Citrus Sinensis ID: 026450

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
cccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHcccccHHHHHHHHccEEEEEEcccccEEEEEEEEEEEc
ccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHcccccHccccccccccccccHHHHHHHccccHHHHccccHHHHHHHHHHcccEEEEEEcccHHccHHHHcHHHcccHHHHHHHHHcEEEEEEEcccccEEEEEEEHEcc
mdsvlsandkqsMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVgnesgaiasasrspaeeianpgpeensvtagqeigdevraplpvvrdtlyddamfyagsgaryplhepssliafrnfdeemkrpgvweseqgaastadssrdnlaslyrppfhlmfngsfekakdaasVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
mdsvlsandkqsMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
***************SFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGN***********************************VRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNF*****************************LYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFL*
***************SFLEIAVGQTAETAVQFLQATSWKLDEAIQLFY***************************************************************************RNF******************************YRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
**********QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGA*********************VTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPG***************RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
*********KQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGN***********************************VRAPLPVVRDTLYDDAMFYAGSGARYPL**PSSLIAFRN************************RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGMTFKVFIDFRYCCFLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q5REY7 489 UBX domain-containing pro yes no 0.810 0.394 0.322 2e-24
O94888 489 UBX domain-containing pro yes no 0.810 0.394 0.322 2e-24
Q6P5G6 467 UBX domain-containing pro yes no 0.718 0.366 0.303 8e-21
Q55BU7 503 UBX domain-containing pro yes no 0.831 0.393 0.261 1e-18
O14048 427 UBX domain-containing pro yes no 0.878 0.489 0.301 7e-18
Q06682 500 UBX domain-containing pro yes no 0.878 0.418 0.244 5e-11
>sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 101/211 (47%), Gaps = 18/211 (8%)

Query: 11  QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANP 70
           + ++  F  I  G +       L+A +  L+ A+ +F  G   G IA    + +  ++  
Sbjct: 14  KGLIQQFTTI-TGASESVGKHMLEACNNNLEMAVTMFLDG---GGIAEEPSTSSASVSTV 69

Query: 71  GPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEM 130
            P            +EVRAP+P  ++ L +    +     R P    S    FR+F  E 
Sbjct: 70  RPHTE---------EEVRAPIPQKQEILVEPEPLFGAPKRRRPAR--SIFDGFRDFQTET 118

Query: 131 KRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQST 190
            R    E E       D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ 
Sbjct: 119 IR---QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNV 175

Query: 191 KEFSSHMLNRDTWANEAVSQTISTNFIFWQV 221
           ++F+   LNRD W+NEAV   I  +FIFWQV
Sbjct: 176 QDFACQCLNRDVWSNEAVKNIIREHFIFWQV 206

Pongo abelii (taxid: 9601)
>sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 Back     alignment and function description
>sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=4 SV=1 Back     alignment and function description
>sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 Back     alignment and function description
>sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
224111366 444 predicted protein [Populus trichocarpa] 0.920 0.493 0.791 7e-95
224099647309 predicted protein [Populus trichocarpa] 0.928 0.715 0.765 2e-92
255561727 452 UBX domain-containing protein, putative 0.924 0.486 0.755 3e-92
359473684 456 PREDICTED: UBX domain-containing protein 0.924 0.482 0.717 3e-88
359473686 447 PREDICTED: UBX domain-containing protein 0.924 0.492 0.737 1e-87
356559124 456 PREDICTED: UBX domain-containing protein 0.924 0.482 0.715 2e-86
356559122 467 PREDICTED: UBX domain-containing protein 0.907 0.462 0.659 1e-85
356526695 468 PREDICTED: UBX domain-containing protein 0.907 0.461 0.661 8e-85
356526697 476 PREDICTED: UBX domain-containing protein 0.907 0.453 0.661 1e-84
357517375 461 UBX domain-containing protein [Medicago 0.928 0.479 0.649 9e-80
>gi|224111366|ref|XP_002315828.1| predicted protein [Populus trichocarpa] gi|222864868|gb|EEF01999.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 187/221 (84%), Gaps = 2/221 (0%)

Query: 1   MDSVLSANDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASAS 60
           M+ +LS ND+QSMVSSFLEIAVGQTAETA QFLQATSWKL++AIQLFYVGNE GA+ASAS
Sbjct: 1   MERMLSENDEQSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASAS 60

Query: 61  RSPAEEIANPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSL 120
             P  E      E   V  G   G+EVRAPLPVVRDTLYDDAM Y  S   YP HE SSL
Sbjct: 61  HPPPTETWPEDLENEKV--GHSDGEEVRAPLPVVRDTLYDDAMLYGASRTGYPPHEASSL 118

Query: 121 IAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQD 180
           IAFRNFDEEMK PGVWES+QG+ ST D+SRDNLASLYRPPFHLMF+GSFEKAK AASVQD
Sbjct: 119 IAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAASVQD 178

Query: 181 KWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQV 221
           KWLLVNLQSTKEFSSHMLNRDTWANEAV+QTISTNFIFWQV
Sbjct: 179 KWLLVNLQSTKEFSSHMLNRDTWANEAVAQTISTNFIFWQV 219

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099647|ref|XP_002311564.1| predicted protein [Populus trichocarpa] gi|222851384|gb|EEE88931.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561727|ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis] gi|223538911|gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359473684|ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2-like isoform 2 [Vitis vinifera] gi|297738308|emb|CBI27509.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473686|ref|XP_002274120.2| PREDICTED: UBX domain-containing protein 2-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559124|ref|XP_003547851.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356559122|ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356526695|ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356526697|ref|XP_003531953.1| PREDICTED: UBX domain-containing protein 7-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|357517375|ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula] gi|358345084|ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula] gi|355502548|gb|AES83751.1| UBX domain-containing protein [Medicago truncatula] gi|355522998|gb|AET03452.1| UBX domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
TAIR|locus:2204497 468 AT1G14570 "AT1G14570" [Arabido 0.575 0.292 0.662 6.9e-47
ZFIN|ZDB-GENE-040704-8 505 ubxn7 "UBX domain protein 7" [ 0.844 0.398 0.333 5.9e-25
UNIPROTKB|E1BTX4 492 UBXN7 "Uncharacterized protein 0.634 0.306 0.386 8.8e-23
UNIPROTKB|F1MUA8 474 UBXN7 "Uncharacterized protein 0.634 0.318 0.379 2.1e-22
UNIPROTKB|I3LQY9 476 UBXN7 "Uncharacterized protein 0.634 0.317 0.379 2.1e-22
UNIPROTKB|E2R9U7 489 UBXN7 "Uncharacterized protein 0.634 0.308 0.379 2.4e-22
UNIPROTKB|O94888 489 UBXN7 "UBX domain-containing p 0.634 0.308 0.379 2.4e-22
MGI|MGI:2146388 467 Ubxn7 "UBX domain protein 7" [ 0.357 0.182 0.470 5.4e-21
TAIR|locus:2202872 307 AT1G59550 "AT1G59550" [Arabido 0.273 0.211 0.544 1.3e-20
DICTYBASE|DDB_G0270358 503 DDB_G0270358 "ubiquitin intera 0.815 0.385 0.283 2.5e-20
TAIR|locus:2204497 AT1G14570 "AT1G14570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 491 (177.9 bits), Expect = 6.9e-47, P = 6.9e-47
 Identities = 98/148 (66%), Positives = 114/148 (77%)

Query:    85 DEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQG--- 141
             DEVRAPLPVVR+TLY ++M+Y          EP+SLIAFRNF EE K PG+WE ++G   
Sbjct:    92 DEVRAPLPVVRETLYGESMYYGAMRVGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSS 151

Query:   142 -----AASTADSS---RDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEF 193
                  +AS ++S+   RD+LASLYRPPFHLMF GSFE+AK  +S QDKWLLVNLQST EF
Sbjct:   152 ASASASASASESASAPRDSLASLYRPPFHLMFQGSFEQAKTTSSSQDKWLLVNLQSTTEF 211

Query:   194 SSHMLNRDTWANEAVSQTISTNFIFWQV 221
             SSHMLNRDTWAN+AVSQTI  NFIFWQV
Sbjct:   212 SSHMLNRDTWANDAVSQTIKANFIFWQV 239
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0048573 "photoperiodism, flowering" evidence=RCA
ZFIN|ZDB-GENE-040704-8 ubxn7 "UBX domain protein 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTX4 UBXN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUA8 UBXN7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQY9 UBXN7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9U7 UBXN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94888 UBXN7 "UBX domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2146388 Ubxn7 "UBX domain protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2202872 AT1G59550 "AT1G59550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270358 DDB_G0270358 "ubiquitin interacting motif (UIM) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
cd02958114 cd02958, UAS, UAS family; UAS is a domain of unkno 7e-29
smart00594122 smart00594, UAS, UAS domain 4e-19
pfam1389981 pfam13899, Thioredoxin_7, Thioredoxin-like 1e-05
>gnl|CDD|239256 cd02958, UAS, UAS family; UAS is a domain of unknown function Back     alignment and domain information 
 Score =  104 bits (262), Expect = 7e-29
 Identities = 35/74 (47%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 164 MFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGM 223
            F GSFE AK  A  + KWLLV LQS  EF S +LNRD W+NE+V + I  NFIFWQ  +
Sbjct: 1   FFQGSFEDAKQEAKSEKKWLLVYLQSEDEFDSQVLNRDLWSNESVKEFIRENFIFWQCDI 60

Query: 224 TFKVFIDFRYCCFL 237
                   R+    
Sbjct: 61  DSS--EGQRFLQSY 72

Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), which is involved in the ubiquitin-proteosome pathway. Some members of this family are uncharacterized proteins containing only a UAS domain. Length = 114
>gnl|CDD|214737 smart00594, UAS, UAS domain Back     alignment and domain information
>gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
KOG1364 356 consensus Predicted ubiquitin regulatory protein, 99.81
smart00594122 UAS UAS domain. 99.62
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 99.42
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 99.41
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.39
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 99.14
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.73
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 97.76
cd02955124 SSP411 TRX domain, SSP411 protein family; members 97.2
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 97.15
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 97.09
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 96.73
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.63
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 96.62
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 96.6
KOG1363 460 consensus Predicted regulator of the ubiquitin pat 96.23
KOG1364 356 consensus Predicted ubiquitin regulatory protein, 94.9
COG1331 667 Highly conserved protein containing a thioredoxin 94.28
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 94.22
KOG2086 380 consensus Protein tyrosine phosphatase SHP1/Cofact 93.8
KOG4351244 consensus Uncharacterized conserved protein [Funct 92.42
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 92.22
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 91.77
smart0054643 CUE Domain that may be involved in binding ubiquit 91.73
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 91.6
PRK06369115 nac nascent polypeptide-associated complex protein 91.15
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 90.68
COG2143182 Thioredoxin-related protein [Posttranslational mod 87.61
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 86.4
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.16
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 82.62
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.81  E-value=8.5e-20  Score=167.42  Aligned_cols=161  Identities=30%  Similarity=0.474  Sum_probs=116.8

Q ss_pred             cchHHHHHhhcccccCCCHHHHHHHHHHcCCCHHHHHHHHhcCCCCCCCCCCCCCCccccCCCCCCCcccccCCCCCCCC
Q 026450            8 NDKQSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIANPGPEENSVTAGQEIGDEV   87 (238)
Q Consensus         8 ~~~~~~i~~F~~iTtg~~~~~A~~~Le~~~wdLe~Ai~lff~~~~~~~~~~~~~sp~~~~~~~~~d~~~~~~~~~~~d~V   87 (238)
                      ..+.++|++|+.||...+.+.|++||++++|||+.||+|||+.++.....++                        ...+
T Consensus         4 ~~~~~lv~~fl~It~~~t~e~A~q~L~~~~~~le~ai~Lffe~~~~~~~~s~------------------------~~~a   59 (356)
T KOG1364|consen    4 GAQRALVSKFLAITVQQTVEIATQYLSAADWDLEAAINLFFEHGGFTQVYSS------------------------SSAA   59 (356)
T ss_pred             chHHHHHHHHHHHhccccHHHHHHHHHhcCCcHHHHHHHHHHhcccccccCC------------------------cccC
Confidence            4568899999999444999999999999999999999999998764222111                        1223


Q ss_pred             CCCCccccccccCCcccccCCCCCCCCCCCcchhccccchhhhcCCCcccccCCCCccccchhhhhhhhcCCCccccccc
Q 026450           88 RAPLPVVRDTLYDDAMFYAGSGARYPLHEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNG  167 (238)
Q Consensus        88 RAPip~~~etLv~~~~~~g~~~~~~~~~~~~~~~~~rdf~~e~~~~~~~~~~~~~~~~~~s~~~~La~LFrPP~dim~~g  167 (238)
                      -+||+.++|+|+.+...........  ..|+               .+|++.    +...+++.+|+.|||||++||++|
T Consensus        60 ~sp~~~~re~l~~~~~~~d~~~~s~--~~p~---------------~~~~~~----s~~~~~~srL~slfrpp~~i~~~g  118 (356)
T KOG1364|consen   60 PSPIEPQREVLFDPLGIMDQSTSSI--LDPS---------------ENQDDE----SEHASSQSRLASLFRPPTDILSHG  118 (356)
T ss_pred             CCcccccceeeeccccccccCcccc--cCcc---------------cccchh----hhhccccchhhhhcCCCcchhhcC
Confidence            3499999999998632110000000  1111               111111    222467889999999999999999


Q ss_pred             hHHHHHHHHHhcCceEEEEeccCCCccccccccc------ccCCHHHHHHhh
Q 026450          168 SFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRD------TWANEAVSQTIS  213 (238)
Q Consensus       168 ~f~~A~~~a~~~~kwllVniq~~~~F~~~~lnRD------~W~~~~v~~~v~  213 (238)
                      +|+.||..|.++.+||||.++....+.+..++|.      .|-|+..-+-|+
T Consensus       119 sld~ak~~a~sk~~wllV~~Dtseg~~~~~Fy~~~~~P~i~iiDp~Tge~v~  170 (356)
T KOG1364|consen  119 SLDAAKSTASSKQRWLLVLDDTSEGQPFSAFYHISSLPHIAIIDPITGERVK  170 (356)
T ss_pred             ChhhhhhcccccceEEEEeeccCCCCchhhheeccCCceEEEECCchhhhhh
Confidence            9999999999999999999999888999899888      566655444444

>smart00594 UAS UAS domain Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>KOG4351 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
2dlx_A153 Solution Structure Of The Uas Domain Of Human Ubx D 9e-20
>pdb|2DLX|A Chain A, Solution Structure Of The Uas Domain Of Human Ubx Domain- Containing Protein 7 Length = 153 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 53/80 (66%)
Query: 142 AASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRD 201
            +S  D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ ++F+   LNRD
Sbjct: 4   GSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRD 63
Query: 202 TWANEAVSQTISTNFIFWQV 221
            W+NEAV   I  +FIFWQV
Sbjct: 64  VWSNEAVKNIIREHFIFWQV 83

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 2e-31
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 5e-07
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 1e-04
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
 Score =  112 bits (281), Expect = 2e-31
 Identities = 39/81 (48%), Positives = 53/81 (65%)

Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNR 200
             +S  D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ ++F+   LNR
Sbjct: 3   SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNR 62

Query: 201 DTWANEAVSQTISTNFIFWQV 221
           D W+NEAV   I  +FIFWQV
Sbjct: 63  DVWSNEAVKNIIREHFIFWQV 83
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 178 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.81
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 99.59
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 99.38
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 99.3
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 99.25
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 99.22
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 99.18
3bq3_A270 Defective in cullin neddylation protein 1; ubiquit 98.47
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 97.62
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.49
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 97.4
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 97.3
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 97.09
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 97.04
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 97.04
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 97.01
1wji_A63 Tudor domain containing protein 3; UBA domain, str 96.93
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.84
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 96.77
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 96.74
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 96.74
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 96.6
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 96.58
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 96.49
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 96.42
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 96.3
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 96.22
3f9u_A172 Putative exported cytochrome C biogenesis-related; 96.13
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 96.13
2l2d_A73 OTU domain-containing protein 7A; UBA fold, struct 96.01
2cwb_A108 Chimera of immunoglobulin G binding protein G and 95.98
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 95.97
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 95.65
2dna_A67 Unnamed protein product; ubiquitin associated doma 95.63
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 95.53
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 95.46
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 95.3
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 95.21
3ira_A173 Conserved protein; methanosarcina mazei,structural 95.06
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 95.01
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 94.62
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 94.45
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 94.11
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 94.0
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 93.88
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 93.63
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 93.33
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 92.75
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 92.59
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 92.56
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 92.47
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 91.94
2kuc_A130 Putative disulphide-isomerase; structural genomics 91.12
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 90.32
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 88.69
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 87.1
2dhy_A67 CUE domain-containing protein 1; structural genomi 86.91
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 86.76
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 86.59
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 85.67
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
Probab=99.81  E-value=1.8e-20  Score=154.33  Aligned_cols=92  Identities=45%  Similarity=0.816  Sum_probs=83.8

Q ss_pred             ccccchhhhhhhhcCCCccccccchHHHHHHHHHhcCceEEEEeccCCCcccccccccccCCHHHHHHhhcCeEEeeeec
Q 026450          144 STADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGM  223 (238)
Q Consensus       144 ~~~~s~~~~La~LFrPP~dim~~g~f~~A~~~a~~~~kwllVniq~~~~F~~~~lnRD~W~~~~v~~~v~~~Fifwq~~~  223 (238)
                      ++.+++.++|+.||+||++||+.++|++|+..||+++|||||+|+....+.|+.|+|+||+|+.|+++|++|||+|+++.
T Consensus         6 ~~~~~~~~~l~~lf~~p~~~~~~~~~~~Al~~Ak~~~K~vlvd~~a~wC~~C~~me~~vf~d~~V~~~l~~~fv~v~~d~   85 (153)
T 2dlx_A            6 SGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYH   85 (153)
T ss_dssp             CCCCCCCCCCCCTTSCCTTTSCCSCHHHHHHHHHHHTCEEEEEEECSCTTTHHHHHHHTTTCHHHHHHHHHTEEEEEEES
T ss_pred             CCCCchhhHHHHhhCCchhhhcccCHHHHHHHHHHcCCeEEEEEECCCCHhHHHHHHHhcCCHHHHHHHHcCeEEEEEec
Confidence            34567889999999999999999999999999999999999999999999999999999999999999999999999977


Q ss_pred             chh---hhhhhhcee
Q 026450          224 TFK---VFIDFRYCC  235 (238)
Q Consensus       224 d~~---~~~~~~~c~  235 (238)
                      ++.   .+.+.|.+.
T Consensus        86 ~~~~~~~l~~~y~v~  100 (153)
T 2dlx_A           86 DSEEGQRYIQFYKLG  100 (153)
T ss_dssp             SSHHHHHHHHHHTCC
T ss_pred             CCHhHHHHHHHcCCC
Confidence            654   666666553
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d2dlxa1147 c.47.1.24 (A:1-147) UBX domain-containing protein 1e-19
d1v92a_46 a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA- 7e-08
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: UAS domain
domain: UBX domain-containing protein 7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.8 bits (196), Expect = 1e-19
 Identities = 39/91 (42%), Positives = 55/91 (60%)

Query: 141 GAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNR 200
             +S  D     LA L+RPP  LM  GSFE AK+   +Q+KWL++N+Q+ ++F+   LNR
Sbjct: 3   SGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNR 62

Query: 201 DTWANEAVSQTISTNFIFWQVGMTFKVFIDF 231
           D W+NEAV   I  +FIFWQV    +    +
Sbjct: 63  DVWSNEAVKNIIREHFIFWQVYHDSEEGQRY 93
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 46 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.87
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 99.6
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 97.78
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 97.4
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 96.96
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.74
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 96.62
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 96.59
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 96.54
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 96.18
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 96.15
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 94.55
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 94.53
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 94.52
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 93.97
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 93.36
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.04
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 92.89
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 92.8
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 92.39
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 90.21
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 90.02
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 88.01
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 86.33
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 85.08
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 80.63
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: UAS domain
domain: UBX domain-containing protein 7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=4.6e-23  Score=166.64  Aligned_cols=92  Identities=45%  Similarity=0.816  Sum_probs=84.2

Q ss_pred             ccccchhhhhhhhcCCCccccccchHHHHHHHHHhcCceEEEEeccCCCcccccccccccCCHHHHHHhhcCeEEeeeec
Q 026450          144 STADSSRDNLASLYRPPFHLMFNGSFEKAKDAASVQDKWLLVNLQSTKEFSSHMLNRDTWANEAVSQTISTNFIFWQVGM  223 (238)
Q Consensus       144 ~~~~s~~~~La~LFrPP~dim~~g~f~~A~~~a~~~~kwllVniq~~~~F~~~~lnRD~W~~~~v~~~v~~~Fifwq~~~  223 (238)
                      +...++..+||+||+||++|++.|+|++|+++|++++|||||+|+.+.++.|+.|+|+||+|+.|++++++|||+|+++.
T Consensus         6 ~~~~~~~~~~a~~~~pp~~i~~~~~~~~A~~~Ak~~~K~llV~~~~~~C~~C~~m~~~v~~d~~V~~~l~~~fV~~~v~~   85 (147)
T d2dlxa1           6 SGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYH   85 (147)
T ss_dssp             CCCCCCCCCCCCTTSCCTTTSCCSCHHHHHHHHHHHTCEEEEEEECSCTTTHHHHHHHTTTCHHHHHHHHHTEEEEEEES
T ss_pred             CCcccchHHHHHhhCCCccccccCCHHHHHHHHHHcCCcEEEEEecCCCCchHHHHHhccCCHHHHHHHhhheeEeeecc
Confidence            44567788999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             chh---hhhhhhcee
Q 026450          224 TFK---VFIDFRYCC  235 (238)
Q Consensus       224 d~~---~~~~~~~c~  235 (238)
                      +++   .|.+.|.+.
T Consensus        86 ~~~e~~~~~~~y~v~  100 (147)
T d2dlxa1          86 DSEEGQRYIQFYKLG  100 (147)
T ss_dssp             SSHHHHHHHHHHTCC
T ss_pred             cchhhhhhhhheecC
Confidence            654   677777654
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure