Citrus Sinensis ID: 026108


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MRVSLTRACRFYTSPITPKPSFFSPRAILNQPFSSSSSSSSHSSTPKPKTPLFLKPPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHccHHHHHHHHHHHHHcccccHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHc
ccEEcccccccccccccccccccccccEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHHHHHHccccccHHHHHcccccHcccccHHHHHHHHHHHHHHccccHHHHEcccHHccccEEEcccEEccccHHHHHHHHHHHHHcccccccccccEEEccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHc
MRVSLTRAcrfytspitpkpsffsprailnqpfsssssssshsstpkpktplflkppkysatlsDLKKWHNWAKALASSVRstfadsdngpdssilFRELNWLvedsledpslipqlgfqnnsqSVRLRIGLDELYGLWKQRiekrkpfqylvGCEHWRDLVLSVeegvfiprpetELMVDLVSDVLvrdndglrdgfwvdlgtgsgAIAIGIARVLgskgsiiavDLNPLAAAVAAFNAQRI
mrvsltracrfytspitpkpsffsPRAILNQPfsssssssshsstpkpktplflkpPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLipqlgfqnnsqsVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
MRVSLTRACRFYTSPITPKPSFFSPRAILNQPFsssssssshsstpkpktplflkppkYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTgsgaiaigiaRVLGSKGSIIavdlnplaaavaafnaQRI
*******ACRFYT***********************************************ATLSDLKKWHNWAKALASS**************SILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAF*****
***************************************************LFLKPPKYSATLSDLKKWHNWAKALASSV*************SILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
MRVSLTRACRFYTSPITPKPSFFSPRAILNQ******************TPLFLKPPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
***SLTRACRFYTSPITPKPSFFSPRAILNQPF**********STPKPKTPLFLKPPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVSLTRACRFYTSPITPKPSFFSPRAILNQPFSSSSSSSSHSSTPKPKTPLFLKPPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q7NJS7 286 Release factor glutamine yes no 0.551 0.468 0.416 6e-19
Q8DHV7 291 Release factor glutamine yes no 0.658 0.549 0.350 1e-18
P74003 299 Release factor glutamine N/A no 0.576 0.468 0.388 9e-18
Q9CHX0 270 Release factor glutamine yes no 0.390 0.351 0.415 1e-11
A9WBM9 283 Release factor glutamine yes no 0.407 0.349 0.441 1e-10
Q9KQ26 286 Release factor glutamine yes no 0.374 0.318 0.391 1e-09
B8E004 282 Release factor glutamine yes no 0.362 0.312 0.360 2e-09
A6H162 285 Release factor glutamine yes no 0.386 0.329 0.362 3e-09
P45873 288 Release factor glutamine yes no 0.452 0.381 0.394 5e-09
Q8R619 354 Release factor glutamine yes no 0.382 0.262 0.377 5e-09
>sp|Q7NJS7|PRMC_GLOVI Release factor glutamine methyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=prmC PE=3 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 82/144 (56%), Gaps = 10/144 (6%)

Query: 99  ELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHW 158
           E+++L+E       L  +LG     ++ R     ++L  LW++RIE+  P QYL+G  HW
Sbjct: 25  EIDYLIEAVTGLDRLRVRLGGPQALEAHR-----EKLAALWRRRIEEAMPLQYLLGTAHW 79

Query: 159 RDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLG 218
           RDL L V   V IPRPE+E +VD+  D   R   G R    VDLGTGSGAIA+ +AR L 
Sbjct: 80  RDLQLQVNPAVLIPRPESEALVDVAVD-FCRSCAGARV---VDLGTGSGAIAVAVARAL- 134

Query: 219 SKGSIIAVDLNPLAAAVAAFNAQR 242
              ++ AVD +  A  VA  N +R
Sbjct: 135 PGATVWAVDASEAALVVAGANIER 158




Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif.
Gloeobacter violaceus (strain PCC 7421) (taxid: 251221)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 1EC: 6
>sp|Q8DHV7|PRMC_THEEB Release factor glutamine methyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|P74003|PRMC_SYNY3 Release factor glutamine methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|Q9CHX0|PRMC_LACLA Release factor glutamine methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|A9WBM9|PRMC_CHLAA Release factor glutamine methyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|Q9KQ26|PRMC_VIBCH Release factor glutamine methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|B8E004|PRMC_DICTD Release factor glutamine methyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|A6H162|PRMC_FLAPJ Release factor glutamine methyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|P45873|PRMC_BACSU Release factor glutamine methyltransferase OS=Bacillus subtilis (strain 168) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|Q8R619|PRMC_FUSNN Release factor glutamine methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prmC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
255566573 354 n6-DNA-methyltransferase, putative [Rici 0.814 0.559 0.658 6e-73
449466616 360 PREDICTED: release factor glutamine meth 0.872 0.588 0.594 6e-72
363807000 364 uncharacterized protein LOC100796269 [Gl 0.962 0.642 0.585 1e-70
358348140 403 Protein hemK [Medicago truncatula] gi|35 0.794 0.478 0.639 3e-69
356525752 361 PREDICTED: protein methyltransferase hem 0.950 0.639 0.584 3e-69
224073134 360 predicted protein [Populus trichocarpa] 0.814 0.55 0.631 5e-68
147788825304 hypothetical protein VITISV_010350 [Viti 0.925 0.740 0.528 7e-64
225462209 356 PREDICTED: protein methyltransferase hem 0.934 0.637 0.537 8e-64
297797429 365 methylase family protein [Arabidopsis ly 0.851 0.567 0.578 4e-63
15237618 377 RNA methyltransferase family protein [Ar 0.851 0.549 0.573 5e-62
>gi|255566573|ref|XP_002524271.1| n6-DNA-methyltransferase, putative [Ricinus communis] gi|223536462|gb|EEF38110.1| n6-DNA-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 131/199 (65%), Positives = 162/199 (81%), Gaps = 1/199 (0%)

Query: 44  STPKPKTPLFLKPPKYSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWL 103
           S+ K + PLFL+PP YS +LS+L KW  WAK LASSV S+F + DNGPDS++L REL WL
Sbjct: 28  SSLKIQNPLFLRPPVYSTSLSELNKWQQWAKHLASSVGSSFVNLDNGPDSTLLCRELKWL 87

Query: 104 VEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVL 163
           +EDSLED SLIPQL  QNN ++V+LR  LDELY LW+QRIE+RKPFQY+VGCEHWRD VL
Sbjct: 88  IEDSLEDHSLIPQLCIQNNFRNVKLRASLDELYSLWRQRIEERKPFQYIVGCEHWRDFVL 147

Query: 164 SVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSI 223
           SV+EGV IPRPETEL++DLV    V +N+ L +G W DLGTGSGA+AIGIA++LG +G +
Sbjct: 148 SVQEGVLIPRPETELIIDLVKGA-VLNNEELSEGLWADLGTGSGALAIGIAKILGPQGRV 206

Query: 224 IAVDLNPLAAAVAAFNAQR 242
           IA DL+P+AA+VA +N QR
Sbjct: 207 IATDLSPVAASVATYNVQR 225




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449466616|ref|XP_004151022.1| PREDICTED: release factor glutamine methyltransferase-like [Cucumis sativus] gi|449526004|ref|XP_004170005.1| PREDICTED: release factor glutamine methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807000|ref|NP_001242318.1| uncharacterized protein LOC100796269 [Glycine max] gi|255645193|gb|ACU23094.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358348140|ref|XP_003638107.1| Protein hemK [Medicago truncatula] gi|355504042|gb|AES85245.1| Protein hemK [Medicago truncatula] Back     alignment and taxonomy information
>gi|356525752|ref|XP_003531487.1| PREDICTED: protein methyltransferase hemK homolog [Glycine max] Back     alignment and taxonomy information
>gi|224073134|ref|XP_002303988.1| predicted protein [Populus trichocarpa] gi|222841420|gb|EEE78967.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147788825|emb|CAN62344.1| hypothetical protein VITISV_010350 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462209|ref|XP_002269180.1| PREDICTED: protein methyltransferase hemK homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797429|ref|XP_002866599.1| methylase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312434|gb|EFH42858.1| methylase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237618|ref|NP_201220.1| RNA methyltransferase family protein [Arabidopsis thaliana] gi|10176963|dbj|BAB10283.1| unnamed protein product [Arabidopsis thaliana] gi|15451004|gb|AAK96773.1| Unknown protein [Arabidopsis thaliana] gi|30725624|gb|AAP37834.1| At5g64156 [Arabidopsis thaliana] gi|332010464|gb|AED97847.1| RNA methyltransferase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:2164396 377 AT5G64150 [Arabidopsis thalian 0.679 0.437 0.526 8.1e-44
TAIR|locus:2164396 AT5G64150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 8.1e-44, P = 8.1e-44
 Identities = 89/169 (52%), Positives = 120/169 (71%)

Query:    59 YSATLSDLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSL-EDPSLIPQL 117
             ++ +LS++ KWH+WAK LASSV  +  +S++  DS IL REL WL+EDS+ +DP +I   
Sbjct:    62 HATSLSEVWKWHDWAKDLASSVEESSKNSEDTLDSVILHRELKWLIEDSIVDDPLVILHR 121

Query:   118 G--FQNNSQSVRLRIGLDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPE 175
                  N  ++V+LR  L+ELY LW+QRIEKR+PFQY+VGCEHWRDLVL VEEGV IPRPE
Sbjct:   122 SEIADNGEKNVKLRASLEELYDLWRQRIEKRRPFQYVVGCEHWRDLVLCVEEGVLIPRPE 181

Query:   176 TELMVDLVSDVLVRDNDGLRDGFWVDLGTXXXXXXXXXXRVLGSKGSII 224
             TEL+VD+V +++ RD +  +   W DLGT          +VLGS+G +I
Sbjct:   182 TELIVDMVEELVTRD-EWFKKDIWADLGTGSGAIAIGIAKVLGSRGRVI 229


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.321   0.138   0.428    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      243       192   0.00096  110 3  11 22  0.44    32
                                                     31  0.43    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  609 (65 KB)
  Total size of DFA:  179 KB (2102 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  15.61u 0.14s 15.75t   Elapsed:  00:00:02
  Total cpu time:  15.61u 0.14s 15.75t   Elapsed:  00:00:02
  Start:  Thu May  9 21:22:28 2013   End:  Thu May  9 21:22:30 2013


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=ISS
GO:0006479 "protein methylation" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008276 "protein methyltransferase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0032259 "methylation" evidence=IEA
GO:0006783 "heme biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
PRK09328 275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 6e-29
TIGR03534 251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 3e-25
COG2890 280 COG2890, HemK, Methylase of polypeptide chain rele 3e-24
TIGR00536 284 TIGR00536, hemK_fam, HemK family putative methylas 1e-23
TIGR03533 284 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) m 5e-12
PRK11805 307 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-meth 3e-10
TIGR03704 251 TIGR03704, PrmC_rel_meth, putative protein-(glutam 4e-07
PRK14966 423 PRK14966, PRK14966, unknown domain/N5-glutamine S- 3e-06
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 1e-05
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 2e-05
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-05
COG2242 187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 4e-05
PRK01544 506 PRK01544, PRK01544, bifunctional N5-glutamine S-ad 4e-05
PRK14967 223 PRK14967, PRK14967, putative methyltransferase; Pr 1e-04
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 2e-04
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 3e-04
PRK14968 188 PRK14968, PRK14968, putative methyltransferase; Pr 3e-04
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 8e-04
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 0.002
COG2263 198 COG2263, COG2263, Predicted RNA methylase [Transla 0.004
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
 Score =  109 bits (275), Expect = 6e-29
 Identities = 43/111 (38%), Positives = 61/111 (54%), Gaps = 6/111 (5%)

Query: 132 LDELYGLWKQRIEKRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDN 191
           L+    L  +R    +P QY++G   +  L   V  GV IPRPETE +V+   + L    
Sbjct: 50  LERFRALVARRA-AGEPLQYILGEAEFWGLDFKVSPGVLIPRPETEELVEWALEAL-LLK 107

Query: 192 DGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQR 242
           + LR    +DLGTGSGAIA+ +A+       + AVD++P A AVA  NA+ 
Sbjct: 108 EPLR---VLDLGTGSGAIALALAKERPDA-EVTAVDISPEALAVARRNAKH 154


Length = 275

>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|234247 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>gnl|CDD|236988 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234318 TIGR03704, PrmC_rel_meth, putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>gnl|CDD|184930 PRK14966, PRK14966, unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234958 PRK01544, PRK01544, bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.96
COG2890 280 HemK Methylase of polypeptide chain release factor 99.96
KOG2904 328 consensus Predicted methyltransferase [General fun 99.95
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.95
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.95
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 99.95
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.93
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.91
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.88
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.76
PLN02672 1082 methionine S-methyltransferase 99.68
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.39
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.34
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.29
PRK13168 443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.29
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.24
PLN02336 475 phosphoethanolamine N-methyltransferase 99.18
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 99.14
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.09
PRK14967 223 putative methyltransferase; Provisional 99.09
KOG2187 534 consensus tRNA uracil-5-methyltransferase and rela 99.08
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.07
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.0
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.0
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.99
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.99
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.99
TIGR00537 179 hemK_rel_arch HemK-related putative methylase. The 98.99
PLN02585 315 magnesium protoporphyrin IX methyltransferase 98.98
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.97
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.96
TIGR03587 204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.96
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.94
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.91
PF13847 152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.9
PRK08287 187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.9
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.89
COG2263 198 Predicted RNA methylase [Translation, ribosomal st 98.89
COG4123 248 Predicted O-methyltransferase [General function pr 98.85
PRK14968 188 putative methyltransferase; Provisional 98.85
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.84
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.83
PF05958 352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.81
PRK07402 196 precorrin-6B methylase; Provisional 98.81
TIGR02143 353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.8
PRK05031 362 tRNA (uracil-5-)-methyltransferase; Validated 98.8
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.77
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.77
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.76
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.72
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.7
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.68
TIGR00740 239 methyltransferase, putative. A simple BLAST search 98.67
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.65
KOG3191 209 consensus Predicted N6-DNA-methyltransferase [Tran 98.63
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 98.63
COG2242 187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.63
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.61
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.6
PLN02233 261 ubiquinone biosynthesis methyltransferase 98.59
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.59
PRK12335 287 tellurite resistance protein TehB; Provisional 98.59
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 98.58
TIGR00091 194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.56
PLN02490 340 MPBQ/MSBQ methyltransferase 98.56
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.55
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 98.53
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 98.53
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.53
PHA03411 279 putative methyltransferase; Provisional 98.53
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.53
PRK11207 197 tellurite resistance protein TehB; Provisional 98.52
PLN02781 234 Probable caffeoyl-CoA O-methyltransferase 98.5
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.48
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.48
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 98.47
PRK14902 444 16S rRNA methyltransferase B; Provisional 98.46
PRK08317 241 hypothetical protein; Provisional 98.45
PLN02244 340 tocopherol O-methyltransferase 98.43
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.43
TIGR03438 301 probable methyltransferase. This model represents 98.43
PHA03412 241 putative methyltransferase; Provisional 98.43
PRK06202 232 hypothetical protein; Provisional 98.41
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.41
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 98.41
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.41
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.4
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 98.39
smart00650 169 rADc Ribosomal RNA adenine dimethylases. 98.38
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.38
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 98.35
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 98.34
PRK15128 396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.34
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.34
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 98.33
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 98.31
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.31
PRK05785 226 hypothetical protein; Provisional 98.31
PRK04266 226 fibrillarin; Provisional 98.3
smart00138 264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.3
PRK10258 251 biotin biosynthesis protein BioC; Provisional 98.28
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.28
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.28
PRK14904 445 16S rRNA methyltransferase B; Provisional 98.27
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 98.25
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 98.25
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.25
PRK04148134 hypothetical protein; Provisional 98.24
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.23
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.23
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.22
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.22
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.21
TIGR01177 329 conserved hypothetical protein TIGR01177. This fam 98.21
PRK10901 427 16S rRNA methyltransferase B; Provisional 98.21
PF01596 205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.21
PRK13255 218 thiopurine S-methyltransferase; Reviewed 98.2
PRK06922 677 hypothetical protein; Provisional 98.2
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.19
PRK14903 431 16S rRNA methyltransferase B; Provisional 98.18
PLN02476 278 O-methyltransferase 98.18
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.18
COG2519 256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.17
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.16
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 98.16
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.15
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.14
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.14
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.13
KOG1271 227 consensus Methyltransferases [General function pre 98.11
PRK04457 262 spermidine synthase; Provisional 98.1
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.09
PRK14901 434 16S rRNA methyltransferase B; Provisional 98.08
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.07
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 98.03
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.02
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 98.01
TIGR00452 314 methyltransferase, putative. Known examples to dat 98.01
COG4122 219 Predicted O-methyltransferase [General function pr 97.96
PF10672 286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.96
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.95
PLN03075 296 nicotianamine synthase; Provisional 97.93
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.93
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 97.91
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.9
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.89
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.89
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.88
KOG1540 296 consensus Ubiquinone biosynthesis methyltransferas 97.87
PF13679141 Methyltransf_32: Methyltransferase domain 97.87
KOG2899 288 consensus Predicted methyltransferase [General fun 97.85
PTZ00146 293 fibrillarin; Provisional 97.79
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.79
PRK11188 209 rrmJ 23S rRNA methyltransferase J; Provisional 97.79
PLN02589 247 caffeoyl-CoA O-methyltransferase 97.78
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.76
COG2520 341 Predicted methyltransferase [General function pred 97.75
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.75
TIGR00438 188 rrmJ cell division protein FtsJ. 97.73
PLN02336 475 phosphoethanolamine N-methyltransferase 97.69
PRK00811 283 spermidine synthase; Provisional 97.68
PRK13256 226 thiopurine S-methyltransferase; Reviewed 97.67
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.65
COG1092 393 Predicted SAM-dependent methyltransferases [Genera 97.63
PF02390 195 Methyltransf_4: Putative methyltransferase ; Inter 97.59
PF05401 201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.56
TIGR00478 228 tly hemolysin TlyA family protein. Hemolysins are 97.53
COG3129 292 Predicted SAM-dependent methyltransferase [General 97.48
PLN02366 308 spermidine synthase 97.46
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 97.45
KOG3010 261 consensus Methyltransferase [General function pred 97.45
COG3897218 Predicted methyltransferase [General function pred 97.42
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.36
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.34
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 97.32
PRK03612 521 spermidine synthase; Provisional 97.31
PRK01581 374 speE spermidine synthase; Validated 97.25
PF05724 218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.25
COG1041 347 Predicted DNA modification methylase [DNA replicat 97.19
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.16
PF11599 246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 97.12
KOG2730 263 consensus Methylase [General function prediction o 97.1
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.94
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.88
KOG1661 237 consensus Protein-L-isoaspartate(D-aspartate) O-me 96.84
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 96.81
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 96.73
COG4076 252 Predicted RNA methylase [General function predicti 96.7
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 96.68
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.66
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 96.63
KOG2361 264 consensus Predicted methyltransferase [General fun 96.62
KOG1663 237 consensus O-methyltransferase [Secondary metabolit 96.62
KOG2912 419 consensus Predicted DNA methylase [Function unknow 96.62
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.57
COG0116 381 Predicted N6-adenine-specific DNA methylase [DNA r 96.51
KOG2915 314 consensus tRNA(1-methyladenosine) methyltransferas 96.5
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.36
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.32
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.31
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.23
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.22
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 96.19
PRK10742 250 putative methyltransferase; Provisional 96.17
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 96.12
PRK11524284 putative methyltransferase; Provisional 96.05
COG1352 268 CheR Methylase of chemotaxis methyl-accepting prot 95.96
PLN02823 336 spermine synthase 95.94
COG0357 215 GidB Predicted S-adenosylmethionine-dependent meth 95.92
PF01739 196 CheR: CheR methyltransferase, SAM binding domain; 95.89
PRK13699227 putative methylase; Provisional 95.82
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.67
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 95.64
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 95.58
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 95.54
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 95.52
COG2384 226 Predicted SAM-dependent methyltransferase [General 95.35
KOG4058199 consensus Uncharacterized conserved protein [Funct 95.29
PHA01634156 hypothetical protein 95.2
PF01728 181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 94.93
PRK10611 287 chemotaxis methyltransferase CheR; Provisional 94.93
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 94.54
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 94.39
PF06080 204 DUF938: Protein of unknown function (DUF938); Inte 94.38
COG2521 287 Predicted archaeal methyltransferase [General func 94.36
KOG1501 636 consensus Arginine N-methyltransferase [General fu 94.18
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 94.18
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 94.15
KOG3115 249 consensus Methyltransferase-like protein [General 94.06
KOG4300 252 consensus Predicted methyltransferase [General fun 93.86
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 93.86
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 93.85
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 93.81
PF12147 311 Methyltransf_20: Putative methyltransferase; Inter 93.79
PRK00536 262 speE spermidine synthase; Provisional 93.2
COG0286 489 HsdM Type I restriction-modification system methyl 92.88
PRK11760 357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 92.41
PF01564 246 Spermine_synth: Spermine/spermidine synthase; Inte 91.89
KOG1227 351 consensus Putative methyltransferase [General func 91.87
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 91.37
KOG2793 248 consensus Putative N2,N2-dimethylguanosine tRNA me 91.09
PF03059 276 NAS: Nicotianamine synthase protein; InterPro: IPR 91.05
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 90.98
KOG4589 232 consensus Cell division protein FtsJ [Cell cycle c 90.96
PF01269 229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 90.63
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 90.63
COG0293 205 FtsJ 23S rRNA methylase [Translation, ribosomal st 90.46
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 89.92
KOG2920 282 consensus Predicted methyltransferase [General fun 89.4
KOG2078 495 consensus tRNA modification enzyme [RNA processing 87.8
PRK10458 467 DNA cytosine methylase; Provisional 87.08
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 87.08
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 86.7
COG1565 370 Uncharacterized conserved protein [Function unknow 86.4
KOG3987 288 consensus Uncharacterized conserved protein DREV/C 86.19
PF02086 260 MethyltransfD12: D12 class N6 adenine-specific DNA 85.81
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 85.69
PF04672 267 Methyltransf_19: S-adenosyl methyltransferase; Int 85.64
PF05891 218 Methyltransf_PK: AdoMet dependent proline di-methy 85.43
COG1189 245 Predicted rRNA methylase [Translation, ribosomal s 83.1
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 82.75
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 82.44
KOG2940 325 consensus Predicted methyltransferase [General fun 82.37
KOG1122 460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 81.09
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 80.58
KOG3201 201 consensus Uncharacterized conserved protein [Funct 80.04
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
Probab=99.96  E-value=6e-29  Score=240.73  Aligned_cols=162  Identities=25%  Similarity=0.294  Sum_probs=132.3

Q ss_pred             HHHHHHHHHHHHhhhcCCccccCCCCCCCcccHHHHHHHHHhccCCCCCCcccccCCCccccccchhHHHHHHHHHhhhc
Q 026108           65 DLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIE  144 (243)
Q Consensus        65 ~l~~~~~~a~~~~~~~~~~~~~~~~~~d~~~~~~Ea~~Ll~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~R~~  144 (243)
                      ++.++++|+...+.++|+..           +..||+||+++++++++..+.+  +   .+..++.+..+.++.+.+||.
T Consensus         4 ~~~~~l~~~~~~l~~~g~~~-----------~~~~a~~Ll~~~l~~~~~~l~~--~---~~~~l~~~~~~~~~~~~~rr~   67 (506)
T PRK01544          4 SIKQILSDATDKLNKIGISS-----------PQLEARILLQHVINKPIEYLLI--N---LDEQLNEAEIEAFEKLLERRL   67 (506)
T ss_pred             cHHHHHHHHHHHHHHcCCCC-----------HHHHHHHHHHHHHCcCHHHHhh--c---cCCCCCHHHHHHHHHHHHHHH
Confidence            47788999999998777632           3569999999999998876542  1   123456666667777888999


Q ss_pred             CCCceeEEeeeccccccccccCCCcccCCccHHHHHHHHHHHhhhc------------------C--CCCCCCcEEEecc
Q 026108          145 KRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRD------------------N--DGLRDGFWVDLGT  204 (243)
Q Consensus       145 ~~~Pl~yi~g~~~f~~l~f~v~~~vliPRp~TElLv~~v~~~l~~~------------------~--~~~~~~rVLDLGt  204 (243)
                      +|+|+|||+|+++|+|++|.|+++|||||||||.|++.+++.+...                  .  ...++.+|||+||
T Consensus        68 ~~ePlqYI~G~~~F~g~~f~V~~~VLIPRpeTE~Lve~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLDlG~  147 (506)
T PRK01544         68 KHEPIAYITGVKEFYSREFIVNKHVLIPRSDTEVLVDVVFQCHSRESGNPEKKQLNPCFRGNDISSNCNDKFLNILELGT  147 (506)
T ss_pred             cCCCHHHHhCcCEEcCcEEEeCCCcccCCCcHHHHHHHHHHHhhhccccccccccccccccccccccccCCCCEEEEccC
Confidence            9999999999999999999999999999999999999998765210                  0  0112357999999


Q ss_pred             CCcHHHHHHHHHhCCCcEEEEEeCCHHHHHHHHHHHHhC
Q 026108          205 GSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQRI  243 (243)
Q Consensus       205 GSG~iai~LA~~~~p~a~V~avDiS~~AL~~Ar~Na~~~  243 (243)
                      |||++++.+++.+ ++++|+|+|+|+.|+++|++|++.+
T Consensus       148 GsG~iai~la~~~-p~~~v~avDis~~al~~A~~N~~~~  185 (506)
T PRK01544        148 GSGCIAISLLCEL-PNANVIATDISLDAIEVAKSNAIKY  185 (506)
T ss_pred             chhHHHHHHHHHC-CCCeEEEEECCHHHHHHHHHHHHHc
Confidence            9999999999986 7899999999999999999998753



>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2912 consensus Predicted DNA methylase [Function unknown] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 5e-23
2b3t_A 276 Protein methyltransferase HEMK; translation termin 3e-22
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 1e-21
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 6e-21
3q87_B 170 N6 adenine specific DNA methylase; SAM-methyltrans 4e-12
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 4e-09
3lpm_A 259 Putative methyltransferase; structural genomics, p 8e-08
2h00_A 254 Methyltransferase 10 domain containing protein; st 2e-07
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 2e-06
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 8e-06
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 9e-06
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 1e-05
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 2e-05
1ne2_A 200 Hypothetical protein TA1320; structural genomics, 2e-05
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 2e-05
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 2e-05
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 3e-05
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 4e-05
2yxd_A 183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 4e-05
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 5e-05
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 5e-05
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 6e-05
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 7e-05
3ocj_A 305 Putative exported protein; structural genomics, PS 8e-05
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-04
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 2e-04
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 3e-04
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 4e-04
3f4k_A 257 Putative methyltransferase; structural genomics, P 8e-04
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
 Score = 93.4 bits (233), Expect = 5e-23
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 141 QRIEKRKPFQYLVG-CEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFW 199
           ++     P  Y++G  E    L   VEEGVF+PRPETE +V+L  +++ R          
Sbjct: 73  EKRASGYPLHYILGEKEFM-GLSFLVEEGVFVPRPETEELVELALELI-RKYGIKT---V 127

Query: 200 VDLGTGSGAIAIGIARVLGSKGSIIAVDLNPLAAAVAAFNAQR 242
            D+GTGSGAI + +A+   +     A D++  A  +A  NA+R
Sbjct: 128 ADIGTGSGAIGVSVAKFSDAIV--FATDVSSKAVEIARKNAER 168


>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Length = 215 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Length = 254 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Length = 343 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 99.93
2b3t_A 276 Protein methyltransferase HEMK; translation termin 99.91
1uwv_A 433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.5
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 99.48
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 99.42
2h00_A 254 Methyltransferase 10 domain containing protein; st 99.41
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 99.37
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.3
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.29
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.29
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.28
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 99.23
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 99.16
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.13
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.13
2fpo_A 202 Methylase YHHF; structural genomics, putative meth 99.11
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.11
2pt6_A 321 Spermidine synthase; transferase, structural genom 99.11
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.09
2ift_A 201 Putative methylase HI0767; NESG, Y767_haein, struc 99.06
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.05
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.04
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.04
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.04
3q87_B 170 N6 adenine specific DNA methylase; SAM-methyltrans 99.01
3bt7_A 369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.98
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.98
3dmg_A 381 Probable ribosomal RNA small subunit methyltransf; 98.96
3a27_A 272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.94
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.94
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 98.93
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 98.92
3fzg_A 200 16S rRNA methylase; methyltransferase, plasmid, tr 98.91
2yxd_A 183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.9
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.88
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 98.87
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.86
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 98.85
3hm2_A 178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.85
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.85
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 98.84
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.84
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.84
3lpm_A 259 Putative methyltransferase; structural genomics, p 98.84
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.84
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 98.83
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 98.83
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.83
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 98.81
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.81
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 98.8
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.8
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 98.8
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 98.79
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 98.79
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 98.79
1g8a_A 227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.78
2frn_A 278 Hypothetical protein PH0793; structural genomics, 98.78
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.77
3k6r_A 278 Putative transferase PH0793; structural genomics, 98.76
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 98.75
4df3_A 233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.74
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 98.74
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 98.74
3c3p_A 210 Methyltransferase; NP_951602.1, structural genomic 98.73
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.73
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 98.73
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 98.72
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 98.72
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.72
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.72
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.72
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.71
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.71
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 98.7
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 98.7
1pjz_A 203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.7
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.7
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 98.7
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.7
3tma_A 354 Methyltransferase; thump domain; 2.05A {Thermus th 98.69
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.69
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.69
3f4k_A 257 Putative methyltransferase; structural genomics, P 98.68
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 98.67
2b25_A 336 Hypothetical protein; structural genomics, methyl 98.67
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.67
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 98.67
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 98.66
2ipx_A 233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.65
1nt2_A 210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.65
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.65
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 98.64
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 98.64
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.64
2bm8_A 236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.64
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 98.63
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.63
1ne2_A 200 Hypothetical protein TA1320; structural genomics, 98.63
2avd_A 229 Catechol-O-methyltransferase; structural genomics, 98.63
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 98.62
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 98.62
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.62
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.61
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 98.61
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 98.61
1af7_A 274 Chemotaxis receptor methyltransferase CHER; chemot 98.61
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 98.6
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.6
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 98.6
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.6
3cbg_A 232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.59
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.59
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 98.58
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 98.58
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.57
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.57
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.56
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.56
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.56
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.55
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 98.55
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 98.55
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.53
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 98.53
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 98.53
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 98.52
3tm4_A 373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.52
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.52
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.52
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 98.52
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.52
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.51
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 98.51
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 98.51
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 98.5
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.5
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.5
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.5
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.5
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 98.5
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.49
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 98.49
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.49
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 98.48
3lcv_B 281 Sisomicin-gentamicin resistance methylase SGM; ant 98.48
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 98.47
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.47
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.47
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.45
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 98.45
3id6_C 232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.45
3ldu_A 385 Putative methylase; structural genomics, PSI-2, pr 98.45
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.45
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.45
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 98.44
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.44
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.44
3k0b_A 393 Predicted N6-adenine-specific DNA methylase; methy 98.44
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.43
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.43
2o07_A 304 Spermidine synthase; structural genomics, structur 98.43
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 98.42
1xtp_A 254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.42
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 98.41
3ldg_A 384 Putative uncharacterized protein SMU.472; YPSC, me 98.41
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 98.4
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.4
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.4
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.4
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.39
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.39
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 98.39
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 98.39
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 98.38
3ocj_A 305 Putative exported protein; structural genomics, PS 98.38
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 98.38
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 98.37
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.37
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.37
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 98.37
3lcc_A 235 Putative methyl chloride transferase; halide methy 98.37
1xxl_A 239 YCGJ protein; structural genomics, protein structu 98.37
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 98.37
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.36
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.36
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 98.36
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 98.36
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.35
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 98.35
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.35
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.35
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.34
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.34
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.34
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.33
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 98.33
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.33
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 98.32
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 98.32
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.32
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 98.31
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 98.31
2qm3_A 373 Predicted methyltransferase; putative methyltransf 98.31
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.3
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 98.3
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 98.29
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.29
3frh_A 253 16S rRNA methylase; methyltransferase domain, heli 98.29
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 98.29
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 98.29
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 98.28
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 98.28
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 98.28
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 98.27
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.27
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 98.27
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.26
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.26
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.25
3cgg_A 195 SAM-dependent methyltransferase; NP_600671.1, meth 98.25
3i9f_A 170 Putative type 11 methyltransferase; structural gen 98.23
2zig_A297 TTHA0409, putative modification methylase; methylt 98.23
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.22
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 98.21
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.21
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.2
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.2
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 98.2
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 98.19
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.18
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 98.18
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 98.18
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.16
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 98.16
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.16
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.15
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.13
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 98.12
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.1
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.08
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 98.06
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 98.05
3cc8_A 230 Putative methyltransferase; structural genomics, j 98.04
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.04
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.04
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.04
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.03
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 98.01
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.99
1ej0_A 180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.99
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 97.98
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.98
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 97.95
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.91
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.86
3lkd_A 542 Type I restriction-modification system methyltrans 97.85
3khk_A 544 Type I restriction-modification system methylation 97.8
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.77
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 97.77
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.76
3dou_A 191 Ribosomal RNA large subunit methyltransferase J; c 97.75
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 97.71
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 97.62
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 97.62
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 97.61
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.49
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.39
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 97.37
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.28
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 97.28
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 97.22
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.21
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 97.17
3sso_A 419 Methyltransferase; macrolide, natural product, ros 97.09
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 97.07
2zfu_A 215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.05
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 96.93
3cvo_A 202 Methyltransferase-like protein of unknown functio; 96.69
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 96.65
3ufb_A 530 Type I restriction-modification system methyltran 96.61
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 96.56
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 96.37
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 96.36
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 96.14
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 96.13
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 95.6
2qy6_A 257 UPF0209 protein YFCK; structural genomics, unknown 95.0
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 94.87
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 94.32
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 93.81
2oo3_A 283 Protein involved in catabolism of external DNA; st 93.81
2wk1_A 282 NOVP; transferase, O-methyltransferase, novobiocin 93.37
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 93.3
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 93.01
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 92.21
3c6k_A 381 Spermine synthase; spermidine aminopropyltransfera 90.82
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 90.38
3me5_A 482 Cytosine-specific methyltransferase; structural ge 90.05
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 89.87
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 89.66
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 89.24
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 89.23
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.23
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 88.08
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 87.83
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 86.9
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 86.86
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 86.04
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 85.06
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 83.81
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 83.55
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 83.0
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 82.65
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 82.22
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 81.23
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 80.78
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 80.05
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
Probab=99.93  E-value=1e-25  Score=201.24  Aligned_cols=155  Identities=26%  Similarity=0.296  Sum_probs=125.1

Q ss_pred             HHHHHHHHHHHHhhhcCCccccCCCCCCCcccHHHHHHHHHhccCCCCCCcccccCCCccccccchhHHHHHHHHHhhhc
Q 026108           65 DLKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIE  144 (243)
Q Consensus        65 ~l~~~~~~a~~~~~~~~~~~~~~~~~~d~~~~~~Ea~~Ll~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~R~~  144 (243)
                      ++.+|++|+.+++.++ ..        +   +..|+++|+++++++++..+.+...   .+..++.   +.+..+.+||.
T Consensus        15 ~~~~~~~~~~~~l~~~-~~--------~---~~~~a~~ll~~~~~~~~~~l~~~~~---~~~~~~~---~~~~~~~~~r~   76 (284)
T 1nv8_A           15 KIWSLIRDCSGKLEGV-TE--------T---SVLEVLLIVSRVLGIRKEDLFLKDL---GVSPTEE---KRILELVEKRA   76 (284)
T ss_dssp             CHHHHHHHHHHHTTTT-CS--------C---HHHHHHHHHHHHHTCCGGGGCCSSC---CCCHHHH---HHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhc-cC--------C---hHHHHHHHHHHHcCCCHHHHHhccc---cccccCH---HHHHHHHHHHH
Confidence            4889999999999654 21        1   3568999999999998876542110   0112222   44555566778


Q ss_pred             CCCceeEEeeeccccccccccCCCcccCCccHHHHHHHHHHHhhhcCCCCCCCcEEEeccCCcHHHHHHHHHhCCCcEEE
Q 026108          145 KRKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSII  224 (243)
Q Consensus       145 ~~~Pl~yi~g~~~f~~l~f~v~~~vliPRp~TElLv~~v~~~l~~~~~~~~~~rVLDLGtGSG~iai~LA~~~~p~a~V~  224 (243)
                      +++|++|++|..+|+++.|.+++++|+|||+||.+++.+++++...    ++.+|||+|||+|++++.+++.  ++++|+
T Consensus        77 ~~~p~~yi~g~~~f~~~~~~v~~~~lipr~~te~lv~~~l~~~~~~----~~~~vLDlG~GsG~~~~~la~~--~~~~v~  150 (284)
T 1nv8_A           77 SGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKY----GIKTVADIGTGSGAIGVSVAKF--SDAIVF  150 (284)
T ss_dssp             TTCCHHHHHTEEEETTEEEECCTTSCCCCTTHHHHHHHHHHHHHHH----TCCEEEEESCTTSHHHHHHHHH--SSCEEE
T ss_pred             CCCCCeEEeeeeEECCeEEEeCCCceecChhHHHHHHHHHHHhccc----CCCEEEEEeCchhHHHHHHHHC--CCCEEE
Confidence            9999999999999999999999999999999999999999877211    2457999999999999999997  678999


Q ss_pred             EEeCCHHHHHHHHHHHHhC
Q 026108          225 AVDLNPLAAAVAAFNAQRI  243 (243)
Q Consensus       225 avDiS~~AL~~Ar~Na~~~  243 (243)
                      |+|+|++|+++|++|++++
T Consensus       151 ~vDis~~al~~A~~n~~~~  169 (284)
T 1nv8_A          151 ATDVSSKAVEIARKNAERH  169 (284)
T ss_dssp             EEESCHHHHHHHHHHHHHT
T ss_pred             EEECCHHHHHHHHHHHHHc
Confidence            9999999999999998753



>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d2h00a1 250 c.66.1.54 (A:5-254) Methyltransferase 10 domain co 7e-08
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 5e-06
d1yb2a1 250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 8e-06
d2ih2a1 223 c.66.1.27 (A:21-243) DNA methylase TaqI, N-termina 2e-04
d1i9ga_ 264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 3e-04
d2f8la1 328 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 { 4e-04
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Methyltransferase 10 domain
domain: Methyltransferase 10 domain containing protein METT10D
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.4 bits (117), Expect = 7e-08
 Identities = 17/89 (19%), Positives = 35/89 (39%), Gaps = 4/89 (4%)

Query: 156 EHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVR--DNDGLRDGFWVDLGTGSGAIAIGI 213
           E +  L + +     IP     L      + L+   D+D       +D+GTG+  I   +
Sbjct: 21  EDF-GLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLL 79

Query: 214 ARVLGSKGSIIAVDLNPLAAAVAAFNAQR 242
              L +    +A +++ +    A  N ++
Sbjct: 80  GATL-NGWYFLATEVDDMCFNYAKKNVEQ 107


>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 223 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Length = 328 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 100.0
d1nv8a_ 271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.97
d2h00a1 250 Methyltransferase 10 domain containing protein MET 99.73
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.32
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.27
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.26
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.12
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.04
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.04
d1uwva2 358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.03
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.01
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.98
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 98.97
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.96
d1ne2a_ 197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.95
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.94
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.89
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.83
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.83
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.83
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.82
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.82
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.82
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 98.82
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.82
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 98.8
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 98.8
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.8
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 98.79
d1nt2a_ 209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.79
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 98.78
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.77
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.77
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.75
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 98.74
d1g8aa_ 227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.73
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.72
d2igta1 309 Putative methyltransferase Atu0340 {Agrobacterium 98.7
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 98.67
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 98.65
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.63
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.62
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.61
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.59
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 98.58
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.55
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 98.53
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.5
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 98.49
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 98.48
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.48
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.48
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 98.47
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.46
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.44
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.43
d1m6ya2 192 TM0872, methyltransferase domain {Thermotoga marit 98.42
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.4
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.39
d2b78a2 317 Hypothetical protein SMu776, middle and C-terminal 98.39
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.37
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.34
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.31
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.28
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.27
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.24
d2cl5a1 214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.24
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.16
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.1
d2avda1 219 COMT domain-containing protein 1, COMTD1 {Human (H 98.08
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 98.03
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.94
d1susa1 227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.92
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.83
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.75
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.46
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.3
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 97.21
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 97.17
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.03
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 96.99
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 96.94
d1af7a2 193 Chemotaxis receptor methyltransferase CheR, C-term 96.92
d1wg8a2 182 TM0872, methyltransferase domain {Thermus thermoph 96.85
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.76
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.7
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.58
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 96.55
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 96.42
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 96.25
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.22
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.18
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.07
d1sqga2 284 Ribosomal RNA small subunit methyltransferase B, R 95.94
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.87
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 95.82
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.34
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 95.07
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 94.6
d2oyra1 250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 94.57
d2bm8a1 232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 94.53
d1ej0a_ 180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 94.35
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 94.29
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 94.17
d1o9ga_ 249 rRNA methyltransferase AviRa {Streptomyces viridoc 93.6
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.58
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.26
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.79
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.72
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 89.03
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 88.53
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.25
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 88.12
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.07
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.51
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 84.28
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 83.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 82.88
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: N5-glutamine methyltransferase, HemK
domain: N5-glutamine methyltransferase, HemK
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.1e-34  Score=257.76  Aligned_cols=154  Identities=28%  Similarity=0.307  Sum_probs=131.8

Q ss_pred             HHHHHHHHHHHhhhcCCccccCCCCCCCcccHHHHHHHHHhccCCCCCCcccccCCCccccccchhHHHHHHHHHhhhcC
Q 026108           66 LKKWHNWAKALASSVRSTFADSDNGPDSSILFRELNWLVEDSLEDPSLIPQLGFQNNSQSVRLRIGLDELYGLWKQRIEK  145 (243)
Q Consensus        66 l~~~~~~a~~~~~~~~~~~~~~~~~~d~~~~~~Ea~~Ll~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~R~~~  145 (243)
                      .++|+++|.+++.+++.             ++.||+||++|++++++..+.+  +   .+..++.+..+.+..+..||.+
T Consensus         2 ~~~~l~~~~~~l~~~~~-------------p~~da~~ll~~~l~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~rr~~   63 (274)
T d2b3ta1           2 YQHWLREAISQLQASES-------------PRRDAEILLEHVTGRGRTFILA--F---GETQLTDEQCQQLDALLTRRRD   63 (274)
T ss_dssp             HHHHHHHHHHTTTTSSC-------------HHHHHHHHHHHHHTCCHHHHHH--T---TTCBCCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHhcCCC-------------HHHHHHHHHHHHhCcCHHHHhh--C---CCCCCCHHHHHHHHHHHHHHhc
Confidence            57899999999975433             4779999999999999876532  1   2234666666777788888899


Q ss_pred             CCceeEEeeeccccccccccCCCcccCCccHHHHHHHHHHHhhhcCCCCCCCcEEEeccCCcHHHHHHHHHhCCCcEEEE
Q 026108          146 RKPFQYLVGCEHWRDLVLSVEEGVFIPRPETELMVDLVSDVLVRDNDGLRDGFWVDLGTGSGAIAIGIARVLGSKGSIIA  225 (243)
Q Consensus       146 ~~Pl~yi~g~~~f~~l~f~v~~~vliPRp~TElLv~~v~~~l~~~~~~~~~~rVLDLGtGSG~iai~LA~~~~p~a~V~a  225 (243)
                      |+|+|||+|+.+|+|++|.|+++||||||+||.|++.++... .    .++.+|||||||||||++++|+.+ |+++|+|
T Consensus        64 g~PlqYI~G~~~F~~~~~~v~~~VlIPRpeTE~lv~~~l~~~-~----~~~~~vlDlGtGSG~I~i~la~~~-p~~~v~a  137 (274)
T d2b3ta1          64 GEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQALARL-P----EQPCRILDLGTGTGAIALALASER-PDCEIIA  137 (274)
T ss_dssp             TCCHHHHSCEEEETTEEEECCTTSCCCCTTHHHHHHHHHHHS-C----SSCCEEEEETCTTSHHHHHHHHHC-TTSEEEE
T ss_pred             CcChhhhcCcEEEeeeEEEEeccccccccchhhhhhhHhhhh-c----ccccceeeeehhhhHHHHHHHhhC-Ccceeee
Confidence            999999999999999999999999999999999999988765 2    135689999999999999999996 8999999


Q ss_pred             EeCCHHHHHHHHHHHHhC
Q 026108          226 VDLNPLAAAVAAFNAQRI  243 (243)
Q Consensus       226 vDiS~~AL~~Ar~Na~~~  243 (243)
                      +|+|+.|+++|++|+++|
T Consensus       138 vDis~~Al~~A~~Na~~~  155 (274)
T d2b3ta1         138 VDRMPDAVSLAQRNAQHL  155 (274)
T ss_dssp             ECSSHHHHHHHHHHHHHH
T ss_pred             ccchhHHHhHHHHHHHHh
Confidence            999999999999999864



>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure