Citrus Sinensis ID: 025931


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTSSPSGHQPSKTEPAQGLVL
ccccccccEEEEEEEEcccHHHHHHHHcccEEcccEEEEEcccccccccccccccccccccccccHHHHcHHHHHHHHHHHcHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccccccccccccccccccc
ccccccccEEEEEEEccHHHHHHHHHHcccEEcccEEEEEccccccccccHcHccccccccccccHHHccHHHHHHHHHHHcccEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccccccccccccccccc
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVsislapdyqlppaasalhetknktpngaeSALRKAEDVVSSMLAKGFilgkdavfkaktfdekhqftstasaKVASFdkkigfsekisvgtsvvsDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVhlaespktsspsghqpsktepaqglvl
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDekhqftstasakvasfdkkigfsekisvgtsvvsdrvrEVDQkfqvsektksafvaaeqkvssvgsaiMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAespktsspsghqpsktepaqglvl
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVgqkakekagmaeeeqkRKMVDDFAQVHLAESPKTSSPSGHQPSKTEPAQGLVL
******WTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDY*****************************VVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSD******************FVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQ**********************************************************
************VTFKDMQGAETAVLLSGATIVDLSVSISLAPDY****************************DVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQ******************************************************GLV*
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAA*******************RKMVDDFAQVHLA************************
******WTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLP********************LRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEE***************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTSSPSGHQPSKTEPAQGLVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
118485672280 unknown [Populus trichocarpa] 0.995 0.875 0.817 1e-108
255575283275 nucleic acid binding protein, putative [ 0.979 0.876 0.796 1e-107
224138192267 predicted protein [Populus trichocarpa] 0.934 0.861 0.827 1e-102
225427136282 PREDICTED: protein vip1 [Vitis vinifera] 1.0 0.872 0.75 2e-97
356496275279 PREDICTED: uncharacterized protein LOC10 0.995 0.878 0.731 1e-94
255637225279 unknown [Glycine max] 0.995 0.878 0.731 3e-94
356531441280 PREDICTED: uncharacterized protein LOC10 0.995 0.875 0.732 2e-93
255645299280 unknown [Glycine max] 0.995 0.875 0.732 5e-93
224071379276 predicted protein [Populus trichocarpa] 0.967 0.862 0.743 8e-93
357516947279 hypothetical protein MTR_8g066460 [Medic 0.995 0.878 0.723 9e-93
>gi|118485672|gb|ABK94686.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/247 (81%), Positives = 217/247 (87%), Gaps = 2/247 (0%)

Query: 1   MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASA-LHETKN 59
           MKSDNE +QIAYVTFKD QGA+TAVLLSGATIVDLSV+++L PDYQLPPAA A L  T N
Sbjct: 35  MKSDNERSQIAYVTFKDSQGADTAVLLSGATIVDLSVTVALDPDYQLPPAALAELSATGN 94

Query: 60  KTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIG 119
           K P G ESALRKAEDVVS MLAKGFILGKDA+ KAK FDEKHQ TSTASAKV SFDKKIG
Sbjct: 95  KAP-GDESALRKAEDVVSGMLAKGFILGKDAINKAKGFDEKHQLTSTASAKVVSFDKKIG 153

Query: 120 FSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWV 179
            +EKIS GT+VV D+VREVDQKFQVSEKTKSAF  AEQKVSS GSAIM NRYVFTGA+WV
Sbjct: 154 LTEKISAGTTVVGDKVREVDQKFQVSEKTKSAFAVAEQKVSSAGSAIMSNRYVFTGAAWV 213

Query: 180 AGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTSSPSGHQPSKTE 239
            GAFNKVA+AAG+VGQKAKEKAGMAEEEQKRKMVDDFAQVHL+ESPK SS S  +PSK  
Sbjct: 214 TGAFNKVAKAAGDVGQKAKEKAGMAEEEQKRKMVDDFAQVHLSESPKASSASDQKPSKPP 273

Query: 240 PAQGLVL 246
           PAQGL+L
Sbjct: 274 PAQGLIL 280




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255575283|ref|XP_002528545.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532047|gb|EEF33857.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224138192|ref|XP_002326541.1| predicted protein [Populus trichocarpa] gi|222833863|gb|EEE72340.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225427136|ref|XP_002278543.1| PREDICTED: protein vip1 [Vitis vinifera] gi|297742057|emb|CBI33844.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496275|ref|XP_003516994.1| PREDICTED: uncharacterized protein LOC100809613 [Glycine max] Back     alignment and taxonomy information
>gi|255637225|gb|ACU18943.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356531441|ref|XP_003534286.1| PREDICTED: uncharacterized protein LOC100797009 [Glycine max] Back     alignment and taxonomy information
>gi|255645299|gb|ACU23146.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224071379|ref|XP_002303431.1| predicted protein [Populus trichocarpa] gi|222840863|gb|EEE78410.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357516947|ref|XP_003628762.1| hypothetical protein MTR_8g066460 [Medicago truncatula] gi|355522784|gb|AET03238.1| hypothetical protein MTR_8g066460 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
TAIR|locus:2129401313 AT4G17720 [Arabidopsis thalian 0.926 0.728 0.691 1.7e-78
TAIR|locus:2172947295 AT5G46870 [Arabidopsis thalian 0.955 0.796 0.598 3.5e-68
TAIR|locus:2148970260 BPA1 "binding partner of acd11 0.756 0.715 0.678 1.5e-60
TAIR|locus:2200211279 AT1G67950 [Arabidopsis thalian 0.768 0.677 0.520 2e-47
TAIR|locus:2145806267 AT5G32450 [Arabidopsis thalian 0.752 0.692 0.507 5.9e-41
TAIR|locus:2012567244 AT1G14340 [Arabidopsis thalian 0.727 0.733 0.371 5.7e-27
TAIR|locus:2102067249 AT3G01210 [Arabidopsis thalian 0.723 0.714 0.366 2.4e-21
ASPGD|ASPL0000008076270 AN6004 [Emericella nidulans (t 0.532 0.485 0.277 2.5e-07
DICTYBASE|DDB_G0291155311 DDB_G0291155 "RNA-binding regi 0.418 0.331 0.3 6.1e-06
TAIR|locus:2129401 AT4G17720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 767 (275.1 bits), Expect = 1.7e-78, Sum P(2) = 1.7e-78
 Identities = 159/230 (69%), Positives = 184/230 (80%)

Query:     2 KSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETK--N 59
             +S+ E T++AYVTFKD+QGAETAVLLSGATIVD SV +S+APDYQL P A A  E K  N
Sbjct:    36 QSETERTKLAYVTFKDLQGAETAVLLSGATIVDSSVIVSMAPDYQLSPEALASLEPKDSN 95

Query:    60 KTPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIG 119
             K+P   +S LRKAEDVVSSMLAKGFILGKDA+ KAK+ DEKHQ TSTASAKVASFDKKIG
Sbjct:    96 KSPKAGDSVLRKAEDVVSSMLAKGFILGKDAIAKAKSVDEKHQLTSTASAKVASFDKKIG 155

Query:   120 FSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWV 179
             F++KI+ GT VV ++VREVDQK+QVSEKTKSA  AAEQ VS+ GSAIMKNRYV TGA+WV
Sbjct:   156 FTDKINTGTVVVGEKVREVDQKYQVSEKTKSAIAAAEQTVSNAGSAIMKNRYVLTGATWV 215

Query:   180 AGAFNKVAQAAGEVXXXXXXXXXXXXXXXXRKMVDDFAQVHLAESPKTSS 229
              GAFNKVA+AA EV                RK+VD+FA+VHL+ESPK +S
Sbjct:   216 TGAFNKVAKAAEEVGQKAKEKVGMAEEEDKRKVVDEFARVHLSESPKAAS 265


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0005829 "cytosol" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2172947 AT5G46870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148970 BPA1 "binding partner of acd11 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200211 AT1G67950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145806 AT5G32450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012567 AT1G14340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102067 AT3G01210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008076 AN6004 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291155 DDB_G0291155 "RNA-binding region RNP-1 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
PLN03120260 PLN03120, PLN03120, nucleic acid binding protein; 1e-122
PLN03121243 PLN03121, PLN03121, nucleic acid binding protein; 2e-46
cd1226969 cd12269, RRM_Vip1_like, RNA recognition motif in a 1e-10
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
 Score =  348 bits (894), Expect = e-122
 Identities = 170/228 (74%), Positives = 193/228 (84%), Gaps = 3/228 (1%)

Query: 1   MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNK 60
           M+S+NE +QIAYVTFKD QGAETA+LLSGATIVD SV+I+ A DYQLPP A A   + N 
Sbjct: 36  MQSENERSQIAYVTFKDPQGAETALLLSGATIVDQSVTITPAEDYQLPPEALA-PLSSNS 94

Query: 61  TPNGAESALRKAEDVVSSMLAKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGF 120
             +GAESA++KAEDVVSSMLAKGFILGKDAV KAK FDEKHQ TSTASAKVAS DKKIG 
Sbjct: 95  PASGAESAVKKAEDVVSSMLAKGFILGKDAVNKAKAFDEKHQLTSTASAKVASLDKKIGL 154

Query: 121 SEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVSSVGSAIMKNRYVFTGASWVA 180
           SEK+S GT+VV+++V+EVDQK+QVSEKTKSA  AAEQKVSS GSAIMKNRYV TGASWV 
Sbjct: 155 SEKLSAGTAVVNEKVKEVDQKYQVSEKTKSALAAAEQKVSSAGSAIMKNRYVLTGASWVT 214

Query: 181 GAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKTS 228
           GAFNKVA+AA EVGQK KEK G AEEEQ  ++VD +A +HL+ESPK  
Sbjct: 215 GAFNKVAKAAEEVGQKTKEKVGAAEEEQ--QVVDAYANIHLSESPKAV 260


Length = 260

>gnl|CDD|215589 PLN03121, PLN03121, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
PLN03120260 nucleic acid binding protein; Provisional 100.0
PLN03121243 nucleic acid binding protein; Provisional 100.0
PLN03120260 nucleic acid binding protein; Provisional 95.54
PLN03121243 nucleic acid binding protein; Provisional 94.48
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 93.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 93.05
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 91.33
smart0036272 RRM_2 RNA recognition motif. 89.39
smart0036071 RRM RNA recognition motif. 89.09
smart0036170 RRM_1 RNA recognition motif. 86.6
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 84.85
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 84.29
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 80.38
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.3e-73  Score=514.08  Aligned_cols=224  Identities=75%  Similarity=1.004  Sum_probs=205.3

Q ss_pred             CCCCCCCceEEEEEEeccchhhHHhhccCCeecCceEEEecCCCCCCCCCccccccccCCCCCCccchhhhHHHHHHHHH
Q 025931            1 MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALHETKNKTPNGAESALRKAEDVVSSML   80 (246)
Q Consensus         1 ~~~~~e~sqtA~VTFe~~~Aa~TALLLsGAtL~d~~V~It~~~~~~~~~~~~~~~~~e~~~qe~kp~a~~~a~~IvAemL   80 (246)
                      |.++.+..+.|||||+++.++++||||||++|+|+.|+|+++++|.+|+.......... .......+++++++||++||
T Consensus        36 I~~d~~~~GfAFVtF~d~eaAe~AllLnG~~l~gr~V~Vt~a~~~~~p~~~~~~~~~~~-~~~~~~~~~~~a~~vva~mL  114 (260)
T PLN03120         36 MQSENERSQIAYVTFKDPQGAETALLLSGATIVDQSVTITPAEDYQLPPEALAPLSSNS-PASGAESAVKKAEDVVSSML  114 (260)
T ss_pred             EeecCCCCCEEEEEeCcHHHHHHHHHhcCCeeCCceEEEEeccCCCCCccccccccccc-CCCCccchhhHHHHHHHHHH
Confidence            34566677899999999999999999999999999999999999999877643321111 11111148999999999999


Q ss_pred             hccccccHHHHHHHHHhhhhcCccHHHHHHHhhhhhhcCccccccccchhhhhhhhhhccccchhHhHHHHHHHHHHHHh
Q 025931           81 AKGFILGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKISVGTSVVSDRVREVDQKFQVSEKTKSAFVAAEQKVS  160 (246)
Q Consensus        81 AkGYvLgddAi~KAi~fDekHgiSs~f~a~v~slD~K~glTeKis~g~~~v~ekak~vDeky~VSektksa~~aaeq~~~  160 (246)
                      ||||+||||||+|||+||||||||++|+++|++||+||||||||+.|+++||+++|+||||||||+||++++.++||+++
T Consensus       115 AkGy~l~~dA~~kAk~fDekH~~ss~a~a~v~~~d~k~gltek~~~g~~~v~~~~k~vDeky~vs~kt~sa~~~~~~~~~  194 (260)
T PLN03120        115 AKGFILGKDAVNKAKAFDEKHQLTSTASAKVASLDKKIGLSEKLSAGTAVVNEKVKEVDQKYQVSEKTKSALAAAEQKVS  194 (260)
T ss_pred             hhhhhhhHHHHHHHHHHHHhhchHHHHHHHHHhhhhhcCcccccccchHHHHHHHHhhhhhhchhHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhcCcccccchhhhhhHHHHHHHHHhhhhhhHHHHhhhhHHHHhhhhcccccccccCCCCCC
Q 025931          161 SVGSAIMKNRYVFTGASWVAGAFNKVAQAAGEVGQKAKEKAGMAEEEQKRKMVDDFAQVHLAESPKT  227 (246)
Q Consensus       161 ~agsai~~n~Yvs~Ga~wvsga~~~vakaa~~~g~~~~ek~~~~~~~~~~~~~~~~~~~~~~~~~~~  227 (246)
                      +||||||+||||++||+||||||+||||||.|+|+|++|||+++|+++  +++++|+++|+++||++
T Consensus       195 ~a~sai~~~~y~~~ga~w~~~a~~~~a~aa~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~  259 (260)
T PLN03120        195 SAGSAIMKNRYVLTGASWVTGAFNKVAKAAEEVGQKTKEKVGAAEEEQ--QVVDAYANIHLSESPKA  259 (260)
T ss_pred             HHHHHHhcCcccccchHHHHHHHHHHHHHHHHHhhhhHHHHhhhhhhc--ccccccceeecCCCCCC
Confidence            999999999999999999999999999999999999999999988887  99999999999999975



>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.5 bits (99), Expect = 8e-05
 Identities = 40/321 (12%), Positives = 75/321 (23%), Gaps = 120/321 (37%)

Query: 1   MKSDNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLAPDYQLPPAASALH----- 55
           + S +  +      F         +L     +V   V   L  +Y+     S +      
Sbjct: 55  IMSKDAVSGT-LRLF-------WTLLSKQEEMVQKFVEEVLRINYKF--LMSPIKTEQRQ 104

Query: 56  ---------ETKNKTPNGAES-------------ALRKA--ED------VVSSMLAKGFI 85
                    E +++  N  +               LR+A  E       ++  +   G  
Sbjct: 105 PSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGV--LGS- 161

Query: 86  LGKDAVFKAKTFDEKHQFTSTASAKVASFDKKIGFSEKI---SVGTSVVSDRVREVDQKF 142
            GK               T  A     S+  +     KI   ++      + V E+ QK 
Sbjct: 162 -GK---------------TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL 205

Query: 143 QV------------SEKTKSAFVAAEQKVSSVGSAIMKNRY---------VFTGASWVAG 181
                         S   K    + + ++  +   +    Y         V    +    
Sbjct: 206 LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRL---LKSKPYENCLLVLLNVQN--AKAWN 260

Query: 182 AFN------------KVAQAAGEVGQKA----KEKAGMAEEEQKRKMVDDFAQVHLAESP 225
           AFN            +V                    +  +E K        +    +  
Sbjct: 261 AFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK----SLLLKY--LDCR 314

Query: 226 KTSSPSGHQPSKTEPAQGLVL 246
               P   +   T P     L
Sbjct: 315 PQDLP--REVLTTNP---RRL 330


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.81
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 95.77
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 95.73
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 95.42
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 95.37
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 95.36
3p5t_L90 Cleavage and polyadenylation specificity factor S; 95.25
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 95.11
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 94.95
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 94.93
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 94.93
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 94.87
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 94.86
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 94.84
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 94.83
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 94.78
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 94.77
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 94.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 94.74
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 94.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 94.69
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 94.59
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 94.59
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 94.59
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 94.59
2krb_A81 Eukaryotic translation initiation factor 3 subunit 94.59
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 94.57
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 94.51
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 94.5
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 94.48
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 94.47
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 94.37
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 94.36
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 94.35
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 94.31
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 94.29
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 94.26
2la6_A99 RNA-binding protein FUS; structural genomics, nort 94.23
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 94.18
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 94.17
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 94.16
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 94.15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 94.14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 94.13
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 94.06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 94.05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 94.04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 93.99
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 93.98
2kt5_A124 RNA and export factor-binding protein 2; chaperone 93.96
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 93.91
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 93.89
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 93.84
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 93.83
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 93.81
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 93.81
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 93.8
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 93.79
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 93.76
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 93.74
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 93.72
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 93.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 93.68
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 93.67
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 93.66
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 93.63
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 93.58
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 93.57
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 93.54
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 93.51
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 93.45
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 93.42
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 93.39
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 93.37
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 93.3
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 93.28
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 93.27
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 93.27
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 93.21
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 93.2
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 93.18
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 93.17
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 93.14
1x5p_A97 Negative elongation factor E; structure genomics, 93.12
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 93.04
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 93.0
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 92.98
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 92.95
2cpj_A99 Non-POU domain-containing octamer-binding protein; 92.94
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 92.86
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 92.79
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 92.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 92.76
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 92.71
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 92.69
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 92.69
2div_A99 TRNA selenocysteine associated protein; structural 92.57
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 92.44
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 92.38
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 92.37
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 92.29
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 92.28
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 92.24
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 92.2
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 92.2
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 92.07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 91.9
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 91.79
2cph_A107 RNA binding motif protein 19; RNA recognition moti 91.65
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 91.3
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 91.27
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 91.22
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 91.12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 91.09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 91.04
2dit_A112 HIV TAT specific factor 1 variant; structural geno 90.93
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 90.83
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 90.72
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 90.67
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 90.56
2cqd_A116 RNA-binding region containing protein 1; RNA recog 90.53
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 90.52
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 90.5
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 90.35
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 90.31
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 90.12
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 90.03
2dis_A109 Unnamed protein product; structural genomics, RRM 89.94
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 89.94
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 89.93
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 89.6
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 89.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 89.49
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 89.44
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 88.97
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 89.35
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 89.3
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 89.27
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 89.18
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 89.15
1x4e_A85 RNA binding motif, single-stranded interacting pro 89.13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 89.03
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 89.0
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 88.93
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 88.21
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 88.19
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 88.05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 87.61
3n9u_C156 Cleavage and polyadenylation specificity factor S; 87.49
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 87.41
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 87.25
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 86.57
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 86.49
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 86.09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 85.11
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 84.26
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 83.74
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 83.62
1x5o_A114 RNA binding motif, single-stranded interacting pro 83.54
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 83.32
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 80.62
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 80.52
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 80.04
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
Probab=95.81  E-value=0.014  Score=43.42  Aligned_cols=43  Identities=16%  Similarity=0.254  Sum_probs=35.5

Q ss_pred             CCCCCc-eEEEEEEeccchhhHHhh-ccCCeecCc-eEEEecCCCC
Q 025931            3 SDNEWT-QIAYVTFKDMQGAETAVL-LSGATIVDL-SVSISLAPDY   45 (246)
Q Consensus         3 ~~~e~s-qtA~VTFe~~~Aa~TALL-LsGAtL~d~-~V~It~~~~~   45 (246)
                      +..+.+ ..|+|+|+++..++.|+- |+|..|.|. .|.|..+.+.
T Consensus        55 ~~~g~~~G~afV~f~~~~~A~~Ai~~l~g~~~~g~~~l~V~~a~~~  100 (105)
T 2nlw_A           55 EEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDF  100 (105)
T ss_dssp             CBTTBSCCEEEEEECSSSHHHHHHHHCSSEECSTTCEEEEECSCCC
T ss_pred             CCCCCeeeEEEEEECCHHHHHHHHHHhCCcccCCCceEEEEEcchH
Confidence            334443 489999999999999998 899999998 9999876544



>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.07
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.59
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.66
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 95.54
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 95.46
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 95.44
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 95.38
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 95.33
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 95.25
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 95.19
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 95.18
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 95.12
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 95.07
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 95.05
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 95.02
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 95.02
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 94.88
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.85
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 94.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 94.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 94.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 94.76
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 94.67
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 94.53
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 94.41
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 94.2
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 94.15
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 94.12
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 94.01
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 94.01
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 93.97
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 93.96
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 93.96
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 93.96
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 93.82
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 93.77
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 93.76
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 93.76
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 93.64
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 93.54
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 93.43
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 93.24
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 93.24
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 93.17
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 92.99
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 92.93
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 92.91
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 92.75
d2cpja186 Non-POU domain-containing octamer-binding protein, 92.73
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 92.47
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 92.43
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 92.1
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 91.84
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 91.72
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 91.51
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 91.38
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 91.38
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 91.2
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 91.17
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 91.15
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 90.96
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 90.88
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 90.75
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 90.74
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.27
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 90.24
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 89.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 88.54
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 87.66
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 87.34
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 86.86
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 85.59
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 85.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 84.08
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 82.94
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 82.4
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 81.48
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: U4/U6 snRNA-associated-splicing factor PRP24
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=97.07  E-value=0.00021  Score=49.79  Aligned_cols=39  Identities=15%  Similarity=0.133  Sum_probs=34.8

Q ss_pred             CCCCceEEEEEEeccchhhHHhhccCCeecCceEEEecC
Q 025931            4 DNEWTQIAYVTFKDMQGAETAVLLSGATIVDLSVSISLA   42 (246)
Q Consensus         4 ~~e~sqtA~VTFe~~~Aa~TALLLsGAtL~d~~V~It~~   42 (246)
                      .++..+.|+|+|+++.+++.||.|+|..|+|+.|.|...
T Consensus        36 ~~~~~~~afV~F~~~~~a~~Al~~~~~~i~g~~i~V~~~   74 (75)
T d2ghpa2          36 LKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHL   74 (75)
T ss_dssp             TTSSSEEEEEEESSHHHHHHHHTTTTCEETTEECEEEEC
T ss_pred             ccccceEEEEEEcchHHhHHHHHhcCcEECCEEEEEEEC
Confidence            345567999999999999999999999999999999754



>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure