Citrus Sinensis ID: 025931
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| 118485672 | 280 | unknown [Populus trichocarpa] | 0.995 | 0.875 | 0.817 | 1e-108 | |
| 255575283 | 275 | nucleic acid binding protein, putative [ | 0.979 | 0.876 | 0.796 | 1e-107 | |
| 224138192 | 267 | predicted protein [Populus trichocarpa] | 0.934 | 0.861 | 0.827 | 1e-102 | |
| 225427136 | 282 | PREDICTED: protein vip1 [Vitis vinifera] | 1.0 | 0.872 | 0.75 | 2e-97 | |
| 356496275 | 279 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.878 | 0.731 | 1e-94 | |
| 255637225 | 279 | unknown [Glycine max] | 0.995 | 0.878 | 0.731 | 3e-94 | |
| 356531441 | 280 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.875 | 0.732 | 2e-93 | |
| 255645299 | 280 | unknown [Glycine max] | 0.995 | 0.875 | 0.732 | 5e-93 | |
| 224071379 | 276 | predicted protein [Populus trichocarpa] | 0.967 | 0.862 | 0.743 | 8e-93 | |
| 357516947 | 279 | hypothetical protein MTR_8g066460 [Medic | 0.995 | 0.878 | 0.723 | 9e-93 |
| >gi|118485672|gb|ABK94686.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 396 bits (1018), Expect = e-108, Method: Compositional matrix adjust.
Identities = 202/247 (81%), Positives = 217/247 (87%), Gaps = 2/247 (0%)
Query: 1 MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASA-LHETKN 59
MKSDNE +QIAYVTFKD QGA+TAVLLSGATIVDLSV+++L PDYQLPPAA A L T N
Sbjct: 35 MKSDNERSQIAYVTFKDSQGADTAVLLSGATIVDLSVTVALDPDYQLPPAALAELSATGN 94
Query: 60 KTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIG 119
K P G ESALRKAEDVVS MLAKGFILGKDA+ KAK FDEKHQ TSTASAKV SFDKKIG
Sbjct: 95 KAP-GDESALRKAEDVVSGMLAKGFILGKDAINKAKGFDEKHQLTSTASAKVVSFDKKIG 153
Query: 120 FSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWV 179
+EKIS GT+VV D+VREVDQKFQVSEKTKSAF AEQKVSS GSAIM NRYVFTGA+WV
Sbjct: 154 LTEKISAGTTVVGDKVREVDQKFQVSEKTKSAFAVAEQKVSSAGSAIMSNRYVFTGAAWV 213
Query: 180 AGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTSSPSGHQPSKTE 239
GAFNKVA+AAG+VGQKAKEKAGMAEEEQKRKMVDDFAQVHL+ESPK SS S +PSK
Sbjct: 214 TGAFNKVAKAAGDVGQKAKEKAGMAEEEQKRKMVDDFAQVHLSESPKASSASDQKPSKPP 273
Query: 240 PAQGLVL 246
PAQGL+L
Sbjct: 274 PAQGLIL 280
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255575283|ref|XP_002528545.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532047|gb|EEF33857.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224138192|ref|XP_002326541.1| predicted protein [Populus trichocarpa] gi|222833863|gb|EEE72340.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225427136|ref|XP_002278543.1| PREDICTED: protein vip1 [Vitis vinifera] gi|297742057|emb|CBI33844.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356496275|ref|XP_003516994.1| PREDICTED: uncharacterized protein LOC100809613 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255637225|gb|ACU18943.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531441|ref|XP_003534286.1| PREDICTED: uncharacterized protein LOC100797009 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255645299|gb|ACU23146.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224071379|ref|XP_002303431.1| predicted protein [Populus trichocarpa] gi|222840863|gb|EEE78410.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357516947|ref|XP_003628762.1| hypothetical protein MTR_8g066460 [Medicago truncatula] gi|355522784|gb|AET03238.1| hypothetical protein MTR_8g066460 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| TAIR|locus:2129401 | 313 | AT4G17720 [Arabidopsis thalian | 0.926 | 0.728 | 0.691 | 1.7e-78 | |
| TAIR|locus:2172947 | 295 | AT5G46870 [Arabidopsis thalian | 0.955 | 0.796 | 0.598 | 3.5e-68 | |
| TAIR|locus:2148970 | 260 | BPA1 "binding partner of acd11 | 0.756 | 0.715 | 0.678 | 1.5e-60 | |
| TAIR|locus:2200211 | 279 | AT1G67950 [Arabidopsis thalian | 0.768 | 0.677 | 0.520 | 2e-47 | |
| TAIR|locus:2145806 | 267 | AT5G32450 [Arabidopsis thalian | 0.752 | 0.692 | 0.507 | 5.9e-41 | |
| TAIR|locus:2012567 | 244 | AT1G14340 [Arabidopsis thalian | 0.727 | 0.733 | 0.371 | 5.7e-27 | |
| TAIR|locus:2102067 | 249 | AT3G01210 [Arabidopsis thalian | 0.723 | 0.714 | 0.366 | 2.4e-21 | |
| ASPGD|ASPL0000008076 | 270 | AN6004 [Emericella nidulans (t | 0.532 | 0.485 | 0.277 | 2.5e-07 | |
| DICTYBASE|DDB_G0291155 | 311 | DDB_G0291155 "RNA-binding regi | 0.418 | 0.331 | 0.3 | 6.1e-06 |
| TAIR|locus:2129401 AT4G17720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 767 (275.1 bits), Expect = 1.7e-78, Sum P(2) = 1.7e-78
Identities = 159/230 (69%), Positives = 184/230 (80%)
Query: 2 KSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETK--N 59
+S+ E T++AYVTFKD+QGAETAVLLSGATIVD SV +S+APDYQL P A A E K N
Sbjct: 36 QSETERTKLAYVTFKDLQGAETAVLLSGATIVDSSVIVSMAPDYQLSPEALASLEPKDSN 95
Query: 60 KTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIG 119
K+P +S LRKAEDVVSSMLAKGFILGKDA+ KAK+ DEKHQ TSTASAKVASFDKKIG
Sbjct: 96 KSPKAGDSVLRKAEDVVSSMLAKGFILGKDAIAKAKSVDEKHQLTSTASAKVASFDKKIG 155
Query: 120 FSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWV 179
F++KI+ GT VV ++VREVDQK+QVSEKTKSA AAEQ VS+ GSAIMKNRYV TGA+WV
Sbjct: 156 FTDKINTGTVVVGEKVREVDQKYQVSEKTKSAIAAAEQTVSNAGSAIMKNRYVLTGATWV 215
Query: 180 AGAFNKVAQAAGEVXXXXXXXXXXXXXXXXRKMVDDFAQVHLAESPKTSS 229
GAFNKVA+AA EV RK+VD+FA+VHL+ESPK +S
Sbjct: 216 TGAFNKVAKAAEEVGQKAKEKVGMAEEEDKRKVVDEFARVHLSESPKAAS 265
|
|
| TAIR|locus:2172947 AT5G46870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148970 BPA1 "binding partner of acd11 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200211 AT1G67950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145806 AT5G32450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012567 AT1G14340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2102067 AT3G01210 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000008076 AN6004 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291155 DDB_G0291155 "RNA-binding region RNP-1 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| PLN03120 | 260 | PLN03120, PLN03120, nucleic acid binding protein; | 1e-122 | |
| PLN03121 | 243 | PLN03121, PLN03121, nucleic acid binding protein; | 2e-46 | |
| cd12269 | 69 | cd12269, RRM_Vip1_like, RNA recognition motif in a | 1e-10 |
| >gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
Score = 348 bits (894), Expect = e-122
Identities = 170/228 (74%), Positives = 193/228 (84%), Gaps = 3/228 (1%)
Query: 1 MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNK 60
M+S+NE +QIAYVTFKD QGAETA+LLSGATIVD SV+I+ A DYQLPP A A + N
Sbjct: 36 MQSENERSQIAYVTFKDPQGAETALLLSGATIVDQSVTITPAEDYQLPPEALA-PLSSNS 94
Query: 61 TPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGF 120
+GAESA++KAEDVVSSMLAKGFILGKDAV KAK FDEKHQ TSTASAKVAS DKKIG
Sbjct: 95 PASGAESAVKKAEDVVSSMLAKGFILGKDAVNKAKAFDEKHQLTSTASAKVASLDKKIGL 154
Query: 121 SEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVA 180
SEK+S GT+VV+++V+EVDQK+QVSEKTKSA AAEQKVSS GSAIMKNRYV TGASWV
Sbjct: 155 SEKLSAGTAVVNEKVKEVDQKYQVSEKTKSALAAAEQKVSSAGSAIMKNRYVLTGASWVT 214
Query: 181 GAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTS 228
GAFNKVA+AA EVGQK KEK G AEEEQ ++VD +A +HL+ESPK
Sbjct: 215 GAFNKVAKAAEEVGQKTKEKVGAAEEEQ--QVVDAYANIHLSESPKAV 260
|
Length = 260 |
| >gnl|CDD|215589 PLN03121, PLN03121, nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 100.0 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 100.0 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 95.54 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 94.48 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 93.66 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 93.05 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 91.33 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 89.39 | |
| smart00360 | 71 | RRM RNA recognition motif. | 89.09 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 86.6 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 84.85 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 84.29 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 80.38 |
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-73 Score=514.08 Aligned_cols=224 Identities=75% Similarity=1.004 Sum_probs=205.3
Q ss_pred CCCCCCCceEEEEEEeccchhhHHhhccCCeecCceEEEecCCCCCCCCCccccccccCCCCCCccchhhhHHHHHHHHH
Q 025931 1 MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSML 80 (246)
Q Consensus 1 ~~~~~e~sqtA~VTFe~~~Aa~TALLLsGAtL~d~~V~It~~~~~~~~~~~~~~~~~e~~~qe~kp~a~~~a~~IvAemL 80 (246)
|.++.+..+.|||||+++.++++||||||++|+|+.|+|+++++|.+|+.......... .......+++++++||++||
T Consensus 36 I~~d~~~~GfAFVtF~d~eaAe~AllLnG~~l~gr~V~Vt~a~~~~~p~~~~~~~~~~~-~~~~~~~~~~~a~~vva~mL 114 (260)
T PLN03120 36 MQSENERSQIAYVTFKDPQGAETALLLSGATIVDQSVTITPAEDYQLPPEALAPLSSNS-PASGAESAVKKAEDVVSSML 114 (260)
T ss_pred EeecCCCCCEEEEEeCcHHHHHHHHHhcCCeeCCceEEEEeccCCCCCccccccccccc-CCCCccchhhHHHHHHHHHH
Confidence 34566677899999999999999999999999999999999999999877643321111 11111148999999999999
Q ss_pred hccccccHHHHHHHHHhhhhcCccHHHHHHHhhhhhhcCccccccccchhhhhhhhhhccccchhHhHHHHHHHHHHHHh
Q 025931 81 AKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVS 160 (246)
Q Consensus 81 AkGYvLgddAi~KAi~fDekHgiSs~f~a~v~slD~K~glTeKis~g~~~v~ekak~vDeky~VSektksa~~aaeq~~~ 160 (246)
||||+||||||+|||+||||||||++|+++|++||+||||||||+.|+++||+++|+||||||||+||++++.++||+++
T Consensus 115 AkGy~l~~dA~~kAk~fDekH~~ss~a~a~v~~~d~k~gltek~~~g~~~v~~~~k~vDeky~vs~kt~sa~~~~~~~~~ 194 (260)
T PLN03120 115 AKGFILGKDAVNKAKAFDEKHQLTSTASAKVASLDKKIGLSEKLSAGTAVVNEKVKEVDQKYQVSEKTKSALAAAEQKVS 194 (260)
T ss_pred hhhhhhhHHHHHHHHHHHHhhchHHHHHHHHHhhhhhcCcccccccchHHHHHHHHhhhhhhchhHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhhhhhcCcccccchhhhhhHHHHHHHHHhhhhhhHHHHhhhhHHHHhhhhcccccccccCCCCCC
Q 025931 161 SVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKT 227 (246)
Q Consensus 161 ~agsai~~n~Yvs~Ga~wvsga~~~vakaa~~~g~~~~ek~~~~~~~~~~~~~~~~~~~~~~~~~~~ 227 (246)
+||||||+||||++||+||||||+||||||.|+|+|++|||+++|+++ +++++|+++|+++||++
T Consensus 195 ~a~sai~~~~y~~~ga~w~~~a~~~~a~aa~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 259 (260)
T PLN03120 195 SAGSAIMKNRYVLTGASWVTGAFNKVAKAAEEVGQKTKEKVGAAEEEQ--QVVDAYANIHLSESPKA 259 (260)
T ss_pred HHHHHHhcCcccccchHHHHHHHHHHHHHHHHHhhhhHHHHhhhhhhc--ccccccceeecCCCCCC
Confidence 999999999999999999999999999999999999999999988887 99999999999999975
|
|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 42.5 bits (99), Expect = 8e-05
Identities = 40/321 (12%), Positives = 75/321 (23%), Gaps = 120/321 (37%)
Query: 1 MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALH----- 55
+ S + + F +L +V V L +Y+ S +
Sbjct: 55 IMSKDAVSGT-LRLF-------WTLLSKQEEMVQKFVEEVLRINYKF--LMSPIKTEQRQ 104
Query: 56 ---------ETKNKTPNGAES-------------ALRKA--ED------VVSSMLAKGFI 85
E +++ N + LR+A E ++ + G
Sbjct: 105 PSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGV--LGS- 161
Query: 86 LGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKI---SVGTSVVSDRVREVDQKF 142
GK T A S+ + KI ++ + V E+ QK
Sbjct: 162 -GK---------------TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL 205
Query: 143 QV------------SEKTKSAFVAAEQKVSSVGSAIMKNRY---------VFTGASWVAG 181
S K + + ++ + + Y V +
Sbjct: 206 LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRL---LKSKPYENCLLVLLNVQN--AKAWN 260
Query: 182 AFN------------KVAQAAGEVGQKA----KEKAGMAEEEQKRKMVDDFAQVHLAESP 225
AFN +V + +E K + +
Sbjct: 261 AFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK----SLLLKY--LDCR 314
Query: 226 KTSSPSGHQPSKTEPAQGLVL 246
P + T P L
Sbjct: 315 PQDLP--REVLTTNP---RRL 330
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 95.81 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 95.77 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 95.73 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 95.42 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 95.37 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 95.36 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 95.25 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 95.11 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 94.95 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 94.93 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 94.93 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 94.87 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 94.86 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 94.84 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 94.83 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 94.78 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 94.77 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 94.76 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 94.74 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 94.7 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 94.69 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 94.59 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 94.59 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 94.59 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 94.59 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 94.59 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 94.57 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 94.51 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 94.5 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 94.48 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 94.47 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 94.37 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 94.36 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 94.35 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 94.31 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 94.29 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 94.26 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 94.23 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 94.18 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 94.17 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 94.16 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 94.15 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 94.14 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 94.13 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 94.06 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 94.05 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 94.04 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 93.99 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 93.98 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 93.96 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 93.91 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 93.89 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 93.84 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 93.83 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 93.81 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 93.81 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 93.8 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 93.79 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 93.76 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 93.74 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 93.72 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 93.69 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 93.68 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 93.67 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 93.66 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 93.63 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 93.58 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 93.57 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 93.54 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 93.51 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 93.45 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 93.42 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 93.39 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 93.37 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 93.3 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 93.28 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 93.27 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 93.27 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 93.21 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 93.2 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 93.18 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 93.17 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 93.14 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 93.12 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 93.04 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 93.0 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 92.98 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 92.95 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 92.94 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 92.86 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 92.79 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 92.79 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 92.76 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 92.71 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 92.69 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 92.69 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 92.57 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 92.44 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 92.38 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 92.37 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 92.29 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 92.28 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 92.24 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 92.2 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 92.2 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 92.07 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 91.9 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 91.79 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 91.65 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 91.3 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 91.27 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 91.22 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 91.12 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 91.09 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 91.04 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 90.93 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 90.83 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 90.72 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 90.67 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 90.56 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 90.53 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 90.52 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 90.5 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 90.35 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 90.31 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 90.12 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 90.03 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 89.94 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 89.94 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 89.93 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 89.6 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 89.55 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 89.49 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 89.44 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 88.97 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 89.35 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 89.3 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 89.27 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 89.18 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 89.15 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 89.13 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 89.03 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 89.0 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 88.93 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 88.21 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 88.19 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 88.05 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 87.61 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 87.49 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 87.41 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 87.25 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 86.57 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 86.49 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 86.09 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 85.11 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 84.26 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 83.74 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 83.62 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 83.54 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 83.32 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 80.62 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 80.52 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 80.04 |
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=95.81 E-value=0.014 Score=43.42 Aligned_cols=43 Identities=16% Similarity=0.254 Sum_probs=35.5
Q ss_pred CCCCCc-eEEEEEEeccchhhHHhh-ccCCeecCc-eEEEecCCCC
Q 025931 3 SDNEWT-QIAYVTFKDMQGAETAVL-LSGATIVDL-SVSISLAPDY 45 (246)
Q Consensus 3 ~~~e~s-qtA~VTFe~~~Aa~TALL-LsGAtL~d~-~V~It~~~~~ 45 (246)
+..+.+ ..|+|+|+++..++.|+- |+|..|.|. .|.|..+.+.
T Consensus 55 ~~~g~~~G~afV~f~~~~~A~~Ai~~l~g~~~~g~~~l~V~~a~~~ 100 (105)
T 2nlw_A 55 EEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDF 100 (105)
T ss_dssp CBTTBSCCEEEEEECSSSHHHHHHHHCSSEECSTTCEEEEECSCCC
T ss_pred CCCCCeeeEEEEEECCHHHHHHHHHHhCCcccCCCceEEEEEcchH
Confidence 334443 489999999999999998 899999998 9999876544
|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.07 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 96.59 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 95.66 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 95.54 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 95.46 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 95.44 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 95.38 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 95.33 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 95.25 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 95.19 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 95.18 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 95.12 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 95.07 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 95.05 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 95.02 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 95.02 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 94.88 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 94.85 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 94.82 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 94.81 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 94.8 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 94.76 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 94.67 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 94.53 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 94.41 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 94.2 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 94.15 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 94.12 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 94.01 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 94.01 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 93.97 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 93.96 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 93.96 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 93.96 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 93.82 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 93.77 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 93.76 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 93.76 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 93.64 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 93.54 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 93.43 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 93.24 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 93.24 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 93.17 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 92.99 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 92.93 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 92.91 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 92.75 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 92.73 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 92.47 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 92.43 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 92.1 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 91.84 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 91.72 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 91.51 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 91.38 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 91.38 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 91.2 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 91.17 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 91.15 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 90.96 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 90.88 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 90.75 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 90.74 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 90.27 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 90.24 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 89.74 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 88.54 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 87.66 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 87.34 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 86.86 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 85.59 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 85.51 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 84.08 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 82.94 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 82.4 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 81.48 |
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: U4/U6 snRNA-associated-splicing factor PRP24 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=97.07 E-value=0.00021 Score=49.79 Aligned_cols=39 Identities=15% Similarity=0.133 Sum_probs=34.8
Q ss_pred CCCCceEEEEEEeccchhhHHhhccCCeecCceEEEecC
Q 025931 4 DNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLA 42 (246)
Q Consensus 4 ~~e~sqtA~VTFe~~~Aa~TALLLsGAtL~d~~V~It~~ 42 (246)
.++..+.|+|+|+++.+++.||.|+|..|+|+.|.|...
T Consensus 36 ~~~~~~~afV~F~~~~~a~~Al~~~~~~i~g~~i~V~~~ 74 (75)
T d2ghpa2 36 LKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHL 74 (75)
T ss_dssp TTSSSEEEEEEESSHHHHHHHHTTTTCEETTEECEEEEC
T ss_pred ccccceEEEEEEcchHHhHHHHHhcCcEECCEEEEEEEC
Confidence 345567999999999999999999999999999999754
|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|