Citrus Sinensis ID: 026434
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.924 | 0.247 | 0.425 | 9e-41 | |
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.928 | 0.247 | 0.431 | 3e-40 | |
| 24461861 | 890 | NBS-LRR type disease resistance protein | 0.882 | 0.235 | 0.450 | 8e-40 | |
| 24461864 | 899 | NBS-LRR type disease resistance protein | 0.911 | 0.241 | 0.427 | 2e-37 | |
| 24461863 | 889 | NBS-LRR type disease resistance protein | 0.936 | 0.250 | 0.419 | 4e-32 | |
| 224122896 | 820 | cc-nbs-lrr resistance protein [Populus t | 0.886 | 0.257 | 0.369 | 8e-32 | |
| 225443158 | 903 | PREDICTED: probable disease resistance p | 0.928 | 0.244 | 0.363 | 1e-28 | |
| 255553059 | 812 | Disease resistance protein RFL1, putativ | 0.936 | 0.274 | 0.391 | 2e-28 | |
| 296088271 | 565 | unnamed protein product [Vitis vinifera] | 0.911 | 0.384 | 0.375 | 6e-28 | |
| 147782477 | 1377 | hypothetical protein VITISV_002420 [Viti | 0.941 | 0.162 | 0.374 | 1e-27 |
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 172 bits (436), Expect = 9e-41, Method: Compositional matrix adjust.
Identities = 97/228 (42%), Positives = 146/228 (64%), Gaps = 8/228 (3%)
Query: 1 MKELLGLKHLKVLSWSFGSSLAVQKFLKYPKLVSITQSVGVYQC--RSPPFNVFHLAYME 58
++ELLGLK+L+V+S++ SS +Q FL KL S T+++ + QC S V LA ++
Sbjct: 662 VEELLGLKYLEVISFTLRSSHGLQSFLSSHKLRSCTRAL-LLQCFNDSTSLEVSALADLK 720
Query: 59 NLQELELEYCN-LEEMKIDSTDEVKKLFQSGFRSLNTVHVFYCQKAKDLTWLVFVQNLKK 117
L L + C LEE+K+D T EV++ F SL V + C K KDLT+LVF NL+
Sbjct: 721 QLNRLWITECKKLEELKMDYTREVQQFV---FHSLKKVEILACSKLKDLTFLVFAPNLES 777
Query: 118 LRIEFCDDVEEIIGVDKLRDISEIIGSEHNFFAQLEYLTISWGINLKGVYPNPLPFPKLK 177
+ + C +EE++ + K ++ E++ + N FA+L+ L + NLK +Y PLPFP LK
Sbjct: 778 IELMGCPAMEEMVSMGKFAEVPEVVAN-LNPFAKLQNLKLFGATNLKSIYWKPLPFPHLK 836
Query: 178 KIKVRGCRHLKKLPLNSSSAKERRVVIEGSKKWWEELQWEDQATQNAF 225
+ C LKKLPL+S+SA+ER +VI G+++WWE+L+W D+AT+NAF
Sbjct: 837 SMSFSHCYKLKKLPLDSNSARERNIVISGTRRWWEQLEWVDEATRNAF 884
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553059|ref|XP_002517572.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543204|gb|EEF44736.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296088271|emb|CBI36497.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147782477|emb|CAN75117.1| hypothetical protein VITISV_002420 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.928 | 0.248 | 0.363 | 1.2e-27 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.920 | 0.246 | 0.336 | 2.6e-27 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.924 | 0.246 | 0.346 | 2.2e-25 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.928 | 0.249 | 0.346 | 1.2e-24 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.903 | 0.243 | 0.347 | 3.3e-24 | |
| TAIR|locus:2031366 | 898 | AT1G63350 "AT1G63350" [Arabido | 0.899 | 0.238 | 0.323 | 6.6e-23 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.936 | 0.255 | 0.306 | 9.4e-22 | |
| TAIR|locus:2171589 | 948 | AT5G47260 [Arabidopsis thalian | 0.941 | 0.236 | 0.283 | 4.7e-21 | |
| TAIR|locus:2031356 | 884 | AT1G63360 [Arabidopsis thalian | 0.878 | 0.236 | 0.299 | 6.9e-21 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.907 | 0.240 | 0.317 | 2.4e-20 |
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 320 (117.7 bits), Expect = 1.2e-27, P = 1.2e-27
Identities = 84/231 (36%), Positives = 120/231 (51%)
Query: 1 MKELLGLKHLKVLSWSFGSSLAVQKFLKYPKLVSITQSVGVYQCRSPPFNVFHLAYMENL 60
+KEL L+HL+V++ SSL + L +LV + V + V L M NL
Sbjct: 652 VKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNL 711
Query: 61 QELELEYCNLEEMKIDSTDEVKKLFQSG----FRSLNTVHVFYCQKAKDLTWLVFVQNLK 116
++L ++ C + E+KI+ T +S F +L+ V + C KDLTWL+F NL
Sbjct: 712 RKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLT 771
Query: 117 KLRIEFCDDVEEIIGVDKLRDISEIIGSEHNFFAQLEYLTISWGINLKGVYPNPLPFPKL 176
L + F +VE+II +K + S I F +LE L + LK +Y L FP L
Sbjct: 772 FLEVGFSKEVEDIISEEKAEEHSATIVP----FRKLETLHLFELRGLKRIYAKALHFPCL 827
Query: 177 KKIKVRGCRHLKKLPLNSSS--AKERRVVIEGSKKWWEELQWEDQATQNAF 225
K I V C L+KLPL+S S A E V+ G ++W E ++WEDQATQ F
Sbjct: 828 KVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRF 878
|
|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.52 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.3 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.3 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.46 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.38 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.33 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.83 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.65 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.55 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.45 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.43 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.43 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.43 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.35 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.21 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.16 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.03 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.0 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.95 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.94 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.91 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.88 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.84 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.8 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.68 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.64 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.61 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.55 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.37 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.35 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.3 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.24 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.22 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.15 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.04 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.92 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.91 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.81 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.37 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 95.23 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.94 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.89 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.83 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 93.98 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 93.97 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 92.97 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 92.46 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.25 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 91.47 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 90.93 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.11 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.0 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 89.59 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 89.56 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 89.39 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 88.12 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 86.77 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 86.57 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 83.31 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 82.4 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.52 E-value=4.2e-15 Score=141.88 Aligned_cols=217 Identities=31% Similarity=0.451 Sum_probs=172.2
Q ss_pred CccccccCCCcceeEEeeehHHHHhhhcCchhhcceeEEEEeecCCCCCcccchhhcccCCeEEEeecC-CceEEecccC
Q 026434 1 MKELLGLKHLKVLSWSFGSSLAVQKFLKYPKLVSITQSVGVYQCRSPPFNVFHLAYMENLQELELEYCN-LEEMKIDSTD 79 (238)
Q Consensus 1 l~eL~~L~~L~~L~i~~~~~~~l~~l~~~~~l~~~L~~L~l~~c~~l~~~~~~l~~l~~L~~L~i~~c~-l~~i~~~~~~ 79 (238)
++||++|++|+.+++++.+...++.+....++....+.+.+.+|.... ..+++..+.+|+.|.|.+|. .+ +.+++..
T Consensus 661 l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~-~~~~~~~l~~L~~L~i~~~~~~e-~~~~~~~ 738 (889)
T KOG4658|consen 661 LKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKRT-LISSLGSLGNLEELSILDCGISE-IVIEWEE 738 (889)
T ss_pred HHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcccccce-eecccccccCcceEEEEcCCCch-hhccccc
Confidence 468999999999999988877778888888888888888886644322 46678889999999999999 55 3333321
Q ss_pred ccCccccc-CCCCccEEEEecCCCCCcCcccccCCCccEEEEecccccceeccccccccccccccccccccccccee-ec
Q 026434 80 EVKKLFQS-GFRSLNTVHVFYCQKAKDLTWLVFVQNLKKLRIEFCDDVEEIIGVDKLRDISEIIGSEHNFFAQLEYL-TI 157 (238)
Q Consensus 80 ~~~~~~~~-~l~~L~~L~i~~C~~L~~l~~~~~l~~L~~L~i~~C~~l~~l~~~~~~~~~~~~~~~~~~~~p~L~~L-~L 157 (238)
. .... +|+++..+.+.+|..++++.|....|+|++|.+..|..++++++......... .....|+++..+ .+
T Consensus 739 ~---~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~---~~i~~f~~~~~l~~~ 812 (889)
T KOG4658|consen 739 S---LIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELK---ELILPFNKLEGLRML 812 (889)
T ss_pred c---cchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhhhcc---cEEecccccccceee
Confidence 1 0111 48899999999999999999999999999999999999999987654432110 235678888888 68
Q ss_pred cccccccccCCCCCCCCCccEEeEcCccCCCCCCCCCCCCCC---cceEEEchhhhhhhcccCchhhhhhc
Q 026434 158 SWGINLKGVYPNPLPFPKLKKIKVRGCRHLKKLPLNSSSAKE---RRVVIEGSKKWWEELQWEDQATQNAF 225 (238)
Q Consensus 158 ~~~~~L~~i~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~~~~---~L~~~~~~~~w~~~~~~~~~~~~~~~ 225 (238)
.+.+++++++.....++.|+.+.+..||+++.+|........ ...+...+.+|.+.++|+|++++..|
T Consensus 813 ~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~ 883 (889)
T KOG4658|consen 813 CSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF 883 (889)
T ss_pred ecCCCCceeEecccCccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence 999999999988888999999999999999999988765442 23444556678899999999999888
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 238 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 42.1 bits (98), Expect = 1e-04
Identities = 33/197 (16%), Positives = 71/197 (36%), Gaps = 37/197 (18%)
Query: 42 YQCRSPPFNVFHLAYMENLQELELEYCNLEEMK-IDSTDEVKKLFQSGFRSLNTVHVFYC 100
YQ + +VF A+++N +++ + K I S +E+ + S T+ +F+
Sbjct: 16 YQYKDI-LSVFEDAFVDNFDCKDVQ----DMPKSILSKEEIDHIIMSKDAVSGTLRLFWT 70
Query: 101 QKAK-DLTWLVFVQNLKKLRIEFCDDVEEIIGVDKLRDISEIIGSEHNFFAQLEYLTISW 159
+K + FV+ + ++ +F + ++ E +E +
Sbjct: 71 LLSKQEEMVQKFVEEVLRINYKFL--------MSPIKT--EQRQPSMMTRMYIEQRDRLY 120
Query: 160 GINLKGVYPNPLPFPKLKKI-KVRGCRHLKKLPLNSSSAKERRVVIE---GSKKWW---E 212
N V+ +L+ K+R + L +L + V+I+ GS K W +
Sbjct: 121 NDN--QVFA-KYNVSRLQPYLKLR--QALLEL------RPAKNVLIDGVLGSGKTWVALD 169
Query: 213 ELQWEDQATQNAFSSGV 229
Q +
Sbjct: 170 VCL--SYKVQCKMDFKI 184
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.49 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.38 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.22 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.19 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.16 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.12 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.07 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.06 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.03 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.03 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.01 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.0 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.0 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.98 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.95 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.93 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.92 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.9 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.9 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.89 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.88 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.88 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.87 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.87 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.86 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.86 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.82 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.81 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.79 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.78 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.76 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.76 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.75 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.75 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.75 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.73 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.72 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.7 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.7 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.7 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.69 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.69 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.69 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.68 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.68 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.67 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.66 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.66 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.65 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.65 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.65 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.64 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.64 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.62 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.62 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.61 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.61 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.6 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.59 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.59 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.58 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.58 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.58 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.57 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.56 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.56 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.55 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.55 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.55 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.54 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.54 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.52 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.52 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.51 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.51 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.5 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.49 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.49 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.49 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.49 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.48 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.47 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.47 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.47 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.47 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.46 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.45 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.44 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.42 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.4 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.38 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.37 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.32 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.32 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.32 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.3 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.29 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.28 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.28 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.28 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.28 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.27 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.26 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.26 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.25 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.24 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.17 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.17 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.17 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.16 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.12 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.04 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.02 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.02 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.01 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.0 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.0 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.97 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.95 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.92 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.88 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.86 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.7 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.65 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.63 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.63 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.63 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.58 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.57 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.45 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.36 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.36 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.31 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.19 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.01 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 95.99 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 95.47 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 94.97 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.72 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.86 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.6 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 90.62 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 90.45 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.49 E-value=4.7e-13 Score=114.19 Aligned_cols=208 Identities=16% Similarity=0.154 Sum_probs=117.7
Q ss_pred cccccCCCcceeEEeeehHHHHhhhcCchhhcceeEEEEeecCCCCCcccchhhcccCCeEEEeecC-CceEEecccCcc
Q 026434 3 ELLGLKHLKVLSWSFGSSLAVQKFLKYPKLVSITQSVGVYQCRSPPFNVFHLAYMENLQELELEYCN-LEEMKIDSTDEV 81 (238)
Q Consensus 3 eL~~L~~L~~L~i~~~~~~~l~~l~~~~~l~~~L~~L~l~~c~~l~~~~~~l~~l~~L~~L~i~~c~-l~~i~~~~~~~~ 81 (238)
++..+.+|+.|++...... .+.....-.++|+.|++.++.- ......+.++++|+.|++++|. +..++.......
T Consensus 99 ~l~~l~~L~~L~L~~n~l~---~lp~~~~~l~~L~~L~Ls~n~l-~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~ 174 (328)
T 4fcg_A 99 QAFRLSHLQHMTIDAAGLM---ELPDTMQQFAGLETLTLARNPL-RALPASIASLNRLRELSIRACPELTELPEPLASTD 174 (328)
T ss_dssp CGGGGTTCSEEEEESSCCC---CCCSCGGGGTTCSEEEEESCCC-CCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC
T ss_pred hhhhCCCCCEEECCCCCcc---chhHHHhccCCCCEEECCCCcc-ccCcHHHhcCcCCCEEECCCCCCccccChhHhhcc
Confidence 3566788888888643322 2222223346788888888742 2212256778888888888887 655432111000
Q ss_pred CcccccCCCCccEEEEecCCCCCcCc-ccccCCCccEEEEecccccceecccccc-----------cccccccccccccc
Q 026434 82 KKLFQSGFRSLNTVHVFYCQKAKDLT-WLVFVQNLKKLRIEFCDDVEEIIGVDKL-----------RDISEIIGSEHNFF 149 (238)
Q Consensus 82 ~~~~~~~l~~L~~L~i~~C~~L~~l~-~~~~l~~L~~L~i~~C~~l~~l~~~~~~-----------~~~~~~~~~~~~~~ 149 (238)
.......+++|+.|+++++ +++.++ .+..+++|++|++.+|. +..++..-.. ....+.....+..+
T Consensus 175 ~~~~~~~l~~L~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l 252 (328)
T 4fcg_A 175 ASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR 252 (328)
T ss_dssp -CCCEEESTTCCEEEEEEE-CCCCCCGGGGGCTTCCEEEEESSC-CCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCC
T ss_pred chhhhccCCCCCEEECcCC-CcCcchHhhcCCCCCCEEEccCCC-CCcCchhhccCCCCCEEECcCCcchhhhHHHhcCC
Confidence 0000112445555555554 344433 23444555555554442 2222110000 00000001355678
Q ss_pred cccceeeccccccccccCCCCCCCCCccEEeEcCccCCCCCCCCCCCCCCcceEEEchhhhhhhcccC
Q 026434 150 AQLEYLTISWGINLKGVYPNPLPFPKLKKIKVRGCRHLKKLPLNSSSAKERRVVIEGSKKWWEELQWE 217 (238)
Q Consensus 150 p~L~~L~L~~~~~L~~i~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~~~~~L~~~~~~~~w~~~~~~~ 217 (238)
++|++|++.++..+..++.....+++|+.|++++|+.+..+|..-.. .++|+.+.....+...+.+.
T Consensus 253 ~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~-L~~L~~l~l~~~~~~~l~~~ 319 (328)
T 4fcg_A 253 APLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ-LPANCIILVPPHLQAQLDQH 319 (328)
T ss_dssp CCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGG-SCTTCEEECCGGGSCC----
T ss_pred CCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhh-ccCceEEeCCHHHHHHHhhh
Confidence 99999999999888888877778999999999999999999965443 36788887776666555544
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.11 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.09 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.07 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.06 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.05 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.03 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.0 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.82 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.67 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.57 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.55 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.53 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.53 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.48 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.46 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.39 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.37 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.27 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.26 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.21 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.17 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.14 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.05 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.04 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.01 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.83 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.82 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.49 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.23 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.11 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.02 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 95.9 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.96 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 93.47 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 93.05 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 91.85 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 86.88 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.11 E-value=6.6e-12 Score=103.02 Aligned_cols=161 Identities=16% Similarity=0.149 Sum_probs=82.5
Q ss_pred ccCCCcceeEEee--ehHHHHhhhcCchhhcceeEEEEeecCCCCC-cccchhhcccCCeEEEeecC-CceEEecccCcc
Q 026434 6 GLKHLKVLSWSFG--SSLAVQKFLKYPKLVSITQSVGVYQCRSPPF-NVFHLAYMENLQELELEYCN-LEEMKIDSTDEV 81 (238)
Q Consensus 6 ~L~~L~~L~i~~~--~~~~l~~l~~~~~l~~~L~~L~l~~c~~l~~-~~~~l~~l~~L~~L~i~~c~-l~~i~~~~~~~~ 81 (238)
...+|+.|+++.+ +...+..++... ++|++|.+.+|. +.. .+..+.++++|++|++++|. +.+..+...
T Consensus 44 ~~~~L~~LdLs~~~i~~~~l~~l~~~c---~~L~~L~L~~~~-l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l--- 116 (284)
T d2astb2 44 SPFRVQHMDLSNSVIEVSTLHGILSQC---SKLQNLSLEGLR-LSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTL--- 116 (284)
T ss_dssp CCBCCCEEECTTCEECHHHHHHHHTTB---CCCSEEECTTCB-CCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHH---
T ss_pred cCCCCCEEECCCCccCHHHHHHHHHhC---CCcccccccccC-CCcHHHHHHhcCCCCcCccccccccccccccchh---
Confidence 3456777776432 234455554443 478888888773 333 34456667788888888877 653211100
Q ss_pred CcccccCCCCccEEEEecCCCCCcCc---cc-ccCCCccEEEEecccc-cceecccccccccccccccccccccccceee
Q 026434 82 KKLFQSGFRSLNTVHVFYCQKAKDLT---WL-VFVQNLKKLRIEFCDD-VEEIIGVDKLRDISEIIGSEHNFFAQLEYLT 156 (238)
Q Consensus 82 ~~~~~~~l~~L~~L~i~~C~~L~~l~---~~-~~l~~L~~L~i~~C~~-l~~l~~~~~~~~~~~~~~~~~~~~p~L~~L~ 156 (238)
...+++|++|++++|.++++-. .+ ...++|+.|.+.+|.. +.... .. .-...+|+|++|+
T Consensus 117 ----~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~-----l~------~l~~~~~~L~~L~ 181 (284)
T d2astb2 117 ----LSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSD-----LS------TLVRRCPNLVHLD 181 (284)
T ss_dssp ----HHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHH-----HH------HHHHHCTTCSEEE
T ss_pred ----hHHHHhccccccccccccccccchhhhcccccccchhhhccccccccccc-----cc------ccccccccccccc
Confidence 1236677777777777665421 11 2346677777766532 21100 00 1112345555555
Q ss_pred ccccccccccCC-CCCCCCCccEEeEcCccCCC
Q 026434 157 ISWGINLKGVYP-NPLPFPKLKKIKVRGCRHLK 188 (238)
Q Consensus 157 L~~~~~L~~i~~-~~~~~~~L~~L~i~~C~~L~ 188 (238)
+.+|+.+++-.. ....+++|++|++++|.+++
T Consensus 182 L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~ 214 (284)
T d2astb2 182 LSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDII 214 (284)
T ss_dssp CTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCC
T ss_pred cccccCCCchhhhhhcccCcCCEEECCCCCCCC
Confidence 555555442211 12234555555555555544
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|