Citrus Sinensis ID: 026324

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MGDHFVLLVDRLLTESTIEAAIESGNGSQQATPSAKDDRTAEFSTHRMDKSIGSSPSKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRRRHQQVNY
ccccEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccEEEEEEcccccccHHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccccEcccccccccccHHHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MGDHFVLLVDRLLTESTIEAAIesgngsqqatpsakddrtaefsthrmdksigsspsklvecricheededsnmeipcsccgslkyahRKCVQRWcnekgdttCEICreqynpgytappplfryggnfranweisgrdlhhnpqlitmvtgerefldsdfdeyytpssrsliCCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRRRHQQVNY
MGDHFVLLVDRLLTESTIEAAiesgngsqqatpsaKDDRTAEFsthrmdksigsspsklvECRICHeededsnmeiPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRrrhqqvny
MGDHFVLLVDRLLTESTIEAAIESGNGSQQATPSAKDDRTAEFSTHRMDKSIGSSPSKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSltlftllilrtigillPIYVMVKAFTAIQRRRHQQVNY
****FVLLVDRLLTEST******************************************VECRICH******NMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQ*********
MGDHFVLLVDRL*************************************************CRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQR*RHQ****
MGDHFVLLVDRLLTESTIEAAIE***********************************LVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQR********
*GDHFVLLVDRLLTESTIEA**E*********************************SKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRRRHQ****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDHFVLLVDRLLTESTIEAAIESGNGSQQATPSAKDDRTAEFSTHRMDKSIGSSPSKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRRRHQQVNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q0VD59289 E3 ubiquitin-protein liga yes no 0.6 0.498 0.261 8e-07
Q1LVZ2249 E3 ubiquitin-protein liga no no 0.366 0.353 0.274 1e-06
Q6NZQ8289 E3 ubiquitin-protein liga yes no 0.354 0.294 0.333 1e-06
Q8TCQ1289 E3 ubiquitin-protein liga yes no 0.354 0.294 0.333 1e-06
Q5T0T0291 E3 ubiquitin-protein liga no no 0.6 0.494 0.256 1e-06
Q9DBD2286 E3 ubiquitin-protein liga no no 0.237 0.199 0.396 1e-06
Q5I0I2246 E3 ubiquitin-protein liga no no 0.345 0.337 0.3 2e-06
Q3TZ87348 E3 ubiquitin-protein liga no no 0.216 0.149 0.384 2e-06
Q86YJ5346 E3 ubiquitin-protein liga no no 0.216 0.150 0.384 2e-06
Q28IK8264 E3 ubiquitin-protein liga no no 0.237 0.215 0.396 3e-06
>sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos taurus GN=MARCH8 PE=2 SV=1 Back     alignment and function desciption
 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 47/191 (24%)

Query: 55  SPSKLVECRICH-EEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNP 113
           +PS    CRICH E D++S +  PC C GSL + H+ C+Q+W        CE+C+ ++  
Sbjct: 71  TPSNQDICRICHCEGDDESPLITPCRCTGSLHFVHQTCLQQWIKSSDTRCCELCKYEF-I 129

Query: 114 GYTAPPPLFRYGGNFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLIC 173
             T   PL ++                   + + M + ER               R ++C
Sbjct: 130 METKLKPLRKW-------------------EKLQMTSSER---------------RKIMC 155

Query: 174 C---RIVAITFMVL---LVLRHTLPIIISG--AGEYSLTLFTLLILRTIGI---LLPIYV 222
                ++AIT +V    +++  T   I  G   G      +T L++  IG    LL +YV
Sbjct: 156 SVTFHVIAITCVVWSLYVLIDRTAEEIRQGQATGILEWPFWTKLVVVAIGFTGGLLFMYV 215

Query: 223 MVKAFTAIQRR 233
             K +  + RR
Sbjct: 216 QCKVYVQLWRR 226
E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 Back     alignment and function description
>sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo sapiens GN=MARCH8 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 Back     alignment and function description
>sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus norvegicus GN=March2 PE=1 SV=1 Back     alignment and function description
>sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 Back     alignment and function description
>sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 Back     alignment and function description
>sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
225453082262 PREDICTED: uncharacterized protein LOC10 0.983 0.900 0.733 1e-100
224079395237 predicted protein [Populus trichocarpa] 0.966 0.978 0.720 4e-94
255583763209 membrane associated ring finger 1,8, put 0.854 0.980 0.765 4e-91
224065214230 predicted protein [Populus trichocarpa] 0.920 0.960 0.701 5e-89
224110782223 predicted protein [Populus trichocarpa] 0.904 0.973 0.697 8e-87
224101805233 predicted protein [Populus trichocarpa] 0.962 0.991 0.615 7e-81
356536224271 PREDICTED: uncharacterized protein LOC10 0.983 0.870 0.591 2e-79
297737730277 unnamed protein product [Vitis vinifera] 0.904 0.783 0.638 3e-79
449466288271 PREDICTED: uncharacterized protein LOC10 0.970 0.859 0.611 1e-78
357444557266 E3 ubiquitin-protein ligase MARCH2 [Medi 0.970 0.875 0.591 1e-77
>gi|225453082|ref|XP_002270912.1| PREDICTED: uncharacterized protein LOC100258737 [Vitis vinifera] gi|296087202|emb|CBI33576.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 195/240 (81%), Gaps = 4/240 (1%)

Query: 1   MGDHFVLLVDRLLTESTIEAAIESGNGSQQATPSAKDDRTAEFSTHRMDKSIGSSPSKLV 60
           MGDHFVLLVDRLLTEST+EAAIES N  Q  TP   +D    FS HRMD  IG S   LV
Sbjct: 1   MGDHFVLLVDRLLTESTLEAAIESKNQWQHTTPCGSEDMMTNFSAHRMDVDIGPSQRILV 60

Query: 61  ECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPP 120
           +CRICH+EDEDSNME+PCSC GSLKYAHR CVQRWCNEKG+TTCEIC +Q+ P YTAPPP
Sbjct: 61  QCRICHDEDEDSNMEVPCSCAGSLKYAHRGCVQRWCNEKGNTTCEICHQQFRPNYTAPPP 120

Query: 121 LFRYGG---NFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIV 177
           LF YGG   NFR NWE+S RD +H P+ I MV  +R FLD+D DEY  P+SRS+ICCRIV
Sbjct: 121 LFHYGGIPMNFRGNWEVSRRDANH-PRFIAMVASDRNFLDTDIDEYPAPNSRSVICCRIV 179

Query: 178 AITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFTAIQRRRHQQ 237
           AI FM+LLVLRHTLPIIISGAGEYS TLFTLL+LR IGILLP+Y+MVKA TA QRRRHQQ
Sbjct: 180 AIIFMILLVLRHTLPIIISGAGEYSFTLFTLLMLRAIGILLPVYIMVKACTAFQRRRHQQ 239

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224079395|ref|XP_002305850.1| predicted protein [Populus trichocarpa] gi|222848814|gb|EEE86361.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583763|ref|XP_002532634.1| membrane associated ring finger 1,8, putative [Ricinus communis] gi|223527625|gb|EEF29737.1| membrane associated ring finger 1,8, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224065214|ref|XP_002301720.1| predicted protein [Populus trichocarpa] gi|222843446|gb|EEE80993.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110782|ref|XP_002333030.1| predicted protein [Populus trichocarpa] gi|222834466|gb|EEE72943.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101805|ref|XP_002312427.1| predicted protein [Populus trichocarpa] gi|222852247|gb|EEE89794.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536224|ref|XP_003536639.1| PREDICTED: uncharacterized protein LOC100792304 [Glycine max] Back     alignment and taxonomy information
>gi|297737730|emb|CBI26931.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449466288|ref|XP_004150858.1| PREDICTED: uncharacterized protein LOC101213226 [Cucumis sativus] gi|449523283|ref|XP_004168653.1| PREDICTED: uncharacterized LOC101213226 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357444557|ref|XP_003592556.1| E3 ubiquitin-protein ligase MARCH2 [Medicago truncatula] gi|355481604|gb|AES62807.1| E3 ubiquitin-protein ligase MARCH2 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:504956090259 AT2G01275 [Arabidopsis thalian 0.937 0.868 0.487 6.1e-55
TAIR|locus:2144441259 AT5G38070 [Arabidopsis thalian 0.929 0.861 0.454 1.3e-50
TAIR|locus:2154109307 AT5G62460 [Arabidopsis thalian 0.916 0.716 0.407 9.6e-41
TAIR|locus:2079112288 AT3G47550 [Arabidopsis thalian 0.966 0.805 0.376 1.4e-39
TAIR|locus:2012477265 AT1G14260 [Arabidopsis thalian 0.945 0.856 0.359 1.9e-35
TAIR|locus:2056710275 AT2G02960 [Arabidopsis thalian 0.579 0.505 0.496 5.1e-35
TAIR|locus:505006426218 PIT1 "pitchoun 1" [Arabidopsis 0.708 0.779 0.356 3.4e-29
ZFIN|ZDB-GENE-070912-276339 si:ch211-283p23.1 "si:ch211-28 0.4 0.283 0.333 7.2e-11
UNIPROTKB|D6REN1141 MARCH1 "E3 ubiquitin-protein l 0.354 0.602 0.344 5.2e-10
ZFIN|ZDB-GENE-070112-1712231 zgc:158785 "zgc:158785" [Danio 0.370 0.385 0.336 1.1e-09
TAIR|locus:504956090 AT2G01275 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
 Identities = 117/240 (48%), Positives = 149/240 (62%)

Query:     1 MGDHFVLLVDRLLTESTIEAAIESGNGSQQATPSAKDDRTAEFSTHRMDKSIGSSPSKLV 60
             MGDHFVLLVDRL+TESTIEAAI+S N   QA    ++    +  T  M   + +    + 
Sbjct:     1 MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDKTLEM---LRNGDLSMA 57

Query:    61 ECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNPGYTAPPP 120
             ECRICH+ED DSNME PCSC GS+KYAHR+CVQRWCNEKGDTTCEIC +++ P YTAPPP
Sbjct:    58 ECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCEICHQEFKPDYTAPPP 117

Query:   121 LFRYGG---NFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIV 177
             L   G    +FR NW IS R+  H  + IT+V  +  F+D     Y   S+ S ICCR +
Sbjct:   118 LLELGHVPLHFRGNWGISQRE--H--RFITVVPADSTFIDQP---YPLSSTTSFICCRSL 170

Query:   178 AITFMVLLVLRHTLPIIISGAGEYSXXXXXXXXXXXXXXXXPIYVMVKAFTAIQRRRHQQ 237
              + FM LL+LRHTLP++++G+  +                 PIYV+ KA      RRH +
Sbjct:   171 VLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTKAVATC--RRHSR 228
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2144441 AT5G38070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154109 AT5G62460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079112 AT3G47550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012477 AT1G14260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056710 AT2G02960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006426 PIT1 "pitchoun 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-276 si:ch211-283p23.1 "si:ch211-283p23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D6REN1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1712 zgc:158785 "zgc:158785" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022320001
SubName- Full=Chromosome chr14 scaffold_26, whole genome shotgun sequence; (234 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
pfam12428118 pfam12428, DUF3675, Protein of unknown function (D 7e-57
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 7e-19
pfam1290647 pfam12906, RINGv, RING-variant domain 8e-16
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 4e-11
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 6e-05
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 6e-05
>gnl|CDD|221572 pfam12428, DUF3675, Protein of unknown function (DUF3675) Back     alignment and domain information 
 Score =  176 bits (449), Expect = 7e-57
 Identities = 65/119 (54%), Positives = 84/119 (70%), Gaps = 4/119 (3%)

Query: 113 PGYTAPPPLFRYGG---NFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSR 169
           PGYTAPP LF+ G      R NWEIS RDL  +P+L+ M   ER+FL++++DEY   +  
Sbjct: 1   PGYTAPPKLFQPGETAITIRGNWEISRRDLR-DPRLLAMAEAERQFLEAEYDEYAAANPS 59

Query: 170 SLICCRIVAITFMVLLVLRHTLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFT 228
              CCR VA+ FMVLL+LRH LP+++ GA +YS TLFTLL+LR  GILLP Y+M +A T
Sbjct: 60  GAACCRSVALIFMVLLLLRHALPVVLGGADDYSFTLFTLLLLRAAGILLPCYIMARAIT 118

This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with pfam00097. There are two completely conserved residues (R and L) that may be functionally important. Length = 118
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
PF12428118 DUF3675: Protein of unknown function (DUF3675) ; I 100.0
KOG1609323 consensus Protein involved in mRNA turnover and st 99.82
PHA02825162 LAP/PHD finger-like protein; Provisional 99.8
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.69
PHA02862156 5L protein; Provisional 99.68
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.66
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.47
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.47
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.5
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.21
PHA02929238 N1R/p28-like protein; Provisional 97.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.98
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.85
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.69
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.44
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.35
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.33
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.31
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.19
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.11
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.1
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 95.69
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 95.56
PHA02926242 zinc finger-like protein; Provisional 95.55
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.86
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.49
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 94.31
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 93.67
COG52191525 Uncharacterized conserved protein, contains RING Z 92.46
KOG149384 consensus Anaphase-promoting complex (APC), subuni 91.77
PF1463444 zf-RING_5: zinc-RING finger domain 91.66
PF06210108 DUF1003: Protein of unknown function (DUF1003); In 90.56
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 90.55
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 90.49
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 89.47
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 89.08
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 87.9
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 87.79
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 87.01
PLN02189 1040 cellulose synthase 81.52
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 80.14
PLN02436 1094 cellulose synthase A 80.01
>PF12428 DUF3675: Protein of unknown function (DUF3675) ; InterPro: IPR022143 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information 
Probab=100.00  E-value=2.6e-44  Score=291.16  Aligned_cols=115  Identities=55%  Similarity=1.055  Sum_probs=112.2

Q ss_pred             cCccCCCCcccccc---ccCCCcccccccCCCCCeeeeeecccccccCCCCccccCCCCCcchhHHHHHHHHHHHHHHhh
Q 026324          113 PGYTAPPPLFRYGG---NFRANWEISGRDLHHNPQLITMVTGEREFLDSDFDEYYTPSSRSLICCRIVAITFMVLLVLRH  189 (240)
Q Consensus       113 ~~yt~p~~~~~~~~---~~~~~w~~~~~dl~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~Crs~ai~~m~lLllrh  189 (240)
                      |+||+|+|+++.++   ++|++|+++++|+|+ ||+++|+++|++++++||++|+++|++|++||||+|||||+||||||
T Consensus         1 PgYTaPp~~~~~~~~~i~ir~~we~~~~d~~~-~~~~a~~~ae~~~l~~~y~e~~~~~~~~a~~CRsvAli~m~LLllRh   79 (118)
T PF12428_consen    1 PGYTAPPKKFQPGETAIDIRGNWEISRRDLRD-PRFLAMAAAERQFLESEYDEYAASNTRGAACCRSVALIFMVLLLLRH   79 (118)
T ss_pred             CCCCCCCCCCCcCccceEecCCccccccCccc-hhhhhhhhhhhhccccccccccccCCCceeHHHHHHHHHHHHHHHHH
Confidence            68999999999998   899999999999998 99999999999999999999999999999999999999999999999


Q ss_pred             hhhhhccCCCchhHHHHHHHHHHHHhhHHHHHHHHHHHH
Q 026324          190 TLPIIISGAGEYSLTLFTLLILRTIGILLPIYVMVKAFT  228 (240)
Q Consensus       190 ~~~~~~~~~~~~~~~~ft~~llraaGillP~Yi~~rai~  228 (240)
                      +++++++|+|+|+|++||+++|||+|||||||||+|+|+
T Consensus        80 al~l~~~~~~~~s~~lftl~~LRaaGilLP~Yim~rais  118 (118)
T PF12428_consen   80 ALALVTGGAEDYSFTLFTLLLLRAAGILLPCYIMARAIS  118 (118)
T ss_pred             HHHHhcCCcccccHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999984

The family is found in association with PF00097 from PFAM. There are two completely conserved residues (R and L) that may be functionally important.
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF06210 DUF1003: Protein of unknown function (DUF1003); InterPro: IPR010406 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 1e-06
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
Query: 55  SPSKLVECRICH-EEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQY 111
           +PS    CRICH E D++S +  PC C GSL + H+ C+Q+W        CE+C+ ++
Sbjct: 11  TPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEF 68

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-20
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-04
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 80.5 bits (199), Expect = 2e-20
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 62  CRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYN 112
           C IC+EE  +      C C G L+  HR C+  W     +T C+IC   YN
Sbjct: 9   CWICNEELGN-ERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN 58
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.76
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.68
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.09
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.02
2ect_A78 Ring finger protein 126; metal binding protein, st 97.91
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.9
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.88
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.88
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.77
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.75
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.75
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.71
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.65
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.65
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.63
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.58
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.58
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.57
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.55
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.54
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.51
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.49
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.45
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.44
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.43
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.4
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.38
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.36
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.3
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.99
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.96
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.94
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.85
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.8
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.77
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.77
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.7
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.62
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.43
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.42
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.39
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.36
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.36
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.11
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.75
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.65
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.33
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 94.8
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 94.76
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 94.65
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 94.53
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.45
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 94.45
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 94.38
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.33
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 94.27
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 94.17
3nw0_A238 Non-structural maintenance of chromosomes element 93.27
2ea5_A68 Cell growth regulator with ring finger domain prot 93.25
2f42_A179 STIP1 homology and U-box containing protein 1; cha 93.02
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 92.73
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 92.55
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 86.81
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 85.6
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 83.6
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 83.28
1weu_A91 Inhibitor of growth family, member 4; structural g 82.36
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 81.57
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.76  E-value=2.7e-19  Score=127.59  Aligned_cols=56  Identities=34%  Similarity=0.777  Sum_probs=50.7

Q ss_pred             CCCCeeeEeccCCCCCCcccccccCCCcccccHHHHHHHHHHhCCcccccccccccc
Q 026324           57 SKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNP  113 (240)
Q Consensus        57 ~~~~~CRIC~e~~~d~~L~~PC~C~GslkyvH~~CL~~W~~~k~~~~CEiCk~~y~~  113 (240)
                      ++...||||+++.+ ++++.||.|+|++||||+.||++|++++++.+||+|+++|+.
T Consensus         4 ~~~~~CrIC~~~~~-~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            4 EDVPVCWICNEELG-NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEECS-CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCEeEEeecCCC-CceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            46679999998754 468999999999999999999999999999999999999975
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 5e-04
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 6e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.002
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.002
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 50.2 bits (119), Expect = 2e-09
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 62  CRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYN 112
           C IC+EE  +      C C G L+  HR C+  W     +T C+IC   YN
Sbjct: 9   CWICNEELGN-ERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN 58
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.52
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.05
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.01
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.89
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.87
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.6
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.58
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.11
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.1
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.84
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.61
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.01
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 94.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 93.73
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 93.41
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 93.38
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 82.46
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.52  E-value=3.2e-15  Score=103.82  Aligned_cols=56  Identities=34%  Similarity=0.777  Sum_probs=50.5

Q ss_pred             CCCCeeeEeccCCCCCCcccccccCCCcccccHHHHHHHHHHhCCcccccccccccc
Q 026324           57 SKLVECRICHEEDEDSNMEIPCSCCGSLKYAHRKCVQRWCNEKGDTTCEICREQYNP  113 (240)
Q Consensus        57 ~~~~~CRIC~e~~~d~~L~~PC~C~GslkyvH~~CL~~W~~~k~~~~CEiCk~~y~~  113 (240)
                      ++...|+||+++.+ ++++.||.|+|+.+++|+.||++|++.+++.+|++|+++|+.
T Consensus         4 ed~~~C~IC~~~~~-~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           4 EDVPVCWICNEELG-NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEECS-CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCccCCccCC-CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            36678999998764 478899999999999999999999999999999999999975
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure