Citrus Sinensis ID: 025964
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 245 | ||||||
| 255577277 | 332 | Triose phosphate/phosphate translocator, | 0.979 | 0.722 | 0.901 | 1e-121 | |
| 449460064 | 338 | PREDICTED: probable sugar phosphate/phos | 0.991 | 0.718 | 0.864 | 1e-119 | |
| 225470902 | 337 | PREDICTED: probable sugar phosphate/phos | 0.946 | 0.688 | 0.892 | 1e-117 | |
| 356525833 | 333 | PREDICTED: probable sugar phosphate/phos | 0.979 | 0.720 | 0.852 | 1e-115 | |
| 356556928 | 333 | PREDICTED: probable sugar phosphate/phos | 0.979 | 0.720 | 0.852 | 1e-114 | |
| 147805383 | 294 | hypothetical protein VITISV_024311 [Viti | 0.918 | 0.765 | 0.857 | 1e-109 | |
| 297834322 | 339 | hypothetical protein ARALYDRAFT_897714 [ | 0.995 | 0.719 | 0.821 | 1e-106 | |
| 18400381 | 340 | Nucleotide/sugar transporter family prot | 0.995 | 0.717 | 0.814 | 1e-105 | |
| 9279588 | 339 | phosphate/phosphoenolpyruvate translocat | 0.995 | 0.719 | 0.814 | 1e-105 | |
| 227206412 | 248 | AT3G14410 [Arabidopsis thaliana] | 0.995 | 0.983 | 0.810 | 1e-104 |
| >gi|255577277|ref|XP_002529520.1| Triose phosphate/phosphate translocator, chloroplast precursor, putative [Ricinus communis] gi|223531004|gb|EEF32858.1| Triose phosphate/phosphate translocator, chloroplast precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 438 bits (1127), Expect = e-121, Method: Compositional matrix adjust.
Identities = 220/244 (90%), Positives = 230/244 (94%), Gaps = 4/244 (1%)
Query: 1 MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEVMSCRMLLIMSVISFGVV 60
MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEVMSCRMLLIMSVISFGV+
Sbjct: 89 MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEVMSCRMLLIMSVISFGVL 148
Query: 61 VASYGEININWIGVVYQMGGVVGEALRLIFMEILVKRKGLKLNPISVMYYVSPCSALCLF 120
VASYGEININWIGVVYQMGGVVGEALRLIFMEILVKRKGLKLNPIS+MYYVSPCSALCLF
Sbjct: 149 VASYGEININWIGVVYQMGGVVGEALRLIFMEILVKRKGLKLNPISMMYYVSPCSALCLF 208
Query: 121 IPWIFLEKPKMDALETWHFPPLMLTLNCLCTFALNLSVFLVISHTSALTIRVAGVVKDWV 180
IPWIFLEKPKM+A W+FPPL+LTLN LCTFALNLSVFLVISHTSALTIRVAGVVKDWV
Sbjct: 209 IPWIFLEKPKMEA-HAWNFPPLVLTLNSLCTFALNLSVFLVISHTSALTIRVAGVVKDWV 267
Query: 181 VVLFSALLFADTKLTIINLFGYGIAIAGVAAYNNHKLKKEASRAISDDSQQTQ---LTAT 237
VVL SALLFADTKLT+INLFGYGIAIAGVAAYNNHKL KEASR SD++Q + LTAT
Sbjct: 268 VVLLSALLFADTKLTVINLFGYGIAIAGVAAYNNHKLVKEASRRSSDEAQSVESVPLTAT 327
Query: 238 TTSS 241
T S+
Sbjct: 328 TNSN 331
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449460064|ref|XP_004147766.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410-like [Cucumis sativus] gi|449519158|ref|XP_004166602.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225470902|ref|XP_002263478.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410 [Vitis vinifera] gi|297745469|emb|CBI40549.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525833|ref|XP_003531526.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356556928|ref|XP_003546772.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147805383|emb|CAN71953.1| hypothetical protein VITISV_024311 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297834322|ref|XP_002885043.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] gi|297330883|gb|EFH61302.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18400381|ref|NP_566487.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] gi|75165421|sp|Q94EI9.1|PT314_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator At3g14410 gi|15294190|gb|AAK95272.1|AF410286_1 AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|20147279|gb|AAM10353.1| AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|332641993|gb|AEE75514.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9279588|dbj|BAB01046.1| phosphate/phosphoenolpyruvate translocator protein-like [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|227206412|dbj|BAH57261.1| AT3G14410 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 245 | ||||||
| TAIR|locus:2090995 | 340 | AT3G14410 [Arabidopsis thalian | 0.918 | 0.661 | 0.835 | 1.4e-96 | |
| TAIR|locus:2024827 | 332 | AT1G53660 [Arabidopsis thalian | 0.893 | 0.659 | 0.779 | 1.6e-88 | |
| TAIR|locus:2007745 | 367 | AT1G48230 [Arabidopsis thalian | 0.804 | 0.536 | 0.505 | 3.5e-52 | |
| TAIR|locus:2093596 | 375 | AT3G17430 [Arabidopsis thalian | 0.804 | 0.525 | 0.5 | 3.1e-51 | |
| TAIR|locus:2145487 | 349 | AT5G25400 [Arabidopsis thalian | 0.906 | 0.636 | 0.458 | 1.1e-48 | |
| TAIR|locus:2127841 | 350 | AT4G32390 [Arabidopsis thalian | 0.885 | 0.62 | 0.454 | 1.4e-48 | |
| TAIR|locus:2147957 | 351 | AT5G11230 [Arabidopsis thalian | 0.885 | 0.618 | 0.463 | 1.8e-48 | |
| TAIR|locus:2040040 | 347 | AT2G25520 [Arabidopsis thalian | 0.885 | 0.625 | 0.454 | 3.7e-48 | |
| ASPGD|ASPL0000040742 | 400 | ugtA [Emericella nidulans (tax | 0.808 | 0.495 | 0.361 | 5.4e-31 | |
| TAIR|locus:2076239 | 355 | AT3G10290 [Arabidopsis thalian | 0.8 | 0.552 | 0.307 | 3.6e-18 |
| TAIR|locus:2090995 AT3G14410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 960 (343.0 bits), Expect = 1.4e-96, P = 1.4e-96
Identities = 188/225 (83%), Positives = 203/225 (90%)
Query: 1 MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEVMSCRMLLIMSVISFGVV 60
MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLE+MSCRMLLIMS+ISFGV+
Sbjct: 93 MFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEMMSCRMLLIMSIISFGVL 152
Query: 61 VASYGEININWIGVVYQMGGVVGEALRLIFMEILVKRKGLKLNPISVMYYVSPCSALCLF 120
VASYGE+NINWIGVVYQMGGVVGEALRLIFME+LVKRKG+KLNPIS+MYYVSPCSA+CLF
Sbjct: 153 VASYGELNINWIGVVYQMGGVVGEALRLIFMELLVKRKGIKLNPISLMYYVSPCSAICLF 212
Query: 121 IPWIFLEKPKMDALETWHFPPLMLTLNCLCTFALNLSVFLVISHTSALTIRVAGVVKDWV 180
+PWIFLEK K+D W+F ++LTLN LCTFALNLSVFLVISHTSALTIRVAGVVKDWV
Sbjct: 213 VPWIFLEKSKIDGNGPWNFHFVVLTLNSLCTFALNLSVFLVISHTSALTIRVAGVVKDWV 272
Query: 181 VVLFSALLFADTKLTIINLFXXXXXXXXXXXXNNHKLKKEASRAI 225
VVL SALLFADTKLTIINLF NNHKLKKEAS+ +
Sbjct: 273 VVLVSALLFADTKLTIINLFGYAIAIAGVAAYNNHKLKKEASKVV 317
|
|
| TAIR|locus:2024827 AT1G53660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007745 AT1G48230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093596 AT3G17430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145487 AT5G25400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127841 AT4G32390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147957 AT5G11230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040040 AT2G25520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040742 ugtA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076239 AT3G10290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 245 | |||
| pfam03151 | 149 | pfam03151, TPT, Triose-phosphate Transporter famil | 5e-31 | |
| TIGR00817 | 302 | TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate | 7e-14 | |
| PTZ00343 | 350 | PTZ00343, PTZ00343, triose or hexose phosphate/pho | 2e-09 |
| >gnl|CDD|217390 pfam03151, TPT, Triose-phosphate Transporter family | Back alignment and domain information |
|---|
Score = 111 bits (280), Expect = 5e-31
Identities = 52/150 (34%), Positives = 78/150 (52%), Gaps = 9/150 (6%)
Query: 73 GVVYQMGGVVGEALRLIFME-ILVKRKGLKLNPISVMYYVSPCSALCLFIPWIFLEKPKM 131
G + + ALRLI + +L K+KG KLN + ++YY+SP + + L +F E K+
Sbjct: 1 GFILALAASALFALRLILSQKLLKKKKGTKLNVLELLYYLSPVAFIVLLPGLLFSEGFKL 60
Query: 132 DALE-------TWHFPPLMLTLNCLCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLF 184
L+L L+ + F NLS F ++ TS LT VAG VK VV++
Sbjct: 61 GKFILKFFGDLKTSRYVLLLLLSGVLAFLYNLSAFGLLGRTSPLTSSVAGTVKRVVVIVL 120
Query: 185 SALLFADTKLTIINLFGYGIAIAGVAAYNN 214
S ++F D +T +N+ G IAI GV Y+
Sbjct: 121 SVIIFGD-PVTFLNILGLAIAILGVVLYSY 149
|
This family includes transporters with a specificity for triose phosphate. Length = 149 |
| >gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 245 | |||
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 99.97 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 99.96 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 99.96 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.95 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 99.93 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 99.93 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 99.93 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 99.92 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.92 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 99.92 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 99.91 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 99.89 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 99.88 | |
| KOG1443 | 349 | consensus Predicted integral membrane protein [Fun | 99.87 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 99.83 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 99.81 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 99.78 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 99.77 | |
| KOG1442 | 347 | consensus GDP-fucose transporter [Carbohydrate tra | 99.75 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 99.75 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 99.73 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 99.72 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 99.71 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 99.71 | |
| KOG1583 | 330 | consensus UDP-N-acetylglucosamine transporter [Car | 99.68 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 99.67 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 99.66 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 99.66 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 99.63 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 99.63 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 99.59 | |
| KOG1582 | 367 | consensus UDP-galactose transporter related protei | 99.56 | |
| KOG2766 | 336 | consensus Predicted membrane protein [Function unk | 99.48 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 99.38 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 99.32 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 99.28 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.05 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 99.05 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 99.05 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 98.96 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.94 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 98.88 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.74 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 98.59 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.52 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 98.47 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 98.46 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 98.44 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 98.44 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.43 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 98.39 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.36 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 98.32 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 98.26 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 98.25 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 98.21 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 98.2 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.14 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 98.1 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 98.09 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 98.09 | |
| PF04657 | 138 | DUF606: Protein of unknown function, DUF606; Inter | 98.03 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 98.03 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 97.86 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.72 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 97.6 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 97.57 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 97.56 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.53 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 97.5 | |
| COG3238 | 150 | Uncharacterized protein conserved in bacteria [Fun | 97.45 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 97.41 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.39 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.36 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.3 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 97.23 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 97.18 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.16 | |
| PF07857 | 254 | DUF1632: CEO family (DUF1632); InterPro: IPR012435 | 97.14 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 97.11 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 97.02 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 96.96 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 96.96 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 96.94 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 96.62 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 96.58 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 96.37 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 96.25 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 96.0 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 95.85 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 95.8 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 95.27 | |
| PF06379 | 344 | RhaT: L-rhamnose-proton symport protein (RhaT); In | 94.79 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 94.43 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 94.38 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 93.33 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 92.81 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 91.57 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 89.54 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 89.13 | |
| PRK02237 | 109 | hypothetical protein; Provisional | 88.25 | |
| PF02694 | 107 | UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; | 86.34 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 84.62 | |
| PF02694 | 107 | UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; | 83.15 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 82.12 | |
| PRK02237 | 109 | hypothetical protein; Provisional | 81.71 | |
| COG1742 | 109 | Uncharacterized conserved protein [Function unknow | 80.04 |
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
Probab=99.97 E-value=1e-29 Score=213.99 Aligned_cols=212 Identities=25% Similarity=0.307 Sum_probs=175.7
Q ss_pred chhhhhhhhhhhhccchhHHHHHHHHHHHHHHHHHHHHcccccchhhHHHHHHhhhhceeeeeccccchHHHHHHHHHHH
Q 025964 2 FAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEVMSCRMLLIMSVISFGVVVASYGEININWIGVVYQMGGV 81 (245)
Q Consensus 2 ~~~~~~~~~~al~~~~~~~~~v~~~~~pi~~~~~~~~~~~e~~~~~~~~~~~~~~~Gv~l~~~~~~~~~~~G~~~~l~~~ 81 (245)
++.+..+.|++++|++++++++++++.|+++++++++++|||++++++.+++++++|+.+...++.+.+..|++++++++
T Consensus 75 ~~~~~~~~~~~l~~~s~s~~~li~~~~Pv~~~ll~~~~~~e~~~~~~~~~l~l~~~Gv~l~~~~~~~~~~~G~~~~l~a~ 154 (302)
T TIGR00817 75 HTIGHVTSNVSLSKVAVSFTHTIKAMEPFFSVVLSAFFLGQEFPSTLWLSLLPIVGGVALASDTELSFNWAGFLSAMISN 154 (302)
T ss_pred HHHHHHHHHHHHHhccHHHHHHHHhcchHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHhhhcCCcccccHHHHHHHHHHH
Confidence 35677899999999999999999999999999999999999999999999999999998877666667788999999999
Q ss_pred HHHHHHHHHHHHHhhhcCCCCCHHHHHHHHhHHHHHHHHHHHHhhcccccccc--cc----ccc-chH-HHHHHHH-HHH
Q 025964 82 VGEALRLIFMEILVKRKGLKLNPISVMYYVSPCSALCLFIPWIFLEKPKMDAL--ET----WHF-PPL-MLTLNCL-CTF 152 (245)
Q Consensus 82 ~~~a~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~--~~----~~~-~~~-~~~~~~~-~~~ 152 (245)
++||++.++.|+..+++ +.|+.+.+.|+...+++.+.|.....|++..... .. +.. ..+ .....+. +..
T Consensus 155 ~~~a~~~v~~k~~~~~~--~~~~~~~~~~~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 232 (302)
T TIGR00817 155 ITFVSRNIFSKKAMTIK--SLDKTNLYAYISIMSLFLLSPPAFITEGPPFLPHGFMQAISGVNVTKIYTVSLVAAMGFFH 232 (302)
T ss_pred HHHHHHHHHHHHhhccC--CCCcccHHHHHHHHHHHHHHHHHHHHcchHHHHHHHHHhhcccCchHHHHHHHHHHHHHHH
Confidence 99999999999987632 4789999999999999998888766554322110 00 111 112 1323333 333
Q ss_pred HHHHHHHHHHhhchhHHHHHHhhhhhhhhhhhhhhhccccccchhhhhhHHHHHHHHHHhhccc
Q 025964 153 ALNLSVFLVISHTSALTIRVAGVVKDWVVVLFSALLFADTKLTIINLFGYGIAIAGVAAYNNHK 216 (245)
Q Consensus 153 ~~~~~~~~~i~~~~a~~~~~~~~~~pv~~~~~~~~~~~e~~~~~~~~~G~~li~~gi~l~~~~~ 216 (245)
..+..++.++++++|.++++.++++|++++++|++++||+ +++.+++|+.+++.|+.+|++.|
T Consensus 233 ~~~~~~~~~l~~~sa~t~sv~~~l~pv~~~~~~~~~lge~-lt~~~~~G~~lil~Gv~l~~~~k 295 (302)
T TIGR00817 233 FYQQVAFMLLGRVSPLTHSVGNCMKRVVVIVVSILFFGTK-ISPQQVFGTGIAIAGVFLYSRVK 295 (302)
T ss_pred HHHHHHHHHHccCCchHHHHHhhhhhhheeeeehhhcCCC-CchhHHHHHHHHHHHHHHHHHHh
Confidence 3455677899999999999999999999999999999999 99999999999999999998654
|
specificities overlap. |
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >KOG1443 consensus Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >KOG1442 consensus GDP-fucose transporter [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2766 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >COG3238 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PF07857 DUF1632: CEO family (DUF1632); InterPro: IPR012435 These sequences are found in hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF06379 RhaT: L-rhamnose-proton symport protein (RhaT); InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK02237 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02694 UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; InterPro: IPR003844 This entry describes integral membrane proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02694 UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; InterPro: IPR003844 This entry describes integral membrane proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02237 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1742 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 245 | |||
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 98.8 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.46 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.38 | |
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 98.34 |
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Probab=98.80 E-value=5.9e-09 Score=76.07 Aligned_cols=67 Identities=18% Similarity=0.127 Sum_probs=46.8
Q ss_pred HHHHHHHHHHHHHHhhchhHHHHHH-hhhhhhhhhhhhhhhccccccchhhhhhHHHHHHHHHHhhccc
Q 025964 149 LCTFALNLSVFLVISHTSALTIRVA-GVVKDWVVVLFSALLFADTKLTIINLFGYGIAIAGVAAYNNHK 216 (245)
Q Consensus 149 ~~~~~~~~~~~~~i~~~~a~~~~~~-~~~~pv~~~~~~~~~~~e~~~~~~~~~G~~li~~gi~l~~~~~ 216 (245)
++.....+++..++++.++..+..+ ..+.|+++.++|+++|||+ +++.+++|+.+++.|+.+.+..+
T Consensus 38 ~~~~ls~~l~~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~-ls~~~~~Gi~LIi~GV~ll~~~~ 105 (137)
T 2i68_A 38 ICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQR-LDLPAIIGMMLICAGVLIINLLS 105 (137)
T ss_dssp HHHHHHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC-------CHHHHHHHHHHHHHHHHC-
T ss_pred HHHHHHHHHHHHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCC-CCHHHHHHHHHHHHHHHHHhcCC
Confidence 3344445567788999999988887 8999999999999999999 99999999999999999987654
|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00