Citrus Sinensis ID: 026366

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MNPNPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccccccccccccccccHHccccccccccccEEEEEccccccccHHHHccccccccccccHHcEEEEEEc
ccccccccccEEEccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccHHHHccccccccccHHHHHccccccccHHHcccccEEEEEEEcccEEEccccHHHHccccccHcccccEEEEEcc
mnpnpvstglrlsyeddehnssvtsaCENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQgslhvkegcgdsevddaasrtnlNYLSvvdgsgnsspmKMQMICRACNIQEVSILLlpcrhlclckdcegligvcpvcKAMRTASVEVYLS
MNPNPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEgnlikgvremkQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
MNPNPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
**************************CENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVK****************LNYLSVV**********MQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVY**
***NPVS*GLR**********************************LEIGRQKEEFDQYVRIQEG********************IEKE************EVMNCKNKELVEKIKQVSMEVQSWHY************************************************************KMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
********GLRLSYED********SACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
******S*****************************ILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYNESVVNALKNNLKQAVAQGSLH************************************QMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPNPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMExxxxxxxxxxxxxxxxxxxxxVQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
Q13489604 Baculoviral IAP repeat-co yes no 0.225 0.089 0.370 2e-06
O08863600 Baculoviral IAP repeat-co yes no 0.230 0.091 0.370 2e-06
Q90660611 Inhibitor of apoptosis pr yes no 0.284 0.111 0.337 3e-06
Q62210612 Baculoviral IAP repeat-co no no 0.292 0.114 0.32 3e-06
Q13490618 Baculoviral IAP repeat-co no no 0.292 0.113 0.306 3e-06
O62640358 Putative inhibitor of apo no no 0.200 0.134 0.416 5e-06
A1E2V0604 Baculoviral IAP repeat-co no no 0.225 0.089 0.351 5e-06
Q8JHV9401 Baculoviral IAP repeat-co N/A no 0.225 0.134 0.351 1e-05
A9ULZ2345 Baculoviral IAP repeat-co N/A no 0.225 0.156 0.351 2e-05
A9JTP3365 Baculoviral IAP repeat-co no no 0.225 0.147 0.333 0.0001
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%)

Query: 186 MKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS 239
           ++ +  C+ C  +EVSI+ +PC HL +CKDC   +  CP+C++    +V  +LS
Sbjct: 551 LQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 604
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF1, and BCL10. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 Back     alignment and function description
>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus GN=ITA PE=2 SV=1 Back     alignment and function description
>sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 Back     alignment and function description
>sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens GN=BIRC2 PE=1 SV=2 Back     alignment and function description
>sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa GN=PIAP PE=2 SV=1 Back     alignment and function description
>sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein 3 OS=Canis familiaris GN=BIRC3 PE=2 SV=1 Back     alignment and function description
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description
>sp|A9JTP3|BIRC7_XENTR Baculoviral IAP repeat-containing protein 7 OS=Xenopus tropicalis GN=birc7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
225457007334 PREDICTED: uncharacterized protein LOC10 1.0 0.715 0.698 1e-94
147841524 360 hypothetical protein VITISV_003762 [Viti 1.0 0.663 0.698 2e-94
147822224 346 hypothetical protein VITISV_032504 [Viti 0.995 0.687 0.606 8e-80
356502299337 PREDICTED: uncharacterized protein LOC10 0.995 0.706 0.588 1e-78
297739068335 unnamed protein product [Vitis vinifera] 0.937 0.668 0.616 3e-78
356497708337 PREDICTED: uncharacterized protein LOC10 0.995 0.706 0.592 5e-78
224121714 357 predicted protein [Populus trichocarpa] 1.0 0.669 0.566 6e-78
255540641301 ATP binding protein, putative [Ricinus c 0.987 0.784 0.598 1e-77
224107815339 predicted protein [Populus trichocarpa] 0.995 0.702 0.581 2e-77
297837447338 protein binding protein [Arabidopsis lyr 0.945 0.668 0.542 8e-70
>gi|225457007|ref|XP_002282390.1| PREDICTED: uncharacterized protein LOC100262147 [Vitis vinifera] gi|297733767|emb|CBI15014.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 167/239 (69%), Positives = 203/239 (84%)

Query: 1   MNPNPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVR 60
           +NPNPVSTGL+LSYE+DEHNSS+TSA ++++ A+P I SLGDNLK EI RQKEEFD Y+R
Sbjct: 96  LNPNPVSTGLKLSYEEDEHNSSITSASDSMTAALPVISSLGDNLKSEIDRQKEEFDHYIR 155

Query: 61  IQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSME 120
           +QE N+IKGVRE+KQR T SFLS+IEK VG++L  KE EIE MN KNKELVE++KQV+ME
Sbjct: 156 VQEENIIKGVRELKQRQTVSFLSSIEKGVGKKLREKEFEIENMNRKNKELVERVKQVTME 215

Query: 121 VQSWHYKAKYNESVVNALKNNLKQAVAQGSLHVKEGCGDSEVDDAASRTNLNYLSVVDGS 180
           VQSWHY+AKYNES+VN LK+NLKQ +AQG++  KEGCGDSEVDDAAS T+   L VV  S
Sbjct: 216 VQSWHYRAKYNESLVNVLKSNLKQVLAQGAMQGKEGCGDSEVDDAASYTDHIQLGVVGCS 275

Query: 181 GNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS 239
           GN + MK Q+ CRAC ++EVS+LLLPCRHLCLC DCEG I VCPVC+ M+TASV+V++S
Sbjct: 276 GNPTSMKKQVNCRACKVREVSVLLLPCRHLCLCMDCEGFIDVCPVCRVMKTASVQVFMS 334

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147841524|emb|CAN75320.1| hypothetical protein VITISV_003762 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822224|emb|CAN63942.1| hypothetical protein VITISV_032504 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502299|ref|XP_003519957.1| PREDICTED: uncharacterized protein LOC100790534 [Glycine max] Back     alignment and taxonomy information
>gi|297739068|emb|CBI28557.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497708|ref|XP_003517701.1| PREDICTED: uncharacterized protein LOC100791550 isoform 1 [Glycine max] gi|356497710|ref|XP_003517702.1| PREDICTED: uncharacterized protein LOC100791550 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|224121714|ref|XP_002318654.1| predicted protein [Populus trichocarpa] gi|222859327|gb|EEE96874.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540641|ref|XP_002511385.1| ATP binding protein, putative [Ricinus communis] gi|223550500|gb|EEF51987.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224107815|ref|XP_002314611.1| predicted protein [Populus trichocarpa] gi|222863651|gb|EEF00782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297837447|ref|XP_002886605.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297332446|gb|EFH62864.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.970 0.684 0.533 4.5e-66
TAIR|locus:2036596340 AT1G60610 [Arabidopsis thalian 0.937 0.658 0.528 2.3e-62
TAIR|locus:2825812325 SBP1 "S-ribonuclease binding p 0.899 0.661 0.388 1.5e-37
TAIR|locus:2035564312 AT1G32740 "AT1G32740" [Arabido 0.895 0.685 0.317 4.6e-25
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.895 0.681 0.301 1.2e-24
TAIR|locus:2171042300 AT5G47050 [Arabidopsis thalian 0.928 0.74 0.322 1.6e-24
TAIR|locus:2131571265 AT4G35070 "AT4G35070" [Arabido 0.778 0.701 0.33 1.4e-23
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.949 0.746 0.302 3.4e-22
TAIR|locus:2089225335 BRG3 "BOI-related gene 3" [Ara 0.845 0.602 0.295 3e-21
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.807 0.656 0.349 1.3e-20
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 672 (241.6 bits), Expect = 4.5e-66, P = 4.5e-66
 Identities = 129/242 (53%), Positives = 180/242 (74%)

Query:     4 NPVSTGLRLSYEDDEHNSSVTSACENISGAIPHILSLGDNLKLEIGRQKEEFDQYVRIQE 63
             N VSTGLRLSY+DDEHNSSVTSA  +I  A P   SL D+L++++ RQK+EFDQ+++IQ 
Sbjct:   102 NLVSTGLRLSYDDDEHNSSVTSASGSILAASPIFQSLDDSLRIDLHRQKDEFDQFIKIQA 161

Query:    64 GNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQS 123
               + KGVR+MKQRH  SFL+ +EK V ++L  K+ EI  MN KNKELVE+IKQV+ME Q+
Sbjct:   162 AQMAKGVRDMKQRHIASFLTTLEKGVSKKLQEKDHEINDMNKKNKELVERIKQVAMEAQN 221

Query:   124 WHYKAKYNESVVNALKNNLKQAVAQGSLHV------KEGCGDSEVDDAASRTNLNYLSVV 177
             WHY+AKYNESVVN LK NL+QA++  +  +      KEG GDSE+DDAAS    +Y+   
Sbjct:   222 WHYRAKYNESVVNVLKANLQQAMSHNNSVIAAADQGKEGFGDSEIDDAAS----SYIDPN 277

Query:   178 DGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVY 237
             + + N+  +  +M C+ CN++EVS+L++PCRHL LCK+C+    +CPVCK+++++ V+V+
Sbjct:   278 NNNNNNMGIHQRMRCKMCNVKEVSVLIVPCRHLSLCKECDVFTKICPVCKSLKSSCVQVF 337

Query:   238 LS 239
              S
Sbjct:   338 FS 339
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2036596 AT1G60610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825812 SBP1 "S-ribonuclease binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035564 AT1G32740 "AT1G32740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171042 AT5G47050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131571 AT4G35070 "AT4G35070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089225 BRG3 "BOI-related gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 1e-07
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 46.6 bits (111), Expect = 1e-07
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 189 QMICRACNIQEVSILLLPCRHLCLCKDCEGLI---GVCPVCKA 228
             +C  C  +  +++ LPC HLCLC++C   +     CP+C+ 
Sbjct: 2   DDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPICRQ 44

Length = 49

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.34
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.2
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.19
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.0
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.58
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.96
PF1463444 zf-RING_5: zinc-RING finger domain 97.95
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.91
PHA02929238 N1R/p28-like protein; Provisional 97.83
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.72
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.71
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.68
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.61
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.6
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.56
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.48
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.46
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.38
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.36
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 97.23
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.19
PHA02926242 zinc finger-like protein; Provisional 97.11
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.87
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.85
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.85
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.8
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.65
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.59
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.57
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.36
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.84
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.62
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.61
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.24
KOG1103 561 consensus Predicted coiled-coil protein [Function 94.88
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 94.72
PF04641260 Rtf2: Rtf2 RING-finger 94.16
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.03
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 93.88
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 93.88
KOG2113394 consensus Predicted RNA binding protein, contains 93.52
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 93.4
COG5152259 Uncharacterized conserved protein, contains RING a 92.9
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.66
KOG3002 299 consensus Zn finger protein [General function pred 92.17
KOG3039303 consensus Uncharacterized conserved protein [Funct 91.99
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.22
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 90.95
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 90.31
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 90.2
KOG0825 1134 consensus PHD Zn-finger protein [General function 89.28
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.38
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 87.29
KOG0971 1243 consensus Microtubule-associated protein dynactin 87.27
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.85
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 86.56
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 86.35
KOG3091508 consensus Nuclear pore complex, p54 component (sc 85.21
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 84.71
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 82.94
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 82.83
KOG0288 459 consensus WD40 repeat protein TipD [General functi 81.51
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 80.53
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 80.51
PF14362301 DUF4407: Domain of unknown function (DUF4407) 80.43
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.7e-37  Score=263.53  Aligned_cols=186  Identities=38%  Similarity=0.681  Sum_probs=164.0

Q ss_pred             HHHHHHhhHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcchHHHHHHHHHHHHHHHHHHHhHHHHH
Q 026366           43 NLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEMEIEVMNCKNKELVEKIKQVSMEVQ  122 (239)
Q Consensus        43 ~l~~~l~~q~~eid~~l~~q~e~lr~~l~e~r~r~~r~Ll~~~e~~~~~rlreke~Eie~~~~~n~eLeErl~ql~~E~q  122 (239)
                      ++.+++++|..+||+|+..|.++||..+.+.++++++.++.++|+.+.+++++|+.||++++++|++|+++++++.+|++
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            78889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhhhhHHHHHHHHHhHHHHHHhc----c--cccccCCCCCcccchhh-hcccccccccCCCCCCCCcccccccccc
Q 026366          123 SWHYKAKYNESVVNALKNNLKQAVAQG----S--LHVKEGCGDSEVDDAAS-RTNLNYLSVVDGSGNSSPMKMQMICRAC  195 (239)
Q Consensus       123 ~Wq~~A~~~Ea~~~~Lr~~Lqq~~~~~----~--~~~~eg~g~se~dda~S-~~~~~~~~~~~~~~~~~~~~~~~~C~iC  195 (239)
                      .|+++|++||+.++.|+.+|+|++.+.    .  +.+.++.|+.+.+|+.| +.+++..          .+.....|+.|
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~~~~~~~~~~~~~~~g~~~~~~~~s~~~~~~~~----------~~~~~~~Cr~C  164 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQCPASAPAEERGQKSCGDREADDGKSSYVDPSVD----------NFKRMRSCRKC  164 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhcccccCchhhhccccCccccccccccccchhhh----------hhhccccceec
Confidence            999999999999999999999998874    1  12223467777777775 4433321          11122239999


Q ss_pred             cccccceEEeCCCCcccccchHhcCCCCCCCcccccceEEEee
Q 026366          196 NIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYL  238 (239)
Q Consensus       196 ~~~~~~vlllPC~Hlc~C~~C~~~l~~CPvCr~~i~~~v~v~~  238 (239)
                      ..++++|+|+||+|+|+|..|...+..||+|+.+++++++||+
T Consensus       165 ~~~~~~VlllPCrHl~lC~~C~~~~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  165 GEREATVLLLPCRHLCLCGICDESLRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             CcCCceEEeecccceEecccccccCccCCCCcChhhceeeccC
Confidence            9999999999999999999999889999999999999999986

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 2e-07
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 4e-07
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 3e-04
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 4e-04
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 5/75 (6%)
Query: 170 NLNYLSVVDGSGNSSPMKMQMI-----CRACNIQEVSILLLPCRHLCLCKDCEGLIGVCP 224
           N+ Y+   D SG S   +++ +     C+ C  +EVS++ +PC HL +C++C   +  CP
Sbjct: 271 NMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCP 330
Query: 225 VCKAMRTASVEVYLS 239
           +C+ +   +V  +LS
Sbjct: 331 ICRGIIKGTVRTFLS 345
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-15
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 1e-11
2ea5_A68 Cell growth regulator with ring finger domain prot 5e-11
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 1e-10
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 8e-04
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
 Score = 73.1 bits (177), Expect = 3e-15
 Identities = 31/202 (15%), Positives = 84/202 (41%), Gaps = 10/202 (4%)

Query: 39  SLGDNLKLEIGRQKEEFDQYVRIQEGNLIKGVREMKQRHTYSFLSAIEKEVGRRLHGKEM 98
           ++ D +   +  + E+ ++    Q   +      + +++  +    +   +   +    +
Sbjct: 153 TVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVL--PILDNLL 210

Query: 99  EIEVMNCKNKELVEKIKQVSMEVQSWHYKAKYN-ESVVNALKNNLKQAVAQGSLHVKEGC 157
           +  V+N +  +++++  Q+ ++ +           +  N  KN+LK+             
Sbjct: 211 KANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNSLKE-------IDSTLY 263

Query: 158 GDSEVDDAASRTNLNYLSVVDGSGNSSPMKMQMICRACNIQEVSILLLPCRHLCLCKDCE 217
            +  VD          +S +        ++ +  C+ C  +EVS++ +PC HL +C++C 
Sbjct: 264 KNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECA 323

Query: 218 GLIGVCPVCKAMRTASVEVYLS 239
             +  CP+C+ +   +V  +LS
Sbjct: 324 PSLRKCPICRGIIKGTVRTFLS 345
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
2ea5_A68 Cell growth regulator with ring finger domain prot 99.49
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.45
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.43
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.42
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.4
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.37
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.13
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.72
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.56
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.55
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.54
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.51
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.5
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.47
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.44
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.43
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.41
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.4
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.38
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.37
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.37
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.36
2ect_A78 Ring finger protein 126; metal binding protein, st 98.34
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.34
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.33
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.32
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.3
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.27
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.26
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.25
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.23
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.22
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.19
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.17
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.16
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.15
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.11
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.04
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.03
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.02
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.99
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.85
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.76
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.72
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.69
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.61
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.58
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.53
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.38
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.37
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.35
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.29
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.18
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.83
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.64
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.63
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.46
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.37
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 95.42
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.86
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 92.08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 91.9
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 91.47
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 90.93
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 90.14
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 90.11
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 90.03
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 89.11
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 88.48
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.47
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 87.18
2wvr_A209 Geminin; DNA replication license, DNA replication 85.9
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.69
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 80.86
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 80.84
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 80.42
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.49  E-value=1.7e-14  Score=102.81  Aligned_cols=52  Identities=33%  Similarity=0.760  Sum_probs=48.7

Q ss_pred             cccccccccccccceEEeCCCCcccccchHhcCCCCCCCcccccceEEEeeC
Q 026366          188 MQMICRACNIQEVSILLLPCRHLCLCKDCEGLIGVCPVCKAMRTASVEVYLS  239 (239)
Q Consensus       188 ~~~~C~iC~~~~~~vlllPC~Hlc~C~~C~~~l~~CPvCr~~i~~~v~v~~S  239 (239)
                      +...|+||++++++++|+||||+++|..|+..+..||+||.+|...++||.+
T Consensus        14 ~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~   65 (68)
T 2ea5_A           14 NSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP   65 (68)
T ss_dssp             CSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred             CCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence            3458999999999999999999999999999999999999999999999863
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.52
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.4
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.29
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.28
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.21
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.15
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.13
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.0
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.7
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.67
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.66
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.59
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.25
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.18
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.02
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.53
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.60  E-value=3.7e-09  Score=75.44  Aligned_cols=45  Identities=24%  Similarity=0.740  Sum_probs=38.8

Q ss_pred             ccccccccccceEEeCCCCcccccchHhc-----CCCCCCCcccccceEEE
Q 026366          191 ICRACNIQEVSILLLPCRHLCLCKDCEGL-----IGVCPVCKAMRTASVEV  236 (239)
Q Consensus       191 ~C~iC~~~~~~vlllPC~Hlc~C~~C~~~-----l~~CPvCr~~i~~~v~v  236 (239)
                      .|.||++...+.+++||||. +|..|...     ...||+||..|...-.|
T Consensus        25 ~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i   74 (79)
T d1fbva4          25 LCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPI   74 (79)
T ss_dssp             BCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCS
T ss_pred             CCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCcee
Confidence            69999999999999999998 89999753     35799999999876544
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure