medicago sativa] Back     alignment and taxonomy information
>gi|255647771|gb|ACU24346.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388521409|gb|AFK48766.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356504601|ref|XP_003521084.1| PREDICTED: chaperone protein dnaJ 2-like [Glycine max] Back     alignment and taxonomy information
>gi|217072316|gb|ACJ84518.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|219363395|ref|NP_001136581.1| putative dnaJ chaperone family protein [Zea mays] gi|194696264|gb|ACF82216.1| unknown [Zea mays] gi|413938083|gb|AFW72634.1| putative dnaJ chaperone family protein [Zea mays] Back     alignment and taxonomy information
>gi|242073922|ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor] gi|241938080|gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|224284516|gb|ACN39991.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
TAIR|locus:2081378 420 J3 [Arabidopsis thaliana (taxi 0.987 0.580 0.658 5.6e-84
TAIR|locus:505006628 419 J2 "DNAJ homologue 2" [Arabido 0.991 0.584 0.646 3.1e-83
ZFIN|ZDB-GENE-040426-2884 412 dnaja2 "DnaJ (Hsp40) homolog, 0.951 0.570 0.512 5e-60
ZFIN|ZDB-GENE-030131-2884 413 dnaja2l "DnaJ (Hsp40) homolog, 0.951 0.569 0.502 1.7e-59
UNIPROTKB|Q2HJ94 412 DNAJA2 "DnaJ homolog subfamily 0.943 0.565 0.497 1.2e-58
UNIPROTKB|O60884 412 DNAJA2 "DnaJ homolog subfamily 0.943 0.565 0.497 1.5e-58
UNIPROTKB|F1RP05 412 LOC100521133 "Uncharacterized 0.943 0.565 0.497 1.5e-58
MGI|MGI:1931882 412 Dnaja2 "DnaJ (Hsp40) homolog, 0.943 0.565 0.497 1.5e-58
RGD|71001 412 Dnaja2 "DnaJ (Hsp40) homolog, 0.943 0.565 0.497 1.5e-58
UNIPROTKB|Q5M9H7 412 Dnaja2 "DnaJ homolog subfamily 0.943 0.565 0.497 1.5e-58
TAIR|locus:2081378 J3 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 841 (301.1 bits), Expect = 5.6e-84, P = 5.6e-84
 Identities = 162/246 (65%), Positives = 186/246 (75%)

Query:     1 MFGRTP-RRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYE 59
             MFGR P ++S+NTK+YEILGV KSA+ ++LKKAY+KAA+KNHPDKGGDPEKFKEL QAYE
Sbjct:     1 MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE 60

Query:    60 VLSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFEXXXXXXXXXXXXXXXXXXXKQGE 119
             VLSDPEKR+IYDQYGEDALKEGMGG G  H+PFDIF                    ++GE
Sbjct:    61 VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQ-RRGE 119

Query:   120 DVVHTLKVSLEDLYNGTTKKLSLSRNILCPXXXXXXXXXXXXXXXYGCQGTGMKITTRQI 179
             DVVH LKVSLED+Y GT KKLSLSRN LC                 GCQG+GMK++ RQ+
Sbjct:   120 DVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQL 179

Query:   180 GLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFE 239
             G GMIQQMQH C EC+G GE I++RD+CPQCK +KV  EKKVLEV+VEKGMQH QKI FE
Sbjct:   180 GPGMIQQMQHACNECKGTGETINDRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFE 239

Query:   240 GQADEA 245
             GQADEA
Sbjct:   240 GQADEA 245
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005730 "nucleolus" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IMP
GO:0043462 "regulation of ATPase activity" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009911 "positive regulation of flower development" evidence=IMP
GO:0048573 "photoperiodism, flowering" evidence=IMP
GO:0009506 "plasmodesma" evidence=IDA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:505006628 J2 "DNAJ homologue 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2884 dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2884 dnaja2l "DnaJ (Hsp40) homolog, subfamily A, member 2, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ94 DNAJA2 "DnaJ homolog subfamily A member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60884 DNAJA2 "DnaJ homolog subfamily A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP05 LOC100521133 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1931882 Dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71001 Dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M9H7 Dnaja2 "DnaJ homolog subfamily A member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42825DNAJ2_ARATHNo assigned EC number0.73980.99190.5847yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-86
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-82
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-80
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 4e-69
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-56
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-55
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-54
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-53
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-52
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-52
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 6e-51
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 7e-51
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-50
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-46
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-46
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 6e-45
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-44
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-44
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-43
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-43
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-42
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 1e-41
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-40
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-39
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-39
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-38
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-38
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 4e-36
pfam0022663 pfam00226, DnaJ, DnaJ domain 9e-30
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 8e-29
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-28
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-24
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 4e-22
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 8e-21
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 6e-20
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 7e-20
cd1071965 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H 3e-16
pfam0068465 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain 6e-15
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-11
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 1e-09
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 1e-08
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 2e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 4e-07
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 6e-07
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 3e-05
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 5e-05
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 5e-05
COG1107 715 COG1107, COG1107, Archaea-specific RecJ-like exonu 1e-04
COG1107 715 COG1107, COG1107, Archaea-specific RecJ-like exonu 4e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 5e-04
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information 
 Score =  262 bits (671), Expect = 2e-86
 Identities = 113/242 (46%), Positives = 157/242 (64%), Gaps = 12/242 (4%)

Query: 3   GRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEVLS 62
           GR  R  +N K YE+L +SK  T  E+KKAYRK A+K+HPDKGGDPEKFKE+ +AYEVLS
Sbjct: 19  GRRKREVDNEKLYEVLNLSKDCTTSEIKKAYRKLAIKHHPDKGGDPEKFKEISRAYEVLS 78

Query: 63  DPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGEDVV 122
           DPEKR IYD+YGE+ L+ G   A    +  D+F+  FGGG        +   +K+GED+V
Sbjct: 79  DPEKRKIYDEYGEEGLEGGEQPA----DASDLFDLIFGGG-------RKPGGKKRGEDIV 127

Query: 123 HTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGCQGTGMKITTRQIGLG 182
             LKV+LE +YNG  +KL+++++++C  C+G G    A   C  C G G+++  RQ+G  
Sbjct: 128 SHLKVTLEQIYNGAMRKLAINKDVICANCEGHGGPKDAFVDCKLCNGQGIRVQIRQMG-S 186

Query: 183 MIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFEGQA 242
           MI Q Q  C  C G G++I E  KC  C    V + +K+LEV+++KG+ +  KI F G+A
Sbjct: 187 MIHQTQSTCNSCNGQGKIIPESKKCKNCSGKGVKKTRKILEVNIDKGVPNQHKITFHGEA 246

Query: 243 DE 244
           DE
Sbjct: 247 DE 248

Length = 421
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PTZ00037 421 DnaJ_C chaperone protein; Provisional 100.0
PRK14296 372 chaperone protein DnaJ; Provisional 100.0
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14288 369 chaperone protein DnaJ; Provisional 100.0
PRK14298 377 chaperone protein DnaJ; Provisional 100.0
PRK14276 380 chaperone protein DnaJ; Provisional 100.0
PRK14286 372 chaperone protein DnaJ; Provisional 100.0
PRK14287 371 chaperone protein DnaJ; Provisional 100.0
PRK14282 369 chaperone protein DnaJ; Provisional 100.0
PRK14280 376 chaperone protein DnaJ; Provisional 100.0
PRK14278 378 chaperone protein DnaJ; Provisional 100.0
PRK14277 386 chaperone protein DnaJ; Provisional 100.0
PRK14285 365 chaperone protein DnaJ; Provisional 100.0
PRK14297 380 chaperone protein DnaJ; Provisional 100.0
PRK14279 392 chaperone protein DnaJ; Provisional 100.0
PRK14284 391 chaperone protein DnaJ; Provisional 100.0
PRK14281 397 chaperone protein DnaJ; Provisional 100.0
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14294 366 chaperone protein DnaJ; Provisional 100.0
PRK14301 373 chaperone protein DnaJ; Provisional 100.0
PRK14290 365 chaperone protein DnaJ; Provisional 100.0
PRK10767 371 chaperone protein DnaJ; Provisional 100.0
PRK14300 372 chaperone protein DnaJ; Provisional 100.0
PRK14291 382 chaperone protein DnaJ; Provisional 100.0
PRK14295 389 chaperone protein DnaJ; Provisional 100.0
PRK14283 378 chaperone protein DnaJ; Provisional 100.0
PRK14292 371 chaperone protein DnaJ; Provisional 100.0
PRK14289 386 chaperone protein DnaJ; Provisional 100.0
PRK14293 374 chaperone protein DnaJ; Provisional 100.0
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14299 291 chaperone protein DnaJ; Provisional 100.0
PRK10266 306 curved DNA-binding protein CbpA; Provisional 100.0
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.81
PHA03102153 Small T antigen; Reviewed 99.81
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.75
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.73
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.7
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.69
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.68
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.66
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 99.6
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PTZ00100116 DnaJ chaperone protein; Provisional 99.59
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.54
PRK05014171 hscB co-chaperone HscB; Provisional 99.53
PRK01356166 hscB co-chaperone HscB; Provisional 99.53
PRK03578176 hscB co-chaperone HscB; Provisional 99.49
PHA02624 647 large T antigen; Provisional 99.49
PRK00294173 hscB co-chaperone HscB; Provisional 99.48
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
PRK14288 369 chaperone protein DnaJ; Provisional 99.43
PRK14279 392 chaperone protein DnaJ; Provisional 99.43
PRK10767 371 chaperone protein DnaJ; Provisional 99.42
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.34
PRK14300 372 chaperone protein DnaJ; Provisional 99.32
PRK14286 372 chaperone protein DnaJ; Provisional 99.25
PRK14277 386 chaperone protein DnaJ; Provisional 99.25
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.23
PRK14289 386 chaperone protein DnaJ; Provisional 99.17
PRK14291 382 chaperone protein DnaJ; Provisional 99.14
PRK01773173 hscB co-chaperone HscB; Provisional 99.14
PRK14285 365 chaperone protein DnaJ; Provisional 99.13
PRK14284 391 chaperone protein DnaJ; Provisional 99.09
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.08
PRK14282 369 chaperone protein DnaJ; Provisional 99.08
PRK14278 378 chaperone protein DnaJ; Provisional 99.07
PRK14281 397 chaperone protein DnaJ; Provisional 99.07
PRK14301 373 chaperone protein DnaJ; Provisional 99.06
PLN03165111 chaperone protein dnaJ-related; Provisional 99.06
PRK14295 389 chaperone protein DnaJ; Provisional 99.05
PRK14297 380 chaperone protein DnaJ; Provisional 99.04
PRK14290 365 chaperone protein DnaJ; Provisional 99.03
PRK14298 377 chaperone protein DnaJ; Provisional 99.03
PRK14276 380 chaperone protein DnaJ; Provisional 99.03
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.03
PRK14296 372 chaperone protein DnaJ; Provisional 99.02
PRK14294 366 chaperone protein DnaJ; Provisional 99.02
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.98
PRK14280 376 chaperone protein DnaJ; Provisional 98.97
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 98.96
PRK14287 371 chaperone protein DnaJ; Provisional 98.95
PTZ00037 421 DnaJ_C chaperone protein; Provisional 98.93
PRK14292 371 chaperone protein DnaJ; Provisional 98.89
PRK14293 374 chaperone protein DnaJ; Provisional 98.85
PRK14283 378 chaperone protein DnaJ; Provisional 98.83
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 98.7
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.69
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.68
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.58
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.45
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 98.34
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 98.13
KOG2813 406 consensus Predicted molecular chaperone, contains 97.87
PLN03165111 chaperone protein dnaJ-related; Provisional 97.7
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.67
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 97.55
KOG2813 406 consensus Predicted molecular chaperone, contains 97.42
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 97.39
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 97.08
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.93
PRK14299291 chaperone protein DnaJ; Provisional 96.58
PRK10266306 curved DNA-binding protein CbpA; Provisional 96.55
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.4
KOG0431453 consensus Auxilin-like protein and related protein 96.39
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.12
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 95.98
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 95.29
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 93.21
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 93.17
PF1344662 RPT: A repeated domain in UCH-protein 92.9
KOG2824281 consensus Glutaredoxin-related protein [Posttransl 92.85
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 91.98
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 88.37
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 87.46
PRK04023 1121 DNA polymerase II large subunit; Validated 86.89
KOG0724335 consensus Zuotin and related molecular chaperones 85.17
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 84.66
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 84.52
PF07092 238 DUF1356: Protein of unknown function (DUF1356); In 82.95
TIGR00310192 ZPR1_znf ZPR1 zinc finger domain. 82.8
smart00709160 Zpr1 Duplicated domain in the epidermal growth fac 81.37
PRK00635 1809 excinuclease ABC subunit A; Provisional 81.26
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 81.12
PRK14714 1337 DNA polymerase II large subunit; Provisional 80.78
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 80.15
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-67  Score=448.70  Aligned_cols=230  Identities=43%  Similarity=0.808  Sum_probs=202.2

Q ss_pred             CCccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-CH---HHHHHHHHHHhhcCCccccchhhhcCchhhhc-CCC
Q 025877            9 SNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGG-DP---EKFKELGQAYEVLSDPEKRDIYDQYGEDALKE-GMG   83 (247)
Q Consensus         9 ~~~~~~y~~Lg~~~~a~~~~ik~ayr~l~~~~hpd~~~-~~---~~~~~i~~Ay~~l~~~~~r~~yD~~g~~~~~~-g~~   83 (247)
                      +..+|||+||||+++||.+|||+|||+||++||||+|+ ++   ++|++|++|||||+||++|++||+||+.+++. +++
T Consensus         1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g   80 (371)
T COG0484           1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG   80 (371)
T ss_pred             CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence            45789999999999999999999999999999999998 43   89999999999999999999999999998863 322


Q ss_pred             CC--CCCC-CcchhhccccCCCCCCCCCCCCCcccccCcceeeeeeeeeeecccCceeeecccccccCCCCCCCCCCCCC
Q 025877           84 GA--GAAH-NPFDIFESFFGGGTFGAGGSSRGRRRKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGA  160 (247)
Q Consensus        84 ~~--~~~~-~~~~~F~~~Fg~~~~~~~~~~~~~~~~~~~~i~~~l~~sl~e~~~G~~~~~~~~~~~~C~~C~G~G~~~~~  160 (247)
                      +.  ++++ ++.|||++||+++.+   +.++..+++++.|+.+.|+|+|+|++.|+++++.+++.++|++|+|+|+..+.
T Consensus        81 g~g~~~fgg~~~DIF~~~FgGg~~---~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt  157 (371)
T COG0484          81 GFGFGGFGGDFGDIFEDFFGGGGG---GRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGT  157 (371)
T ss_pred             CCCcCCCCCCHHHHHHHhhcCCCc---ccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCC
Confidence            21  1122 578999999973322   22233446789999999999999999999999999999999999999999984


Q ss_pred             -cccCCCCCCCcEEEEEEeeccceeeEeeeeCCCCcccceEecCCCCCCCCCCCcEEEEeEEEEEEecCCCCCCCEEEEc
Q 025877          161 -LGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIAFE  239 (247)
Q Consensus       161 -~~~C~~C~G~G~~~~~~~~~~g~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~~~v~Ip~G~~~g~~i~~~  239 (247)
                       ..+|+.|+|+|.+...+++   .+++++++|+.|+|+|++++  ++|++|+|.|++...++++|+||+|+.+|++|+++
T Consensus       158 ~~~tC~tC~G~G~v~~~~~~---g~~~~~~~C~~C~G~G~~i~--~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~  232 (371)
T COG0484         158 DPKTCPTCNGSGQVRTVQRT---GFFSFQQTCPTCNGTGKIIK--DPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLS  232 (371)
T ss_pred             CCCcCCCCCCcCeEEEEEee---eEEEEEEECCCCccceeECC--CCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEe
Confidence             6789999999998888777   44566799999999999996  99999999999999999999999999999999999


Q ss_pred             cCCCCCC
Q 025877          240 GQADEAV  246 (247)
Q Consensus       240 g~Gd~~~  246 (247)
                      |+|++++
T Consensus       233 g~G~~g~  239 (371)
T COG0484         233 GEGEAGP  239 (371)
T ss_pred             cCcccCC
Confidence            9999986

>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PF07092 DUF1356: Protein of unknown function (DUF1356); InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length Back     alignment and domain information
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain Back     alignment and domain information
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
1nlt_A 248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 6e-26
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-19
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-17
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-17
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-16
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 5e-16
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 6e-16
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 7e-16
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 8e-16
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 9e-16
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 5e-15
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-14
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-13
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-13
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-12
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-12
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-11
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-11
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-08
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 2e-08
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 4e-08
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 4e-08
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 3e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-04
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 4e-04
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 4e-04
2pf4_E174 Crystal Structure Of The Full-Length Simian Virus 4 5e-04
>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (60%), Gaps = 1/130 (0%)
Query: 116 KQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPXXXXXXXXXXXXXXXYGCQGTGMKIT 175
           ++G+D+ H +  SLE+LY G T KL+L++ ILC                  C G G+K  
Sbjct: 9   QRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFV 68
Query: 176 TRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQK 235
           TRQ+G  MIQ+ Q  C  C G G++I  +D+C  C   KV  E+K+LEVHVE GM+ GQ+
Sbjct: 69  TRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQR 127
Query: 236 IAFEGQADEA 245
           I F+G+AD+A
Sbjct: 128 IVFKGEADQA 137
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2PF4|E Chain E, Crystal Structure Of The Full-Length Simian Virus 40 Small T Antigen Complexed With The Protein Phosphatase 2a Aalpha Subunit Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 3e-65
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 1e-50
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-42
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-41
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 4e-39
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-38
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-37
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-37
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-37
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-37
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 4e-37
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 5e-37
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 4e-35
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-35
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-35
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-34
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 5e-34
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-33
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-33
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 5e-32
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-30
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-30
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 9e-28
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 7e-27
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-26
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-22
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-17
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 3e-17
2guz_A71 Mitochondrial import inner membrane translocase su 6e-17
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-16
3agx_A 181 DNAJ homolog subfamily B member 1; chaperone; 1.85 3e-16
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 2e-07
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-16
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-15
2q2g_A 180 HSP40 protein, heat shock 40 kDa protein, putative 2e-14
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 2e-11
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 6e-11
1c3g_A 170 Heat shock protein 40; beta sheets, short helices, 7e-11
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-10
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
 Score =  202 bits (515), Expect = 3e-65
 Identities = 67/138 (48%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 108 GSSRGRRRKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSKSGALGKCYGC 167
           G+ R R  ++G+D+ H +  SLE+LY G T KL+L++ ILC +C+G+G K GA+ KC  C
Sbjct: 1   GAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSC 60

Query: 168 QGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVE 227
            G G+K  TRQ+G  MIQ+ Q  C  C G G++I  +D+C  C   KV  E+K+LEVHVE
Sbjct: 61  NGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVE 119

Query: 228 KGMQHGQKIAFEGQADEA 245
            GM+ GQ+I F+G+AD+A
Sbjct: 120 PGMKDGQRIVFKGEADQA 137
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 100.0
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 99.97
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.9
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.88
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.87
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.86
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.86
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.85
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.85
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.85
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.85
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.82
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.82
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.81
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.8
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.8
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.8
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.78
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.78
2guz_A71 Mitochondrial import inner membrane translocase su 99.76
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.75
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.71
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.7
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.68
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.68
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.67
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.66
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.66
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.66
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 99.56
3agx_A 181 DNAJ homolog subfamily B member 1; chaperone; 1.85 99.4
2guz_B65 Mitochondrial import inner membrane translocase su 99.23
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 99.15
2q2g_A 180 HSP40 protein, heat shock 40 kDa protein, putative 99.14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.01
1c3g_A 170 Heat shock protein 40; beta sheets, short helices, 98.74
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 98.43
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 98.31
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 98.13
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 97.89
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 97.62
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 97.59
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.57
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 97.55
3pmq_A 669 Decaheme cytochrome C MTRF; greek KEY, C type cyto 97.26
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 97.03
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 97.03
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 96.99
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 96.78
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 92.68
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=5.9e-37  Score=264.88  Aligned_cols=174  Identities=31%  Similarity=0.489  Sum_probs=56.5

Q ss_pred             CCCccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCH---HHHHHHHHHHhhcCCccccchhhhcCchhhhcCCCC
Q 025877            8 RSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDP---EKFKELGQAYEVLSDPEKRDIYDQYGEDALKEGMGG   84 (247)
Q Consensus         8 ~~~~~~~y~~Lg~~~~a~~~~ik~ayr~l~~~~hpd~~~~~---~~~~~i~~Ay~~l~~~~~r~~yD~~g~~~~~~g~~~   84 (247)
                      .+..+|||+||||+++|+.+|||+|||+||++||||+++++   ++|++|++||++|+||.+|+.||+|+......++++
T Consensus        24 ~m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~  103 (329)
T 3lz8_A           24 AMELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR  103 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccc
Confidence            45668999999999999999999999999999999998753   799999999999999999999999854422111110


Q ss_pred             -----CC--CCCCcchhhccccCCCCCCCCCCCCCcccccCcceeeeeeeeeeecccCceeeecccccccCCCCCCCCCC
Q 025877           85 -----AG--AAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGEDVVHTLKVSLEDLYNGTTKKLSLSRNILCPKCKGKGSK  157 (247)
Q Consensus        85 -----~~--~~~~~~~~F~~~Fg~~~~~~~~~~~~~~~~~~~~i~~~l~~sl~e~~~G~~~~~~~~~~~~C~~C~G~G~~  157 (247)
                           .+  +..++.++|++||++++.+    +..+.+.++.|+.+.|.|+|+|++.|+++++.+++.+.|    +.   
T Consensus       104 ~~~~~~~~f~~~~f~diF~~~Fg~~g~~----~~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~----g~---  172 (329)
T 3lz8_A          104 QRQTHEQSYSQQDFDDIFSSMFGQQAHQ----RRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN----VF---  172 (329)
T ss_dssp             -------------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC----SC---
T ss_pred             ccccccCCcCCCchhhhhHhhhcCcCCC----CCCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec----CC---
Confidence                 01  1124668888888742111    112235678999999999999999999999998765422    11   


Q ss_pred             CCCcccCCCCCCCcEEEEEEeeccceeeEeeeeCCCCcccceEecCCCCCCCCCCCcEEEEeEEEEEEecCCCCCCCEEE
Q 025877          158 SGALGKCYGCQGTGMKITTRQIGLGMIQQMQHVCPECRGAGEVISERDKCPQCKANKVTQEKKVLEVHVEKGMQHGQKIA  237 (247)
Q Consensus       158 ~~~~~~C~~C~G~G~~~~~~~~~~g~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~~~v~Ip~G~~~g~~i~  237 (247)
                                   |                           .+              ++...++++|+||+||++|++|+
T Consensus       173 -------------G---------------------------~v--------------~~~~~~~l~V~IP~Gv~~G~~Ir  198 (329)
T 3lz8_A          173 -------------G---------------------------MI--------------ESETPKTLNVKIPAGVVDGQRIR  198 (329)
T ss_dssp             -------------C----------------------------C--------------CEEEEEEEEEEECTTCCTTCEEE
T ss_pred             -------------e---------------------------EE--------------EEecceEEEEeCCCCCCCCCEEE
Confidence                         1                           11              22345689999999999999999


Q ss_pred             EccCCCCCC
Q 025877          238 FEGQADEAV  246 (247)
Q Consensus       238 ~~g~Gd~~~  246 (247)
                      |+|+|++.+
T Consensus       199 l~G~G~~g~  207 (329)
T 3lz8_A          199 LKGQGTPGE  207 (329)
T ss_dssp             ESSCSCCC-
T ss_pred             EcccccCCC
Confidence            999999864
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 8e-22
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-20
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-19
d1nlta374 g.54.1.1 (A:139-212) Mitochondrial protein import 2e-19
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 6e-19
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-18
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 5e-17
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-16
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-16
d1exka_79 g.54.1.1 (A:) Cysteine-rich domain of the chaperon 2e-10
d1m1qa_90 a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum 3e-05
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 1e-04
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 2e-04
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 83.9 bits (207), Expect = 8e-22
 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 4/71 (5%)

Query: 14 YYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDP----EKFKELGQAYEVLSDPEKRDI 69
          YYEILGVSK+A E E++KAY++ AMK HPD+         KFKE+ +AYEVL+D +KR  
Sbjct: 5  YYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 64

Query: 70 YDQYGEDALKE 80
          YDQYG  A ++
Sbjct: 65 YDQYGHAAFEQ 75
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.86
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.84
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.83
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.73
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.72
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 99.72
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 99.62
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.24
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.21
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 98.47
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 98.0
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 97.73
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 97.35
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 96.8
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 92.54
d2b7ea156 Pre-mRNA-processing protein PRP40 {Baker's yeast ( 80.58
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=1.5e-25  Score=151.16  Aligned_cols=69  Identities=57%  Similarity=0.956  Sum_probs=63.8

Q ss_pred             ccccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCH----HHHHHHHHHHhhcCCccccchhhhcCchhhh
Q 025877           11 NTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDP----EKFKELGQAYEVLSDPEKRDIYDQYGEDALK   79 (247)
Q Consensus        11 ~~~~y~~Lg~~~~a~~~~ik~ayr~l~~~~hpd~~~~~----~~~~~i~~Ay~~l~~~~~r~~yD~~g~~~~~   79 (247)
                      .+|||+||||+++||.+|||+|||+|++++|||+++++    +.|..|++||+||+||.+|..||.+|..+++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            57999999999999999999999999999999998753    6799999999999999999999999987643
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure