Citrus Sinensis ID: 026284

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
cccccEEEEEcccccccccccccccccHHHHHcccccHHcccccccccccccccccccEEEccEEEccccccHHHHHHHHHHHHHccEEEEEcccccEEccccccHHHHHcccEEEEEcccccccccccEEEEEccHHHHHHHHHHHHccccccccccccEEEEcccccccccccccEEEEEEEccccccccccccEEEEEEccccccccccccccccccccEEEccccccccccccccc
cEEEEEEEEEEcccEEcccccEcccccccHHHHHEcccccEcccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHccEEEEEcccEEEcccccccccEcccccEEEEEEccccccccccEEEEEccHHHHHHHHHHHccccccccccccccEEEcccccccccccccEEEEEEEccccccccccccEEEEEEEccccccccccHHcccccEEEEEEcccccccccccccc
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIetigmkktprrcsdvkcgsrlkdtvldwedalppvemnpaeencrMADVVLCLgtslqitpacnlplkslrgggKIVIVNLqqtpkdkkaslvVHAPVDKVIAGVMRHLnlwippyvrvdlfqinldqysrpsrsdkYVKWALRVgsvhrpkapspfvqsvevsfsdrpdlKTAILNKQPFKLKRRKQITSAMIRTPLFGS
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEietigmkktprrcsdvkcgsrlkdtvldwedalppVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLqqtpkdkkaslvVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDqysrpsrsdkyVKWALRVGsvhrpkapspfvqsvevsfsdrpdlktailnkqpfklkrrkqitsamirtplfgs
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
**IACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSV*****************************************************
***ACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQI******************LRVGS*H***A**************************************AMIRTPLFG*
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLKTAILNKQPFKLKRRKQITSAMIRTPLFGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q9FE17 473 NAD-dependent protein dea yes no 0.804 0.408 0.661 6e-74
B8ARK7 484 NAD-dependent protein dea N/A no 0.825 0.409 0.643 1e-72
P59941334 NAD-dependent protein dea no no 0.737 0.529 0.376 6e-27
Q8N6T7355 NAD-dependent protein dea yes no 0.520 0.352 0.465 1e-26
Q9VH08317 NAD-dependent protein dea yes no 0.587 0.444 0.372 7e-20
Q9NRC8400 NAD-dependent protein dea no no 0.508 0.305 0.357 5e-11
Q0P595400 NAD-dependent protein dea no no 0.508 0.305 0.357 1e-10
Q8BKJ9402 NAD-dependent protein dea no no 0.508 0.303 0.364 1e-10
B2RZ55402 NAD-dependent protein dea no no 0.508 0.303 0.364 3e-10
Q73KE1251 NAD-dependent protein dea yes no 0.404 0.386 0.421 5e-10
>sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  276 bits (707), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 161/195 (82%), Gaps = 2/195 (1%)

Query: 31  VEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVL 90
            EY+RDFE+ETIG+K+T R+CS  KCG++LKDTVLDWEDALPP E++PAE++C+ AD+VL
Sbjct: 147 AEYLRDFEVETIGLKETSRKCSVEKCGAKLKDTVLDWEDALPPKEIDPAEKHCKKADLVL 206

Query: 91  CLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNL 150
           CLGTSLQITPACNLPLK L+GGGKIVIVNLQ+TPKDKKA++V+H  VDKV+AGVM  LN+
Sbjct: 207 CLGTSLQITPACNLPLKCLKGGGKIVIVNLQKTPKDKKANVVIHGLVDKVVAGVMESLNM 266

Query: 151 WIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDL 210
            IPPYVR+DLFQI L Q    S   +++ W LRV SVH   +  PF++S+EVSFSD  + 
Sbjct: 267 KIPPYVRIDLFQIILTQ--SISGDQRFINWTLRVASVHGLTSQLPFIKSIEVSFSDNHNY 324

Query: 211 KTAILNKQPFKLKRR 225
           K A+L+KQPF +KRR
Sbjct: 325 KDAVLDKQPFLMKRR 339
NAD-dependent protein deacetylase. Has deacetylase activity towards H3K9Ac. May have a function in the safeguard against genome instabiliy and DNA damage to ensure plant cell growth.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: -
>sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 Back     alignment and function description
>sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 Back     alignment and function description
>sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 Back     alignment and function description
>sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 Back     alignment and function description
>sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 Back     alignment and function description
>sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 Back     alignment and function description
>sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 Back     alignment and function description
>sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
449506405 552 PREDICTED: NAD-dependent protein deacety 0.804 0.349 0.707 2e-77
225461927 467 PREDICTED: NAD-dependent deacetylase sir 0.804 0.413 0.717 4e-77
356524368 574 PREDICTED: NAD-dependent deacetylase sir 0.829 0.346 0.696 5e-77
449462391 472 PREDICTED: NAD-dependent protein deacety 0.8 0.406 0.711 8e-77
359466799 467 sirtuin 1 [Vitis vinifera] 0.804 0.413 0.712 2e-76
356566429 479 PREDICTED: NAD-dependent deacetylase sir 0.829 0.415 0.691 3e-76
224056465 464 histone deacetylase [Populus trichocarpa 0.804 0.415 0.712 1e-75
255563480 466 chromatin regulatory protein sir2, putat 0.825 0.424 0.683 9e-75
297793049 473 hypothetical protein ARALYDRAFT_495661 [ 0.804 0.408 0.676 7e-74
297790063 473 hypothetical protein ARALYDRAFT_497237 [ 0.804 0.408 0.671 3e-73
>gi|449506405|ref|XP_004162741.1| PREDICTED: NAD-dependent protein deacetylase SRT1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/195 (70%), Positives = 159/195 (81%), Gaps = 2/195 (1%)

Query: 31  VEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVL 90
            EY+RDFE+ETIG+K T RRCSD  CG++L+DTVLDWEDALPP EMNPAE +CRMAD+VL
Sbjct: 117 AEYLRDFEVETIGLKDTSRRCSDANCGAKLRDTVLDWEDALPPKEMNPAERHCRMADIVL 176

Query: 91  CLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNL 150
           CLGTSLQITPACNLPLKSLRGGGKI+IVNLQ+TPKDKKASLV+H  VDKVIAGVM  LN+
Sbjct: 177 CLGTSLQITPACNLPLKSLRGGGKIIIVNLQKTPKDKKASLVIHGRVDKVIAGVMEILNM 236

Query: 151 WIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDL 210
            IPP+VR+DLFQI L Q    S   K+V W LR+ S+H  KAP PF++SVE+SF D  D 
Sbjct: 237 QIPPFVRIDLFQIILSQ--GLSLDKKFVNWTLRILSIHGQKAPLPFIKSVEISFLDNQDY 294

Query: 211 KTAILNKQPFKLKRR 225
           K+  L  QPF LKRR
Sbjct: 295 KSTTLQSQPFLLKRR 309

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461927|ref|XP_002265837.1| PREDICTED: NAD-dependent deacetylase sirtuin-6 [Vitis vinifera] gi|296089923|emb|CBI39742.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356524368|ref|XP_003530801.1| PREDICTED: NAD-dependent deacetylase sirtuin-7-like [Glycine max] Back     alignment and taxonomy information
>gi|449462391|ref|XP_004148924.1| PREDICTED: NAD-dependent protein deacetylase SRT1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359466799|gb|AEV46830.1| sirtuin 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356566429|ref|XP_003551434.1| PREDICTED: NAD-dependent deacetylase sirtuin-6-like [Glycine max] Back     alignment and taxonomy information
>gi|224056465|ref|XP_002298870.1| histone deacetylase [Populus trichocarpa] gi|222846128|gb|EEE83675.1| histone deacetylase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563480|ref|XP_002522742.1| chromatin regulatory protein sir2, putative [Ricinus communis] gi|223537980|gb|EEF39593.1| chromatin regulatory protein sir2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297793049|ref|XP_002864409.1| hypothetical protein ARALYDRAFT_495661 [Arabidopsis lyrata subsp. lyrata] gi|297310244|gb|EFH40668.1| hypothetical protein ARALYDRAFT_495661 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297790063|ref|XP_002862943.1| hypothetical protein ARALYDRAFT_497237 [Arabidopsis lyrata subsp. lyrata] gi|297308724|gb|EFH39202.1| hypothetical protein ARALYDRAFT_497237 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:2162112 473 SRT1 "AT5G55760" [Arabidopsis 0.8 0.405 0.664 5.6e-68
RGD|1305216330 Sirt6 "sirtuin 6" [Rattus norv 0.675 0.490 0.411 1.7e-27
UNIPROTKB|F1P0C4357 SIRT6 "Uncharacterized protein 0.516 0.347 0.476 2.8e-27
MGI|MGI:1354161334 Sirt6 "sirtuin 6 (silent matin 0.675 0.485 0.395 3.2e-26
UNIPROTKB|F1S7P1359 SIRT6 "Uncharacterized protein 0.583 0.389 0.438 5.2e-26
UNIPROTKB|A5D7K6359 SIRT6 "SIRT6 protein" [Bos tau 0.587 0.392 0.428 6.6e-26
UNIPROTKB|B4DDV3283 SIRT6 "NAD-dependent protein d 0.583 0.494 0.438 6.6e-26
UNIPROTKB|Q8N6T7355 SIRT6 "NAD-dependent protein d 0.583 0.394 0.438 6.6e-26
UNIPROTKB|F1S7M5328 SIRT6 "Uncharacterized protein 0.516 0.378 0.469 6.6e-26
UNIPROTKB|E2QXD9361 SIRT6 "Uncharacterized protein 0.583 0.387 0.431 1.1e-25
TAIR|locus:2162112 SRT1 "AT5G55760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 690 (248.0 bits), Expect = 5.6e-68, P = 5.6e-68
 Identities = 129/194 (66%), Positives = 161/194 (82%)

Query:    32 EYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLC 91
             EY+RDFE+ETIG+K+T R+CS  KCG++LKDTVLDWEDALPP E++PAE++C+ AD+VLC
Sbjct:   148 EYLRDFEVETIGLKETSRKCSVEKCGAKLKDTVLDWEDALPPKEIDPAEKHCKKADLVLC 207

Query:    92 LGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLW 151
             LGTSLQITPACNLPLK L+GGGKIVIVNLQ+TPKDKKA++V+H  VDKV+AGVM  LN+ 
Sbjct:   208 LGTSLQITPACNLPLKCLKGGGKIVIVNLQKTPKDKKANVVIHGLVDKVVAGVMESLNMK 267

Query:   152 IPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFSDRPDLK 211
             IPPYVR+DLFQI L Q    S   +++ W LRV SVH   +  PF++S+EVSFSD  + K
Sbjct:   268 IPPYVRIDLFQIILTQSI--SGDQRFINWTLRVASVHGLTSQLPFIKSIEVSFSDNHNYK 325

Query:   212 TAILNKQPFKLKRR 225
              A+L+KQPF +KRR
Sbjct:   326 DAVLDKQPFLMKRR 339
GO:0003677 "DNA binding" evidence=ISS
GO:0005677 "chromatin silencing complex" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006342 "chromatin silencing" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0006476 "protein deacetylation" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0070403 "NAD+ binding" evidence=IEA
RGD|1305216 Sirt6 "sirtuin 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0C4 SIRT6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1354161 Sirt6 "sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7P1 SIRT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7K6 SIRT6 "SIRT6 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DDV3 SIRT6 "NAD-dependent protein deacetylase sirtuin-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N6T7 SIRT6 "NAD-dependent protein deacetylase sirtuin-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7M5 SIRT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXD9 SIRT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033378001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (467 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
cd01410206 cd01410, SIRT7, SIRT7: Eukaryotic and prokaryotic 9e-48
cd01407218 cd01407, SIR2-fam, SIR2 family of proteins include 9e-28
cd00296222 cd00296, SIR2, SIR2 superfamily of proteins includ 2e-20
PRK00481242 PRK00481, PRK00481, NAD-dependent deacetylase; Pro 8e-19
cd01413222 cd01413, SIR2_Af2, SIR2_Af2: Archaeal and prokaryo 3e-15
COG0846250 COG0846, SIR2, NAD-dependent protein deacetylases, 5e-14
PRK14138244 PRK14138, PRK14138, NAD-dependent deacetylase; Pro 7e-11
cd01412224 cd01412, SIRT5_Af1_CobB, SIRT5_Af1_CobB: Eukaryoti 2e-10
PTZ00409271 PTZ00409, PTZ00409, Sir2 (Silent Information Regul 5e-08
cd01411225 cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic 2e-07
PTZ00408242 PTZ00408, PTZ00408, NAD-dependent deacetylase; Pro 1e-05
pfam02146177 pfam02146, SIR2, Sir2 family 3e-05
cd01409260 cd01409, SIRT4, SIRT4: Eukaryotic and prokaryotic 3e-04
>gnl|CDD|238701 cd01410, SIRT7, SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information 
 Score =  156 bits (396), Expect = 9e-48
 Identities = 59/105 (56%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 32  EYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLC 91
           EY+RD  +ET G K+T RRC    CG  LKDT++D+ + LPP     A      AD+ LC
Sbjct: 104 EYVRDDVVETRGDKETGRRCH--ACGGILKDTIVDFGERLPPENWMGAAAAACRADLFLC 161

Query: 92  LGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAP 136
           LGTSLQ+TPA NLPLK+ R GG++VIVNLQ TPKDK A LV+H  
Sbjct: 162 LGTSLQVTPAANLPLKAARAGGRLVIVNLQPTPKDKLADLVIHGD 206

Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. Length = 206
>gnl|CDD|238698 cd01407, SIR2-fam, SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>gnl|CDD|238184 cd00296, SIR2, SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>gnl|CDD|234777 PRK00481, PRK00481, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238704 cd01413, SIR2_Af2, SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|223915 COG0846, SIR2, NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>gnl|CDD|172627 PRK14138, PRK14138, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|238703 cd01412, SIRT5_Af1_CobB, SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>gnl|CDD|173599 PTZ00409, PTZ00409, Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>gnl|CDD|238702 cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>gnl|CDD|240405 PTZ00408, PTZ00408, NAD-dependent deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|216902 pfam02146, SIR2, Sir2 family Back     alignment and domain information
>gnl|CDD|238700 cd01409, SIRT4, SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
PRK14138244 NAD-dependent deacetylase; Provisional 100.0
KOG1905353 consensus Class IV sirtuins (SIR2 family) [Chromat 100.0
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla 100.0
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 99.98
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla 99.97
PTZ00408242 NAD-dependent deacetylase; Provisional 99.97
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 99.97
PRK00481242 NAD-dependent deacetylase; Provisional 99.97
cd01413222 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group 99.97
PRK05333285 NAD-dependent deacetylase; Provisional 99.97
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 fami 99.97
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 99.96
cd01411225 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homo 99.96
cd01407218 SIR2-fam SIR2 family of proteins includes silent i 99.96
PTZ00410349 NAD-dependent SIR2; Provisional 99.95
KOG2682314 consensus NAD-dependent histone deacetylases and c 99.93
cd00296222 SIR2 SIR2 superfamily of proteins includes silent 99.92
KOG2683305 consensus Sirtuin 4 and related class II sirtuins 99.92
KOG2684412 consensus Sirtuin 5 and related class III sirtuins 99.89
PF02146178 SIR2: Sir2 family; InterPro: IPR003000 These seque 99.89
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 97.1
PRK07524 535 hypothetical protein; Provisional 95.71
PRK08322 547 acetolactate synthase; Reviewed 95.7
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 95.66
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 95.64
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 95.58
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 95.51
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 95.48
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 95.47
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 95.44
PRK06154 565 hypothetical protein; Provisional 95.3
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 95.29
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 95.28
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 95.28
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 95.25
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 95.21
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 95.14
PRK08199 557 thiamine pyrophosphate protein; Validated 95.09
PLN02470 585 acetolactate synthase 95.04
PRK05858 542 hypothetical protein; Provisional 95.0
PRK08266 542 hypothetical protein; Provisional 94.9
PRK06112 578 acetolactate synthase catalytic subunit; Validated 94.86
PRK11269 591 glyoxylate carboligase; Provisional 94.86
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 94.83
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 94.82
PRK08327 569 acetolactate synthase catalytic subunit; Validated 94.81
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 94.76
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 94.72
PRK08611 576 pyruvate oxidase; Provisional 94.67
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 94.62
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 94.61
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 94.55
PRK08155 564 acetolactate synthase catalytic subunit; Validated 94.52
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 94.5
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 94.43
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 94.34
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 94.34
PRK08273 597 thiamine pyrophosphate protein; Provisional 94.31
PRK06546 578 pyruvate dehydrogenase; Provisional 94.31
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 94.27
PRK08617 552 acetolactate synthase; Reviewed 94.23
PRK07064 544 hypothetical protein; Provisional 93.88
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 93.86
KOG1185 571 consensus Thiamine pyrophosphate-requiring enzyme 93.45
PRK09124 574 pyruvate dehydrogenase; Provisional 93.23
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 92.97
PRK07092 530 benzoylformate decarboxylase; Reviewed 92.09
COG3962 617 Acetolactate synthase [Amino acid transport and me 91.95
PLN02573 578 pyruvate decarboxylase 91.79
PRK06457 549 pyruvate dehydrogenase; Provisional 90.9
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 90.67
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 90.52
PRK03363313 fixB putative electron transfer flavoprotein FixB; 90.4
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 90.24
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 89.97
cd02750 461 MopB_Nitrate-R-NarG-like Respiratory nitrate reduc 89.85
cd02759 477 MopB_Acetylene-hydratase The MopB_Acetylene-hydrat 89.24
cd02766 501 MopB_3 The MopB_3 CD includes a group of related u 88.64
cd02753 512 MopB_Formate-Dh-H Formate dehydrogenase H (Formate 87.97
PRK07449 568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 87.67
cd02765 567 MopB_4 The MopB_4 CD includes a group of related u 86.57
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 86.36
cd02768386 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The Nuo 86.28
cd02755 454 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-lik 85.09
cd02767 574 MopB_ydeP The MopB_ydeP CD includes a group of rel 84.83
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 84.71
cd02763 679 MopB_2 The MopB_2 CD includes a group of related u 84.31
PF0336684 YEATS: YEATS family; InterPro: IPR005033 Named the 84.14
cd02754 565 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA 83.98
TIGR01591 671 Fdh-alpha formate dehydrogenase, alpha subunit, ar 83.97
TIGR03479 912 DMSO_red_II_alp DMSO reductase family type II enzy 83.97
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 83.81
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 82.97
cd02762 539 MopB_1 The MopB_1 CD includes a group of related u 82.51
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 82.15
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 81.45
cd02760 760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA 81.17
cd02770 617 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the D 80.57
TIGR01553 1009 formate-DH-alph formate dehydrogenase, alpha subun 80.23
cd02757 523 MopB_Arsenate-R This CD includes the respiratory a 80.11
cd00368374 Molybdopterin-Binding Molybdopterin-Binding (MopB) 80.08
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.2e-35  Score=258.44  Aligned_cols=138  Identities=29%  Similarity=0.460  Sum_probs=127.9

Q ss_pred             CCCCeEEecccccccceecCCCcccchHHHHhhhhhhhccCcCCCCCCCCCCCCCcccccEEEcCCCCChhhHHHHHHHh
Q 026284            4 ACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENC   83 (240)
Q Consensus         4 ~~~kViElHG~sl~~~~C~~C~~~~~~~ey~r~~~~~~~~~~~~~p~C~~~~CgG~LRP~IV~FGE~lp~~~l~~a~~~~   83 (240)
                      |+++|+|+|| ++.+.+|+.|++.|+.+++.+...      ....|+||  .|||.|||+||||||.+|+..++++.+++
T Consensus       106 G~~~VielHG-~~~~~~C~~C~~~~~~~~~~~~~~------~~~~p~Cp--~Cgg~lrP~Vv~FgE~~p~~~~~~~~~~~  176 (244)
T PRK14138        106 GSKKVIELHG-NVEEYYCVRCGKRYTVEDVIEKLE------KSDVPRCD--DCSGLIRPNIVFFGEALPQDALREAIRLS  176 (244)
T ss_pred             CCCeEEEccC-CcCeeEECCCCCcccHHHHHHHHh------cCCCCCCC--CCCCeECCCEEECCCcCCHHHHHHHHHHH
Confidence            6889999999 999999999999999876654321      23579999  89999999999999999999999999999


Q ss_pred             ccCCEEEEEcCCCCccccccchhhhhcCCCEEEEEcCCCCCCCCcccEEEECcHHHHHHHHHHHhcc
Q 026284           84 RMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNL  150 (240)
Q Consensus        84 ~~aDLvLVIGTSL~V~Pa~~lp~~a~~~g~~lViIN~q~t~~d~~adl~I~g~~devl~~L~~~Lg~  150 (240)
                      ++||++|||||||+|+|+++|+..++++|+++++||+++|+.|..++++|+|+++++|++||+.||+
T Consensus       177 ~~aDl~lviGTSl~V~pa~~l~~~~~~~g~~~i~iN~~~t~~d~~~~~~i~~~~~~~l~~l~~~~~~  243 (244)
T PRK14138        177 SKASLMIVMGSSLVVYPAAELPLITVRSGGKLVIVNLGETPLDDIATLKYNMDVVEFANRVMSEGGI  243 (244)
T ss_pred             hcCCEEEEeCcCCeeecHhHHHHHHHHcCCeEEEEcCCCCCCCcceeEEEeCCHHHHHHHHHHHhCC
Confidence            9999999999999999999999999999999999999999999999999999999999999998885

>KOG1905 consensus Class IV sirtuins (SIR2 family) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>PTZ00410 NAD-dependent SIR2; Provisional Back     alignment and domain information
>KOG2682 consensus NAD-dependent histone deacetylases and class I sirtuins (SIR2 family) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>KOG2683 consensus Sirtuin 4 and related class II sirtuins (SIR2 family) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2684 consensus Sirtuin 5 and related class III sirtuins (SIR2 family) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF02146 SIR2: Sir2 family; InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information
>cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>cd02765 MopB_4 The MopB_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>cd02755 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins Back     alignment and domain information
>cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>cd02763 MopB_2 The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>PF03366 YEATS: YEATS family; InterPro: IPR005033 Named the YEATS family, after `YNK7', `ENL', `AF-9', and `TFIIF small subunit', this family also contains the GAS41 protein Back     alignment and domain information
>cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type Back     alignment and domain information
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>cd02760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA-OR CD contains the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), and other related proteins Back     alignment and domain information
>cd02770 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes Back     alignment and domain information
>TIGR01553 formate-DH-alph formate dehydrogenase, alpha subunit, proteobacterial-type Back     alignment and domain information
>cd02757 MopB_Arsenate-R This CD includes the respiratory arsenate reductase, As(V), catalytic subunit (ArrA) and other related proteins Back     alignment and domain information
>cd00368 Molybdopterin-Binding Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
3k35_A318 Crystal Structure Of Human Sirt6 Length = 318 4e-28
3pki_A355 Human Sirt6 Crystal Structure In Complex With Adp R 1e-27
2h4h_A246 Sir2 H116y Mutant-P53 Peptide-Nad Length = 246 1e-08
1yc5_A246 Sir2-P53 Peptide-Nicotinamide Length = 246 1e-08
2h59_A246 Sir2 H116a-Deacetylated P53 Peptide-3'-O-Acetyl Adp 1e-08
1ici_A256 Crystal Structure Of A Sir2 Homolog-Nad Complex Len 4e-08
1m2g_A249 Sir2 Homologue-Adp Ribose Complex Length = 249 4e-08
1m2j_A249 Sir2 Homologue H80n Mutant-Adp Ribose Complex Lengt 5e-08
1m2h_A249 Sir2 Homologue S24a Mutant-adp Ribose Complex Lengt 5e-08
1m2n_A249 Sir2 Homologues (D102gF159AR170A) MUTANT-2'-O-Acety 9e-08
1m2k_A249 Sir2 Homologue F159a Mutant-Adp Ribose Complex Leng 1e-07
1ma3_A253 Structure Of A Sir2 Enzyme Bound To An Acetylated P 5e-05
>pdb|3K35|A Chain A, Crystal Structure Of Human Sirt6 Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 86/131 (65%), Gaps = 6/131 (4%)
Query: 31  VEYMRDFEIETIGMKKTPRRCSDVK------CGSRLKDTVLDWEDALPPVEMNPAEENCR 84
            +Y+RD  + T+G+K T R C+  K      C   L+DT+LDWED+LP  ++  A+E  R
Sbjct: 146 TQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASR 205
Query: 85  MADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGV 144
            AD+ + LGTSLQI P+ NLPL + R GG++VIVNLQ T  D+ A L +H  VD+V+  +
Sbjct: 206 NADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRL 265
Query: 145 MRHLNLWIPPY 155
           M+HL L IP +
Sbjct: 266 MKHLGLEIPAW 276
>pdb|3PKI|A Chain A, Human Sirt6 Crystal Structure In Complex With Adp Ribose Length = 355 Back     alignment and structure
>pdb|2H4H|A Chain A, Sir2 H116y Mutant-P53 Peptide-Nad Length = 246 Back     alignment and structure
>pdb|1YC5|A Chain A, Sir2-P53 Peptide-Nicotinamide Length = 246 Back     alignment and structure
>pdb|2H59|A Chain A, Sir2 H116a-Deacetylated P53 Peptide-3'-O-Acetyl Adp Ribose Length = 246 Back     alignment and structure
>pdb|1ICI|A Chain A, Crystal Structure Of A Sir2 Homolog-Nad Complex Length = 256 Back     alignment and structure
>pdb|1M2G|A Chain A, Sir2 Homologue-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2J|A Chain A, Sir2 Homologue H80n Mutant-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2H|A Chain A, Sir2 Homologue S24a Mutant-adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2N|A Chain A, Sir2 Homologues (D102gF159AR170A) MUTANT-2'-O-Acetyl Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1M2K|A Chain A, Sir2 Homologue F159a Mutant-Adp Ribose Complex Length = 249 Back     alignment and structure
>pdb|1MA3|A Chain A, Structure Of A Sir2 Enzyme Bound To An Acetylated P53 Peptide Length = 253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 6e-45
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 2e-44
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 7e-32
1m2k_A249 Silent information regulator 2; protein-ligand com 8e-20
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 4e-19
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 5e-18
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 5e-18
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 3e-16
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 4e-16
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 1e-15
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 2e-13
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 9e-13
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 5e-12
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Length = 355 Back     alignment and structure
 Score =  152 bits (387), Expect = 6e-45
 Identities = 70/194 (36%), Positives = 100/194 (51%), Gaps = 10/194 (5%)

Query: 32  EYMRDFEIETIGMKKTPRRCSDVK------CGSRLKDTVLDWEDALPPVEMNPAEENCRM 85
           +Y+RD  + T+G+K T R C+  K      C   L+DT+LDWED+LP  ++  A+E  R 
Sbjct: 147 QYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRN 206

Query: 86  ADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVM 145
           AD+ + LGTSLQI P+ NLPL + R GG++VIVNLQ T  D+ A L +H  VD+V+  +M
Sbjct: 207 ADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLM 266

Query: 146 RHLNLWIPPYVRVDLFQINLDQYSRPSRSDKYVKWALRVGSVHRPKAPSPFVQSVEVSFS 205
            HL L IP +    + +  L    RP       K   +  S  R     P     E    
Sbjct: 267 EHLGLEIPAWDGPRVLERALPPLPRPPTP----KLEPKEESPTRINGSIPAGPKQEPCAQ 322

Query: 206 DRPDLKTAILNKQP 219
                  +   ++P
Sbjct: 323 HNGSEPASPKRERP 336
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Length = 318 Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Length = 246 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Length = 249 Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} PDB: 3rig_A* 2b4y_A* 2nyr_A* Length = 273 Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Length = 253 Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Length = 290 Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Length = 289 Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Length = 361 Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Length = 235 Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Length = 323 Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Length = 354 Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A Length = 285 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 100.0
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 100.0
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 100.0
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 100.0
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 100.0
1m2k_A249 Silent information regulator 2; protein-ligand com 100.0
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 100.0
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 100.0
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 99.97
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 99.97
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 99.97
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 99.97
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 99.97
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 99.97
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 95.09
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 94.19
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 94.15
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 94.06
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 93.9
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 93.69
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 93.58
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 93.51
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 93.5
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 93.22
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 91.83
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 91.77
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 91.68
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 91.46
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 91.44
1o97_D320 Electron transferring flavoprotein alpha-subunit; 91.02
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 90.5
1efv_A315 Electron transfer flavoprotein; electron transport 88.58
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 87.8
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 86.71
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 85.64
2vpz_A 765 Thiosulfate reductase; oxidoreductase, molybdopter 84.81
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 83.73
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 82.75
2e7z_A 727 Acetylene hydratase AHY; tungstoprotein, DMSO redu 82.0
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.3e-37  Score=279.83  Aligned_cols=148  Identities=40%  Similarity=0.620  Sum_probs=128.9

Q ss_pred             CCeEEecccccccceecCCCcccchHHHHhhhhhhhccCcCCCCCCCC------CCCCCcccccEEEcCCCCChhhHHHH
Q 026284            6 ICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSD------VKCGSRLKDTVLDWEDALPPVEMNPA   79 (240)
Q Consensus         6 ~kViElHG~sl~~~~C~~C~~~~~~~ey~r~~~~~~~~~~~~~p~C~~------~~CgG~LRP~IV~FGE~lp~~~l~~a   79 (240)
                      ++|+|+|| |+++++|+.|++.|+.+.+...     ...+.+++.|+.      ..|||.|||+||||||.+|++.++.|
T Consensus       127 ~~VielHG-sl~~~~C~~C~~~~~~~~~~~~-----~~~~p~~~~C~~~~~~~c~~CgG~LRPdVV~FGE~lP~~~~~~a  200 (318)
T 3k35_A          127 DKLAELHG-NMFVEECAKCKTQYVRDTVVGT-----MGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALA  200 (318)
T ss_dssp             GGEEETTC-CTTEEEETTTCCEEECSSCCSC-----CSSCEEEEECCC--------CCCEEEECCCCTTCCCCHHHHHHH
T ss_pred             cCEEEeCC-CCCeeEeCCCCCccchHHhhhh-----cccCCCCCcCcccccccccCcCCeeCCCEEEccCcCCHHHHHHH
Confidence            68999999 9999999999998775432211     111122345531      16999999999999999999999999


Q ss_pred             HHHhccCCEEEEEcCCCCccccccchhhhhcCCCEEEEEcCCCCCCCCcccEEEECcHHHHHHHHHHHhcccCCCCccCC
Q 026284           80 EENCRMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNLWIPPYVRVD  159 (240)
Q Consensus        80 ~~~~~~aDLvLVIGTSL~V~Pa~~lp~~a~~~g~~lViIN~q~t~~d~~adl~I~g~~devl~~L~~~Lg~~iP~~~~~~  159 (240)
                      .+++++||++|||||||+|+|+++|+..++++|+++++||+++|+.|+.+|++|+|+++++|++|+++|||+||+|+..+
T Consensus       201 ~~~~~~aDllLViGTSL~V~Paa~l~~~a~~~G~~vviIN~~~t~~d~~adl~i~g~~~evl~~L~~~Lg~~iP~~~~~~  280 (318)
T 3k35_A          201 DEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR  280 (318)
T ss_dssp             HHHHHTCSEEEEESCCCCSTTGGGHHHHHHHTTCEEEEECSSCCTTGGGCSEEECSCHHHHHHHHHHHHTCCCCCCCSCB
T ss_pred             HHHHhcCCEEEEEccCCCchhhhhhHHHHHhcCCEEEEECCCCCCCCCcccEEEeCCHHHHHHHHHHHhCCCCCCCCCCc
Confidence            99999999999999999999999999989999999999999999999999999999999999999999999999999865
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d1yc5a1245 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA 2e-21
d1m2ka_249 c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Ar 3e-21
d2b4ya1267 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirt 9e-21
d1j8fa_323 c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Ho 3e-18
d1ma3a_252 c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Arc 4e-18
d1s5pa_235 c.31.1.5 (A:) NAD-dependent deacetylase CobB {Esch 1e-16
d1q1aa_289 c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces c 8e-15
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Length = 245 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Sir2 family of transcriptional regulators
domain: NAD-dependent deacetylase NpdA
species: Thermotoga maritima [TaxId: 2336]

 Score = 87.5 bits (216), Expect = 2e-21
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 32  EYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENCRMADVVLC 91
           +Y  +  I+ +     P       C S ++  ++ + + LP   +  A      A +++ 
Sbjct: 130 KYTVEDVIKKLESSDVPLCD---DCNSLIRPNIVFFGENLPQDALREAIGLSSRASLMIV 186

Query: 92  LGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNL 150
           LG+SL + PA  LPL ++R GGK+VIVNL +TP D  A+L  +  V +    VM    +
Sbjct: 187 LGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGI 245
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 249 Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Length = 235 Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 289 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 100.0
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 100.0
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 100.0
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 100.0
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.97
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 99.97
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 99.97
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 97.7
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 97.34
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 97.33
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 97.28
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 97.28
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 97.26
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 97.11
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 96.72
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 95.03
d1efva2124 C-terminal domain of the electron transfer flavopr 94.81
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 94.77
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 94.6
d3clsd2123 C-terminal domain of the electron transfer flavopr 93.39
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 88.96
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 84.94
d1m3sa_186 Hypothetical protein YckF {Bacillus subtilis [TaxI 84.19
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Sir2 family of transcriptional regulators
domain: NAD-dependent deacetylase NpdA
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=1.4e-35  Score=258.24  Aligned_cols=138  Identities=29%  Similarity=0.447  Sum_probs=129.0

Q ss_pred             CCCCeEEecccccccceecCCCcccchHHHHhhhhhhhccCcCCCCCCCCCCCCCcccccEEEcCCCCChhhHHHHHHHh
Q 026284            4 ACICVLEYQGRNLLSCTAILFEKFAHLVEYMRDFEIETIGMKKTPRRCSDVKCGSRLKDTVLDWEDALPPVEMNPAEENC   83 (240)
Q Consensus         4 ~~~kViElHG~sl~~~~C~~C~~~~~~~ey~r~~~~~~~~~~~~~p~C~~~~CgG~LRP~IV~FGE~lp~~~l~~a~~~~   83 (240)
                      |+++|+|+|| ++++++|+.|++.++.+++.+...      ....|.|+  .|||.|||+||||||.+|++.++.|.+++
T Consensus       108 G~~~v~elHG-~l~~~~C~~c~~~~~~~~~~~~~~------~~~~p~c~--~Cgg~lrP~Vv~FgE~lp~~~~~~a~~~~  178 (245)
T d1yc5a1         108 GSKKVIELHG-NVEEYYCVRCEKKYTVEDVIKKLE------SSDVPLCD--DCNSLIRPNIVFFGENLPQDALREAIGLS  178 (245)
T ss_dssp             TCSCEEETTE-EEEEEEETTTCCEEEHHHHHHHTT------TCSSCBCT--TTCCBEEEEECCBTSBCCHHHHHHHHHHH
T ss_pred             CCcccccccc-ccceeeecccCCCccHHHHhhhhh------cccCCCcc--ccCCcccCcEEEccccCCHHHHHHHHHHh
Confidence            6789999999 999999999999999877665432      34678999  89999999999999999999999999999


Q ss_pred             ccCCEEEEEcCCCCccccccchhhhhcCCCEEEEEcCCCCCCCCcccEEEECcHHHHHHHHHHHhcc
Q 026284           84 RMADVVLCLGTSLQITPACNLPLKSLRGGGKIVIVNLQQTPKDKKASLVVHAPVDKVIAGVMRHLNL  150 (240)
Q Consensus        84 ~~aDLvLVIGTSL~V~Pa~~lp~~a~~~g~~lViIN~q~t~~d~~adl~I~g~~devl~~L~~~Lg~  150 (240)
                      ++||++|||||||+|+|+++++..++++|+++|+||+++|+.|..+|+.|+|+++++|++|+++||+
T Consensus       179 ~~~DlllviGTSl~V~p~~~l~~~a~~~g~~~i~IN~~~t~~d~~~d~~i~g~~~e~l~~l~~~lgi  245 (245)
T d1yc5a1         179 SRASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGI  245 (245)
T ss_dssp             HHCSEEEEESCCSCEETGGGHHHHHHHHTCEEEEECSSCCTTGGGCSEEECSCHHHHHHHHHHHHTC
T ss_pred             hcCCEEEEECCCeEEechhhhhHHHHHcCCeEEEECCCCCCCCcceeEEEeCCHHHHHHHHHHHcCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999985
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure