Citrus Sinensis ID: 026283

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MATTLTWQPLQLQPKTTLHIGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDFEEK
ccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccccccEEccccccccccccccccccccccEEEEccccc
cccEcccccccccccccccccccccccHHHccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccEEEEcccEEEEEcccccEEEccccccccccccccccccccccEEEEEEEcc
mattltwqplqlqpkttlhiGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFrmdfsrnwPRYRKQLNDflntplgrsfATIFFLWFALSGWLFRILILATWvlpiaaplligtvannfvikgacpackrefigsksQIIRCAgcgnivwqpegdffsrngggkkstksdddiidvdfeek
mattltwqplqlqpkttlhigrrraatvrafrrsdfdrfarrmtsgeawrdAWRTANNGFEQLVFDAKKtaeridrqysvsrrlnsaartaavrareldrefaisvrwrsfrmdfsrnwprYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFsrngggkkstksdddiidvdfeek
MATTLTWQPLQLQPKTTLHIGrrraatvrafrrsdfdrfarrMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSdddiidvdFEEK
******WQPLQLQPKTTLHIGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVS**L**AARTAAVRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFF************************
****LTWQPL************************DFDRFARRMTSGEA**DAWRTANNGFEQLVFDAKKTAERIDRQYSVSR**********VRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACK**FIGSKSQIIRCAGCGNI**************************DVDF***
MATTLTWQPLQLQPKTTLHIGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSR************ARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSR**********DDDIIDVDFEEK
****LTWQPLQLQPK*******************DFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPE*****************DDIIDVDFEEK
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTLTWQPLQLQPKTTLHIGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDFEEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
225454876244 PREDICTED: uncharacterized protein LOC10 0.995 0.979 0.677 1e-89
224078794260 predicted protein [Populus trichocarpa] 0.962 0.888 0.611 1e-86
255557915231 conserved hypothetical protein [Ricinus 0.945 0.982 0.676 2e-86
297737376214 unnamed protein product [Vitis vinifera] 0.883 0.990 0.737 3e-86
297837839247 hypothetical protein ARALYDRAFT_315473 [ 0.887 0.862 0.724 2e-83
18406650248 uncharacterized protein [Arabidopsis tha 0.937 0.907 0.670 3e-77
356531736240 PREDICTED: uncharacterized protein LOC10 0.966 0.966 0.619 6e-75
351727667226 uncharacterized protein LOC100306460 [Gl 0.920 0.977 0.618 2e-72
449451842247 PREDICTED: uncharacterized protein LOC10 0.812 0.789 0.656 2e-70
414867827256 TPA: hypothetical protein ZEAMMB73_92900 0.937 0.878 0.544 5e-59
>gi|225454876|ref|XP_002278704.1| PREDICTED: uncharacterized protein LOC100247606 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 166/245 (67%), Positives = 190/245 (77%), Gaps = 6/245 (2%)

Query: 1   MATTLTWQPLQLQPKTTLH-----IGRRRAATVRAFRRSDFDRFARRMTSGEAWRDAWRT 55
           M T+L W PL      TL      +  R    VRAFRRSDFD FA+RM SG+AWRDAWR+
Sbjct: 1   MTTSLPWHPLFSSKPQTLRRFAAPVRHRLPMPVRAFRRSDFDGFAKRMASGDAWRDAWRS 60

Query: 56  ANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDF 115
           AN+GFE L+F+AKKTAERI+RQY+VSRR + A  +A   ARE+DREF I  RWR+  +DF
Sbjct: 61  ANDGFELLIFEAKKTAERINRQYAVSRRFSEAVGSAGDWAREVDREFEIGRRWRTVTLDF 120

Query: 116 SRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVA 175
            RNWPRYRKQLNDFL+TPLGRSFATIFFLWFALSGWLFR LI ATWVLP A PLLIGT A
Sbjct: 121 GRNWPRYRKQLNDFLDTPLGRSFATIFFLWFALSGWLFRFLIFATWVLPFAGPLLIGTFA 180

Query: 176 NNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDV 235
           NNFVIKG CPAC+R+FIG K+QI+RCAGCGNIVWQP+GD  SR   G   + S  +IIDV
Sbjct: 181 NNFVIKGNCPACRRQFIGYKNQIVRCAGCGNIVWQPKGD-VSRGSRGTPPSSSQSEIIDV 239

Query: 236 DFEEK 240
           +FEEK
Sbjct: 240 EFEEK 244

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078794|ref|XP_002305632.1| predicted protein [Populus trichocarpa] gi|222848596|gb|EEE86143.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557915|ref|XP_002519986.1| conserved hypothetical protein [Ricinus communis] gi|223540750|gb|EEF42310.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297737376|emb|CBI26577.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297837839|ref|XP_002886801.1| hypothetical protein ARALYDRAFT_315473 [Arabidopsis lyrata subsp. lyrata] gi|297332642|gb|EFH63060.1| hypothetical protein ARALYDRAFT_315473 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18406650|ref|NP_566028.1| uncharacterized protein [Arabidopsis thaliana] gi|13899075|gb|AAK48959.1|AF370532_1 Unknown protein [Arabidopsis thaliana] gi|18377520|gb|AAL66926.1| unknown protein [Arabidopsis thaliana] gi|20196922|gb|AAC31837.2| expressed protein [Arabidopsis thaliana] gi|330255384|gb|AEC10478.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356531736|ref|XP_003534432.1| PREDICTED: uncharacterized protein LOC100785744 [Glycine max] Back     alignment and taxonomy information
>gi|351727667|ref|NP_001235377.1| uncharacterized protein LOC100306460 [Glycine max] gi|255628613|gb|ACU14651.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449451842|ref|XP_004143669.1| PREDICTED: uncharacterized protein LOC101219174 [Cucumis sativus] Back     alignment and taxonomy information
>gi|414867827|tpg|DAA46384.1| TPA: hypothetical protein ZEAMMB73_929009 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:2054972248 AT2G44870 "AT2G44870" [Arabido 0.766 0.741 0.744 9.3e-75
TAIR|locus:2054972 AT2G44870 "AT2G44870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 9.3e-75, P = 9.3e-75
 Identities = 137/184 (74%), Positives = 160/184 (86%)

Query:    45 SGEAWRDAWRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAI 104
             SG+AWRDAWR+AN+GFEQ VF+AKKTAERIDRQY+VSRR +SAA +AA RARE+DREF I
Sbjct:    44 SGKAWRDAWRSANDGFEQFVFEAKKTAERIDRQYAVSRRFSSAASSAADRAREIDREFGI 103

Query:   105 SVRWRSFRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLP 164
             + R R+   DFSRN+P+YRKQ + FLNTPLG SFATIFFLWFALSGWLFR++I+ATWVLP
Sbjct:   104 TPRVRTVSADFSRNFPKYRKQFSAFLNTPLGGSFATIFFLWFALSGWLFRVIIIATWVLP 163

Query:   165 IAAPLLIGTVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKK 224
             IA PLLIG VANNFVIKG CPACKR+FIG K+QIIRC GCGNIVWQP+GDFFS++G    
Sbjct:   164 IAGPLLIGAVANNFVIKGECPACKRQFIGYKNQIIRCEGCGNIVWQPQGDFFSKDGNNNN 223

Query:   225 STKS 228
             +  +
Sbjct:   224 NNNN 227


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.136   0.441    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      240       211   0.00081  112 3  11 22  0.43    32
                                                     31  0.48    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  622 (66 KB)
  Total size of DFA:  188 KB (2105 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  16.30u 0.16s 16.46t   Elapsed:  00:00:01
  Total cpu time:  16.30u 0.16s 16.46t   Elapsed:  00:00:01
  Start:  Fri May 10 05:53:43 2013   End:  Fri May 10 05:53:44 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0009536 "plastid" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.2096.1
hypothetical protein (205 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
PRK00420112 hypothetical protein; Validated 98.57
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 97.02
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 96.95
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.74
PRK02935110 hypothetical protein; Provisional 96.61
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 96.37
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.17
smart00531147 TFIIE Transcription initiation factor IIE. 95.95
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 95.88
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 95.86
COG1645131 Uncharacterized Zn-finger containing protein [Gene 95.54
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 95.53
PF1324023 zinc_ribbon_2: zinc-ribbon domain 95.47
PRK05978148 hypothetical protein; Provisional 95.46
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 95.37
COG1592166 Rubrerythrin [Energy production and conversion] 95.31
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 95.11
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 95.08
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.65
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 94.51
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 94.46
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 94.44
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 94.25
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 94.17
PF1371736 zinc_ribbon_4: zinc-ribbon domain 94.15
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 93.77
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 93.72
PF14353128 CpXC: CpXC protein 93.69
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 93.66
COG0675364 Transposase and inactivated derivatives [DNA repli 93.63
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 93.55
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 93.49
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 93.43
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.36
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 93.35
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 93.31
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 92.9
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 92.81
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 92.81
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 92.81
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 92.7
PRK06266178 transcription initiation factor E subunit alpha; V 92.63
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 92.49
PRK12495 226 hypothetical protein; Provisional 92.04
PRK00448 1437 polC DNA polymerase III PolC; Validated 91.89
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 91.72
PLN03120260 nucleic acid binding protein; Provisional 91.34
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 91.27
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 91.15
PRK08270656 anaerobic ribonucleoside triphosphate reductase; P 91.08
COG1096188 Predicted RNA-binding protein (consists of S1 doma 90.99
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 90.84
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 90.81
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 90.72
PRK00464154 nrdR transcriptional regulator NrdR; Validated 90.35
PRK0043250 30S ribosomal protein S27ae; Validated 90.3
PRK12496164 hypothetical protein; Provisional 90.29
PF1277350 DZR: Double zinc ribbon 90.18
PRK08579625 anaerobic ribonucleoside triphosphate reductase; P 90.06
PF1277350 DZR: Double zinc ribbon 89.7
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 89.32
PHA02942383 putative transposase; Provisional 88.56
TIGR00686109 phnA alkylphosphonate utilization operon protein P 87.84
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 87.74
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 87.67
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 87.66
TIGR00155 403 pqiA_fam integral membrane protein, PqiA family. T 87.33
COG4530129 Uncharacterized protein conserved in bacteria [Fun 87.09
PF0442354 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IP 86.8
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 86.78
PF14257262 DUF4349: Domain of unknown function (DUF4349) 86.34
PF0259156 DUF164: Putative zinc ribbon domain; InterPro: IPR 86.0
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 86.0
COG1326 201 Uncharacterized archaeal Zn-finger protein [Genera 85.92
PF1345341 zf-TFIIB: Transcription factor zinc-finger 85.82
PRK10220111 hypothetical protein; Provisional 85.24
PTZ0008385 40S ribosomal protein S27; Provisional 84.43
COG3877122 Uncharacterized protein conserved in bacteria [Fun 84.41
PLN0020986 ribosomal protein S27; Provisional 84.35
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 84.11
PF09334 391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 84.09
PRK1182760 hypothetical protein; Provisional 83.81
TIGR00340163 zpr1_rel ZPR1-related zinc finger protein. A model 83.79
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 83.42
PF13597546 NRDD: Anaerobic ribonucleoside-triphosphate reduct 82.96
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 82.81
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 82.78
PF01927147 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T 82.74
PRK14350 669 ligA NAD-dependent DNA ligase LigA; Provisional 82.57
PRK08271623 anaerobic ribonucleoside triphosphate reductase; P 82.09
KOG2593 436 consensus Transcription initiation factor IIE, alp 82.01
PRK14704618 anaerobic ribonucleoside triphosphate reductase; P 82.0
PRK14714 1337 DNA polymerase II large subunit; Provisional 81.92
PRK08402355 replication factor A; Reviewed 81.67
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 81.53
PRK09263711 anaerobic ribonucleoside triphosphate reductase; P 81.21
PRK07591 421 threonine synthase; Validated 81.13
PRK06450 338 threonine synthase; Validated 81.03
cd0797398 Spt4 Transcription elongation factor Spt4. Spt4 is 80.8
PF1371937 zinc_ribbon_5: zinc-ribbon domain 80.62
PF1178136 RRN7: RNA polymerase I-specific transcription init 80.61
PRK07218423 replication factor A; Provisional 80.34
COG2824112 PhnA Uncharacterized Zn-ribbon-containing protein 80.2
PRK04023 1121 DNA polymerase II large subunit; Validated 80.01
>PRK00420 hypothetical protein; Validated Back     alignment and domain information 
Probab=98.57  E-value=2.8e-08  Score=80.62  Aligned_cols=35  Identities=17%  Similarity=0.428  Sum_probs=32.9

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -.+.||+||++++++++.+.+||+||+++.+++++
T Consensus        22 l~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~v~~~e   56 (112)
T PRK00420         22 LSKHCPVCGLPLFELKDGEVVCPVHGKVYIVKSDE   56 (112)
T ss_pred             ccCCCCCCCCcceecCCCceECCCCCCeeeeccHH
Confidence            45999999999999999999999999999999875

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>TIGR00155 pqiA_fam integral membrane protein, PqiA family Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04423 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14257 DUF4349: Domain of unknown function (DUF4349) Back     alignment and domain information
>PF02591 DUF164: Putative zinc ribbon domain; InterPro: IPR003743 This entry describes proteins of unknown function Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>PF13597 NRDD: Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>cd07973 Spt4 Transcription elongation factor Spt4 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PRK07218 replication factor A; Provisional Back     alignment and domain information
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA p 95.85
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 95.13
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 95.06
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 94.39
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 94.32
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 92.98
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 92.91
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 92.81
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 92.78
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 92.71
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 92.41
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 91.59
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 91.41
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 90.87
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 90.79
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 90.75
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 90.58
3m7n_A179 Putative uncharacterized protein AF_0206; exosome, 90.47
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 90.02
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 89.41
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 89.09
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 88.22
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 88.18
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 88.02
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 88.02
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 87.86
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 87.33
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 87.06
2k5r_A97 Uncharacterized protein XF2673; solution structure 86.92
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 86.52
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 86.01
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 85.88
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 85.48
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.3
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 85.22
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 85.03
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 84.92
1ryq_A69 DNA-directed RNA polymerase, subunit E''; structur 84.5
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 84.44
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 84.08
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 83.93
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 83.72
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 83.65
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 83.11
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 83.03
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 82.49
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 81.17
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 80.56
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 80.41
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 80.12
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 80.01
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C, DNA polymerase III; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
Probab=95.85  E-value=0.0031  Score=65.19  Aligned_cols=54  Identities=28%  Similarity=0.428  Sum_probs=36.1

Q ss_pred             CCCCCc-cc-------cccccceeecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeeeeeccc
Q 026283          184 CPACKR-EF-------IGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDFEE  239 (240)
Q Consensus       184 CPvC~~-eF-------tG~nnt~~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtIDVe~e~  239 (240)
                      ||.|+| ||       .|+.=-.--||.||+.+.-..-+- .=+-+=+..|.++|| |||+|+.
T Consensus       505 c~~c~~~ef~~~~~~~~g~dlp~k~cp~cg~~~~~dg~~L-lFERFLnpeR~~~PD-IDlDF~~  566 (1041)
T 3f2b_A          505 CPNCKHSEFFNDGSVGSGFDLPDKNCPRCGTKYKKDGHDI-PFETFLGFKGDKVPD-IDLNFSG  566 (1041)
T ss_dssp             CTTTCCEEECCSSCCSCGGGSCCCBCTTTCCBCEEECCCC-CTHHHHTTTSCSCCC-EEEEEET
T ss_pred             CccccccccccccccccccCCccccCccccccccccCCCc-ChhhccCCCCCCCCC-cceECCC
Confidence            999998 34       577777889999999976544220 000001567888887 6888763
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 95.35
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 94.66
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 94.31
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.24
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.91
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 90.4
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 89.67
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 89.49
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 89.16
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 89.07
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 86.38
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 86.04
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.01
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 85.28
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 84.76
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 83.98
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 83.49
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 83.41
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 82.65
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Methionyl-tRNA synthetase (MetRS), Zn-domain
family: Methionyl-tRNA synthetase (MetRS), Zn-domain
domain: Methionyl-tRNA synthetase (MetRS), Zn-domain
species: Pyrococcus abyssi [TaxId: 29292]

Probab=95.35  E-value=0.0028  Score=40.23  Aligned_cols=26  Identities=31%  Similarity=0.721  Sum_probs=20.5

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      |+|+||.|+++    +..--||.+||..+.
T Consensus         1 V~G~CP~C~~~----~a~GDqCe~CG~~~~   26 (35)
T d1rqga3           1 VIGTCPYCGAE----DQKGDQCEVCGRPLT   26 (35)
T ss_dssp             CCSBCSSSCCS----CCCTTTCSSSCCCCC
T ss_pred             CeEECCCCCCC----cccCcchhhcCCccC
Confidence            78999999986    333468999998764
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure