Citrus Sinensis ID: 026286
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| 224063261 | 321 | predicted protein [Populus trichocarpa] | 0.9 | 0.672 | 0.733 | 8e-80 | |
| 356508073 | 321 | PREDICTED: F-box protein FBW2-like isofo | 0.916 | 0.685 | 0.695 | 1e-74 | |
| 449436998 | 318 | PREDICTED: F-box protein FBW2-like [Cucu | 0.925 | 0.698 | 0.646 | 4e-74 | |
| 255545780 | 329 | ubiquitin-protein ligase, putative [Rici | 0.937 | 0.683 | 0.663 | 3e-73 | |
| 225467167 | 317 | PREDICTED: F-box protein FBW2 isoform 1 | 0.891 | 0.675 | 0.643 | 2e-70 | |
| 147787397 | 225 | hypothetical protein VITISV_035646 [Viti | 0.816 | 0.871 | 0.608 | 4e-65 | |
| 18413178 | 317 | F-box protein FBW2 [Arabidopsis thaliana | 0.883 | 0.668 | 0.588 | 3e-64 | |
| 297813231 | 317 | F-box family protein [Arabidopsis lyrata | 0.883 | 0.668 | 0.575 | 3e-63 | |
| 359492882 | 296 | PREDICTED: F-box protein FBW2 [Vitis vin | 0.787 | 0.638 | 0.602 | 1e-61 | |
| 242065902 | 365 | hypothetical protein SORBIDRAFT_04g02735 | 0.895 | 0.589 | 0.565 | 4e-59 |
| >gi|224063261|ref|XP_002301066.1| predicted protein [Populus trichocarpa] gi|222842792|gb|EEE80339.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 302 bits (773), Expect = 8e-80, Method: Compositional matrix adjust.
Identities = 162/221 (73%), Positives = 182/221 (82%), Gaps = 5/221 (2%)
Query: 22 AGSLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCR 81
AGSLQTLR+PRS++ DSIV QIAGRLS VTFLD+SYC+KI ALEAIGKHCKLLV LCR
Sbjct: 104 AGSLQTLRIPRSDIGDSIVEQIAGRLSTVTFLDVSYCNKISGRALEAIGKHCKLLVGLCR 163
Query: 82 NMHPLDTADKLSQDDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGC 141
NMHPLDT +QDDEA AIA+TMPKLKRLEMAYH++STE +L+ILSSC LEF+DLRGC
Sbjct: 164 NMHPLDTEGLEAQDDEAYAIATTMPKLKRLEMAYHLVSTESLLQILSSCTNLEFMDLRGC 223
Query: 142 WDVKLDDKFMKGNFPNLKVLGPFVM-DYYEINDW-DDCSDYSDGSEYLAWEFLAGEMGDY 199
W+V LD+KF K F L VLGP VM DYYE NDW +DCS+YSD S+YLAW FLA G
Sbjct: 224 WNVNLDNKFFKEKFQKLTVLGPLVMEDYYEANDWEEDCSEYSDDSDYLAWGFLA-GDGGD 282
Query: 200 DDDDEIYEGMWDDEGRLEELELRFYDGIEEDAGIYGWPPSP 240
DDDE Y+ MWDDEGRLEELELRFY+G DAG+YGWPPSP
Sbjct: 283 YDDDESYDEMWDDEGRLEELELRFYEGA--DAGLYGWPPSP 321
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356508073|ref|XP_003522785.1| PREDICTED: F-box protein FBW2-like isoform 1 [Glycine max] gi|356508075|ref|XP_003522786.1| PREDICTED: F-box protein FBW2-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449436998|ref|XP_004136279.1| PREDICTED: F-box protein FBW2-like [Cucumis sativus] gi|449524052|ref|XP_004169037.1| PREDICTED: F-box protein FBW2-like isoform 1 [Cucumis sativus] gi|449524054|ref|XP_004169038.1| PREDICTED: F-box protein FBW2-like isoform 2 [Cucumis sativus] gi|449524056|ref|XP_004169039.1| PREDICTED: F-box protein FBW2-like isoform 3 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255545780|ref|XP_002513950.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547036|gb|EEF48533.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225467167|ref|XP_002269291.1| PREDICTED: F-box protein FBW2 isoform 1 [Vitis vinifera] gi|359496684|ref|XP_003635300.1| PREDICTED: F-box protein FBW2 isoform 2 [Vitis vinifera] gi|296085646|emb|CBI29445.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147787397|emb|CAN62342.1| hypothetical protein VITISV_035646 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18413178|ref|NP_567343.1| F-box protein FBW2 [Arabidopsis thaliana] gi|30680931|ref|NP_849346.1| F-box protein FBW2 [Arabidopsis thaliana] gi|42572853|ref|NP_974523.1| F-box protein FBW2 [Arabidopsis thaliana] gi|145332987|ref|NP_001078359.1| F-box protein FBW2 [Arabidopsis thaliana] gi|238480265|ref|NP_001154215.1| F-box protein FBW2 [Arabidopsis thaliana] gi|75267749|sp|Q9ZPE4.1|FBW2_ARATH RecName: Full=F-box protein FBW2; AltName: Full=SKP1-interacting partner 18 gi|4325371|gb|AAD17367.1| contains similarity to Medicago truncatula N7 protein (GB:Y17613) [Arabidopsis thaliana] gi|7267540|emb|CAB78022.1| putative protein [Arabidopsis thaliana] gi|21536818|gb|AAM61150.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|27311651|gb|AAO00791.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|30984530|gb|AAP42728.1| At4g08980 [Arabidopsis thaliana] gi|222423880|dbj|BAH19904.1| AT4G08980 [Arabidopsis thaliana] gi|332657303|gb|AEE82703.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657304|gb|AEE82704.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657305|gb|AEE82705.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657306|gb|AEE82706.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657307|gb|AEE82707.1| F-box protein FBW2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297813231|ref|XP_002874499.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320336|gb|EFH50758.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359492882|ref|XP_002285756.2| PREDICTED: F-box protein FBW2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242065902|ref|XP_002454240.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] gi|241934071|gb|EES07216.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| TAIR|locus:2122308 | 317 | FBW2 "AT4G08980" [Arabidopsis | 0.870 | 0.659 | 0.573 | 3.1e-60 | |
| TAIR|locus:2115949 | 302 | AT4G05460 "AT4G05460" [Arabido | 0.591 | 0.470 | 0.364 | 3.7e-14 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.625 | 0.5 | 0.327 | 1.9e-12 | |
| TAIR|locus:2118736 | 301 | AT4G30640 "AT4G30640" [Arabido | 0.625 | 0.498 | 0.275 | 2.4e-05 | |
| TAIR|locus:2140715 | 220 | AT4G03630 "AT4G03630" [Arabido | 0.420 | 0.459 | 0.349 | 9.9e-05 | |
| TAIR|locus:2115979 | 307 | AT4G05490 "AT4G05490" [Arabido | 0.495 | 0.387 | 0.307 | 0.00018 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.454 | 0.443 | 0.309 | 0.00043 |
| TAIR|locus:2122308 FBW2 "AT4G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 617 (222.3 bits), Expect = 3.1e-60, P = 3.1e-60
Identities = 128/223 (57%), Positives = 156/223 (69%)
Query: 22 AGSLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCR 81
AGSL+TL++PRS +++S V +A +LS++TFLDLSYC KIG A++AIGKHCK L CR
Sbjct: 105 AGSLKTLKVPRSGLTNSGVVNVAEKLSSLTFLDLSYCCKIGPEAIQAIGKHCKSLREFCR 164
Query: 82 NMHPLDTADKLSQDDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGC 141
NMHPLD A +S DDEA AIA+TMPKLKRLE+AYH +STE VLKILS C LEFL+LRGC
Sbjct: 165 NMHPLDVASVVSHDDEAYAIANTMPKLKRLEIAYHRVSTEGVLKILSCCVFLEFLELRGC 224
Query: 142 WDVKLDDKFMKGNFPNLKVLGPFVMDYYE-INDWDDC-SDY-SDGSEYLAWEFLAXXXXX 198
WDV+LD+KF K FP++KVLGP V+ +Y+ INDW+DC SDY SDGS+YLAWEF
Sbjct: 225 WDVQLDNKFFKEKFPDMKVLGPRVIGFYDMINDWEDCCSDYFSDGSDYLAWEFFEDGVMG 284
Query: 199 XXXXXXXXXXXWDDEGRXXXXXXRFY-DGIEEDAGIYGWPPSP 240
WDD FY + D + WPPSP
Sbjct: 285 EFYEDEFEHG-WDDN---------FYAENAVLDMEPHIWPPSP 317
|
|
| TAIR|locus:2115949 AT4G05460 "AT4G05460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118736 AT4G30640 "AT4G30640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_II0452 | SubName- Full=Putative uncharacterized protein; (322 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 7e-06 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 45.4 bits (108), Expect = 7e-06
Identities = 42/167 (25%), Positives = 64/167 (38%), Gaps = 18/167 (10%)
Query: 6 LDF-LCADVDLFPGSASAG-SLQTLRLPRS-EMSDSIVAQIAGRLSAVTFLDLSYCSKIG 62
L+ +C D S L+ L LP S + D + +A + LDL C I
Sbjct: 33 LELYMCPISDPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENIT 92
Query: 63 APALEAIGKHCKLLVVL----CRNMHPLDTADKLSQDDEANAIASTMPKLKRLEMAYHVI 118
+ A+ +C L + RN H L D +A+ L+ + A +
Sbjct: 93 DSGIVALATNCPKLQTINLGRHRNGH-------LITDVSLSALGKNCTFLQTVGFAGCDV 145
Query: 119 STEIVLKILSSCAL-LEFLDLRGCW---DVKLDDKFMKGNFPNLKVL 161
+ + V ++ S C+ LE L L C D + FPNL VL
Sbjct: 146 TDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVL 192
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.58 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.51 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.5 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.43 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.37 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.37 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.3 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.25 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.21 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.13 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.04 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.92 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.92 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.81 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.58 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.56 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.52 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 98.5 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.49 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.31 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.27 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.18 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.18 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.16 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.0 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.99 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.95 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.94 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.87 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.86 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.79 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.69 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.63 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.62 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.55 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.54 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.5 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.44 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.38 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.33 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.2 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.14 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.08 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.08 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.02 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.96 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.94 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.91 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.86 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.79 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.67 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.64 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.62 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.57 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.54 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.44 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.43 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.42 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 96.33 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 96.21 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.16 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.81 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.58 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.58 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.48 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.18 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.17 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 95.15 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 94.85 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.43 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 94.14 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 93.96 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.87 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 93.77 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.6 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 93.07 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.02 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 91.88 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.02 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 87.04 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 85.9 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 84.68 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 84.48 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.58 E-value=1.7e-15 Score=133.42 Aligned_cols=142 Identities=23% Similarity=0.298 Sum_probs=82.2
Q ss_pred ccccccc-cchhcHHHHHhCCCCCcEEEeeCC-CCCHHHHHHHHhcCccCcEEEecCCCCCCHHHHHHHHhcCCCCcEEE
Q 026286 3 LCLLDFL-CADVDLFPGSASAGSLQTLRLPRS-EMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLC 80 (240)
Q Consensus 3 l~~~~~~-~tD~~L~~i~~~~~~L~~L~L~~~-~itd~~l~~l~~~~~~L~~L~Ls~c~~it~~~l~~l~~~c~~L~~L~ 80 (240)
|.+.+|+ +-+.++...+.+||++++|.+.+| .||+..+..+++.|++|++|+|-.|..+|+..++.+++.||+|+.|+
T Consensus 143 LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lN 222 (483)
T KOG4341|consen 143 LSLRGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLN 222 (483)
T ss_pred ccccccccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhh
Confidence 4455555 555556666666666666666665 56666666666566666666666655566655555666666666666
Q ss_pred EeeccCCC-------------------CCc---------------------------cCChHHHHHHHhcCCCCCEEEee
Q 026286 81 RNMHPLDT-------------------ADK---------------------------LSQDDEANAIASTMPKLKRLEMA 114 (240)
Q Consensus 81 L~~~~~~~-------------------~~~---------------------------~~~d~~~~~i~~~~~~L~~L~L~ 114 (240)
++.++-.. .|+ .++|..+..++..+.+|+.|..+
T Consensus 223 lSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s 302 (483)
T KOG4341|consen 223 LSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYS 302 (483)
T ss_pred hccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhccc
Confidence 55433110 011 25556666666666666666666
Q ss_pred Ccc-cCHHHHHHHHhcCCcccEEeccCCCCC
Q 026286 115 YHV-ISTEIVLKILSSCALLEFLDLRGCWDV 144 (240)
Q Consensus 115 ~~~-it~~~l~~l~~~c~~Le~LdL~~C~~v 144 (240)
++. +++..+.++.++|++|++|-|++|.++
T Consensus 303 ~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~f 333 (483)
T KOG4341|consen 303 SCTDITDEVLWALGQHCHNLQVLELSGCQQF 333 (483)
T ss_pred CCCCCchHHHHHHhcCCCceEEEeccccchh
Confidence 665 666666666666666666666666655
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-14 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-05 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 69.5 bits (170), Expect = 4e-14
Identities = 33/142 (23%), Positives = 54/142 (38%), Gaps = 12/142 (8%)
Query: 24 SLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNM 83
LQ L L +SD IV +A + S + L+LS CS AL+ + C L L
Sbjct: 119 KLQNLSLEGLRLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELN--- 174
Query: 84 HPLDTADKLSQDDEANAIASTMPKLKRLEMA--YHVISTEIVLKILSSCALLEFLDLRGC 141
L ++ A+A + +L ++ + + ++ C L LDL
Sbjct: 175 --LSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS 232
Query: 142 WDVKLDDKFMK--GNFPNLKVL 161
V L + + L+ L
Sbjct: 233 --VMLKNDCFQEFFQLNYLQHL 252
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.73 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.71 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.7 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.66 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.61 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.59 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.55 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.52 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.49 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.48 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.47 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.38 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.32 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.25 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.21 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.2 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.19 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.19 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.19 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.17 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 99.17 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.09 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.09 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.02 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.88 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.88 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.88 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.87 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.85 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.85 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.84 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.83 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.81 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.81 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.79 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.78 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.78 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.77 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.77 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.76 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.76 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.76 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.74 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.73 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.71 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.71 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.7 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.7 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.69 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.69 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.68 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.68 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.68 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.68 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.67 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.66 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.65 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.62 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.62 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.61 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.61 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.6 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.6 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.59 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.59 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.58 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.58 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.57 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.57 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.56 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.55 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.55 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.54 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.54 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.54 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.54 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.54 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.54 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.52 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.52 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.52 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.52 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.51 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.51 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.49 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.49 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.48 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.48 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.47 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.46 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.46 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.45 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.45 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.44 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.44 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.43 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.42 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.42 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.42 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.41 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.41 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.41 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.4 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.4 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.39 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.38 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.38 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.38 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.37 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.36 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.35 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.35 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.34 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.34 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.33 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.33 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.33 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.32 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.27 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.27 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.27 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.26 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.25 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.2 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.11 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.06 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.03 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.02 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.02 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.02 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.99 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.91 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.9 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.9 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.89 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.81 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.68 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.68 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.67 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.67 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.59 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.5 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.45 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.3 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.28 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.25 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.9 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.69 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.37 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 93.21 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 90.67 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.35 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 88.65 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 88.44 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 83.05 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 82.76 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 81.51 |
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
Probab=99.73 E-value=3.6e-17 Score=144.97 Aligned_cols=132 Identities=15% Similarity=0.107 Sum_probs=67.5
Q ss_pred ccccccccchhcHHHHHhCC------------CCCcEEEeeCCCCCHHHHHHHH---hcCccCcEEEecCCCCCCHHHHH
Q 026286 3 LCLLDFLCADVDLFPGSASA------------GSLQTLRLPRSEMSDSIVAQIA---GRLSAVTFLDLSYCSKIGAPALE 67 (240)
Q Consensus 3 l~~~~~~~tD~~L~~i~~~~------------~~L~~L~L~~~~itd~~l~~l~---~~~~~L~~L~Ls~c~~it~~~l~ 67 (240)
|.|.++.+++.+...++... ++|++|+|++|.+++.++..++ ..+++|+.|+|++| .++..++.
T Consensus 127 L~L~~n~l~~~~~~~l~~~l~~l~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n-~l~~~g~~ 205 (386)
T 2ca6_A 127 LYLHNNGLGPQAGAKIARALQELAVNKKAKNAPPLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKMVQN-GIRPEGIE 205 (386)
T ss_dssp EECCSSCCHHHHHHHHHHHHHHHHHHHHHHTCCCCCEEECCSSCCTGGGHHHHHHHHHHCTTCCEEECCSS-CCCHHHHH
T ss_pred EECcCCCCCHHHHHHHHHHHHHHhhhhhcccCCCCcEEECCCCCCCcHHHHHHHHHHHhCCCcCEEECcCC-CCCHhHHH
Confidence 45555555555444443322 5666666666666554444322 24566666666664 45555544
Q ss_pred HHHh----cCCCCcEEEEeeccCCCCCccCChHHHHHHH---hcCCCCCEEEeeCcccCHHHHHHHHhc-----CCcccE
Q 026286 68 AIGK----HCKLLVVLCRNMHPLDTADKLSQDDEANAIA---STMPKLKRLEMAYHVISTEIVLKILSS-----CALLEF 135 (240)
Q Consensus 68 ~l~~----~c~~L~~L~L~~~~~~~~~~~~~d~~~~~i~---~~~~~L~~L~L~~~~it~~~l~~l~~~-----c~~Le~ 135 (240)
++.. .+++|+.|.|+.|.+ ++.++..++ ..+++|++|+|++|.|++.+...+... +++|++
T Consensus 206 ~l~~~~l~~~~~L~~L~Ls~n~l-------~~~g~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~~~L~~ 278 (386)
T 2ca6_A 206 HLLLEGLAYCQELKVLDLQDNTF-------THLGSSALAIALKSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQT 278 (386)
T ss_dssp HHHHTTGGGCTTCCEEECCSSCC-------HHHHHHHHHHHGGGCTTCCEEECTTCCCCHHHHHHHHHHHHTCSSCCCCE
T ss_pred HHHHHHhhcCCCccEEECcCCCC-------CcHHHHHHHHHHccCCCcCEEECCCCCCchhhHHHHHHHHhhccCCCeEE
Confidence 3332 456666666655432 333333222 344556666666666655544433321 555666
Q ss_pred EeccCCC
Q 026286 136 LDLRGCW 142 (240)
Q Consensus 136 LdL~~C~ 142 (240)
|+|++|.
T Consensus 279 L~L~~n~ 285 (386)
T 2ca6_A 279 LRLQYNE 285 (386)
T ss_dssp EECCSSC
T ss_pred EECcCCc
Confidence 6665554
|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.83 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.81 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.31 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.3 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.28 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.27 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.24 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.19 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.12 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.05 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.93 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.9 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.85 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.75 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.69 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.63 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.59 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.58 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.57 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.54 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.31 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.3 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.26 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.15 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.09 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.09 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.09 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.04 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.96 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.85 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.84 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.76 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.71 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.53 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.52 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.26 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.02 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.97 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.95 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.85 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.01 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83 E-value=2.9e-20 Score=157.18 Aligned_cols=155 Identities=21% Similarity=0.172 Sum_probs=130.4
Q ss_pred cccccccccchhcHHHHHhCCCCCcEEEeeCCCCCHHHHHHHHhcCccCcEEEecCCCCCCHHHHHHHHhcCCCCcEEEE
Q 026286 2 ALCLLDFLCADVDLFPGSASAGSLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCR 81 (240)
Q Consensus 2 ~l~~~~~~~tD~~L~~i~~~~~~L~~L~L~~~~itd~~l~~l~~~~~~L~~L~Ls~c~~it~~~l~~l~~~c~~L~~L~L 81 (240)
.|++++|.++++++..+..+|++|++|+|.+|.+++.++..++ ++++|+.|+|++|..+|+.++.++++.||+|++|++
T Consensus 50 ~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~l 128 (284)
T d2astb2 50 HMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNL 128 (284)
T ss_dssp EEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEEC
T ss_pred EEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhcccccc
Confidence 3678889999999999999999999999999999999998886 789999999999999999999999999999999999
Q ss_pred eeccCCCCCccCChHHHHH-HHhcCCCCCEEEeeCcc--cCHHHHHHHHhcCCcccEEeccCCCCCCCChHHHHhcCCCC
Q 026286 82 NMHPLDTADKLSQDDEANA-IASTMPKLKRLEMAYHV--ISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGNFPNL 158 (240)
Q Consensus 82 ~~~~~~~~~~~~~d~~~~~-i~~~~~~L~~L~L~~~~--it~~~l~~l~~~c~~Le~LdL~~C~~v~~~~~~l~~~~~~L 158 (240)
+.+. .+++.++.. ++..+++|++|+++++. +++.++..++.+||+|++|+|++|..++.........+++|
T Consensus 129 s~c~------~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L 202 (284)
T d2astb2 129 SWCF------DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYL 202 (284)
T ss_dssp CCCT------TCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTC
T ss_pred cccc------ccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcC
Confidence 7542 246666654 55556899999999864 89999999999999999999999998833222223567888
Q ss_pred ccccC
Q 026286 159 KVLGP 163 (240)
Q Consensus 159 ~~L~~ 163 (240)
++|..
T Consensus 203 ~~L~L 207 (284)
T d2astb2 203 QHLSL 207 (284)
T ss_dssp CEEEC
T ss_pred CEEEC
Confidence 88877
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|