Citrus Sinensis ID: 026499

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPNEENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL
cccHHHHHHHHHHHHHHHHccccccEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEccccccccccEEEEEcccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcHHccccHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccc
cccHHHHHHHHHHHHHHHccccccEEEccccccEEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEccccccccccEEEEEHcccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcc
MAEKACVKRLQKEYRALCkepvshvvarpspndilEWHYvlegsngtpfaggyyygkikfppeypykppgilmitpngrfmtQKKLCLSmsdfhpeswnpmwsVSSILTGLLSFmmdtspttgsvnttTEEKQRLAKASLafncknpafrKLFPEYVEKYNEQQLAEQRvseqlspespneensrpkvekvgsgedmktidtpkearknrkqsfPTWMLLLLVSIFGIVMALPLLQL
MAEKACVKRLQKEyralckepvshvvarpspNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVseqlspespneensrpkvekvgsgedmktidtpkearknrkqsfpTWMLLLLVSIFGIVMALPLLQL
MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDtspttgsvntttEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPNEENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL
********RLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMM*********************ASLAFNCKNPAFRKLFPEYVEKY*****************************************************FPTWMLLLLVSIFGIVMALPLL**
****ACV*RLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYV************************************************************MLLLLVSIFGIVMALPLLQL
MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQL***************************SGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL
****ACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQR*********************************P******RKQSFPTWMLLLLVSIFGIVMALPLLQL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPNEENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
Q9SHI7237 Ubiquitin-conjugating enz yes no 1.0 1.0 0.789 1e-110
Q9FK29243 Probable ubiquitin-conjug no no 1.0 0.975 0.740 1e-103
Q8N2K1259 Ubiquitin-conjugating enz yes no 0.725 0.664 0.523 4e-51
Q6P073259 Ubiquitin-conjugating enz yes no 0.725 0.664 0.517 1e-50
Q2TA03259 Ubiquitin-conjugating enz yes no 0.725 0.664 0.517 1e-50
P33296250 Ubiquitin-conjugating enz yes no 0.827 0.784 0.457 2e-48
Q6FQK7246 Ubiquitin-conjugating enz yes no 0.725 0.699 0.522 4e-48
Q6BYG4242 Ubiquitin-conjugating enz yes no 0.949 0.929 0.421 3e-47
Q54LP7241 Ubiquitin-conjugating enz yes no 0.687 0.676 0.509 1e-45
O42646227 Ubiquitin-conjugating enz yes no 0.687 0.718 0.524 3e-45
>sp|Q9SHI7|UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana GN=UBC34 PE=2 SV=1 Back     alignment and function desciption
 Score =  397 bits (1019), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/237 (78%), Positives = 206/237 (86%)

Query: 1   MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKF 60
           MAEKAC+KRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGS GTPFAGG+YYGKIKF
Sbjct: 1   MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF 60

Query: 61  PPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120
           PPEYPYKPPGI M TPNGRFMTQKK+CLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP
Sbjct: 61  PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120

Query: 121 TTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPN 180
           TTGSVNTT  EKQRLAK+SLAFNCK PAFRKLFPEYVEKYN+QQLAEQ  ++  +PESP 
Sbjct: 121 TTGSVNTTVIEKQRLAKSSLAFNCKTPAFRKLFPEYVEKYNQQQLAEQATTQLTTPESPQ 180

Query: 181 EENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL 237
           + +++ + EK        +    KE +KN KQ  P W++LLLVS+FG+VMALPLLQL
Sbjct: 181 KSDTKVESEKTIDPTKGDSEGGLKERKKNNKQGLPAWIILLLVSVFGVVMALPLLQL 237
Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q9FK29|UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana GN=UBC33 PE=2 SV=1 Back     alignment and function description
>sp|Q8N2K1|UB2J2_HUMAN Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens GN=UBE2J2 PE=1 SV=3 Back     alignment and function description
>sp|Q6P073|UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus GN=Ube2j2 PE=1 SV=1 Back     alignment and function description
>sp|Q2TA03|UB2J2_BOVIN Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus GN=UBE2J2 PE=2 SV=1 Back     alignment and function description
>sp|P33296|UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC6 PE=1 SV=1 Back     alignment and function description
>sp|Q6FQK7|UBC6_CANGA Ubiquitin-conjugating enzyme E2 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC6 PE=3 SV=1 Back     alignment and function description
>sp|Q6BYG4|UBC6_DEBHA Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC6 PE=3 SV=2 Back     alignment and function description
>sp|Q54LP7|UB2J2_DICDI Ubiquitin-conjugating enzyme E2 J2 OS=Dictyostelium discoideum GN=ube2j2 PE=1 SV=1 Back     alignment and function description
>sp|O42646|UBC6_SCHPO Ubiquitin-conjugating enzyme E2 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
224137760235 predicted protein [Populus trichocarpa] 0.983 0.991 0.807 1e-110
359806739238 uncharacterized protein LOC100789952 [Gl 0.995 0.991 0.807 1e-110
356520176238 PREDICTED: ubiquitin-conjugating enzyme 0.995 0.991 0.803 1e-110
410994608239 ubiquitin conjugating enzyme J2 [Camelli 1.0 0.991 0.799 1e-110
297742924305 unnamed protein product [Vitis vinifera] 0.991 0.770 0.841 1e-110
255586333237 ubiquitin-conjugating enzyme E2 j2, puta 1.0 1.0 0.797 1e-109
225441969237 PREDICTED: ubiquitin-conjugating enzyme 0.991 0.991 0.841 1e-109
297850126237 ubiquitin-conjugating enzyme 32 [Arabido 1.0 1.0 0.784 1e-108
15220062237 ubiquitin-conjugating enzyme E2 34 [Arab 1.0 1.0 0.789 1e-108
357514351241 Ubiquitin carrier protein E2 [Medicago t 1.0 0.983 0.780 1e-108
>gi|224137760|ref|XP_002326433.1| predicted protein [Populus trichocarpa] gi|222833755|gb|EEE72232.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/239 (80%), Positives = 212/239 (88%), Gaps = 6/239 (2%)

Query: 1   MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKF 60
           MAEK+CVKRLQKEYRALCKEPVSHVVARPSP+DILEWHYVLEGS GTPFAGGYYYGKIKF
Sbjct: 1   MAEKSCVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF 60

Query: 61  PPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120
           PPEYPYKPPGI+MITPNGRFMTQKK+CLSMSDFHPESWNPMWSVSSILTGLLSFM D SP
Sbjct: 61  PPEYPYKPPGIIMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMTDNSP 120

Query: 121 TTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPN 180
           TTGSVNTT  +K+RLAK SLAFNCKN AFRKLFPEYVEK++++  +EQ VS Q    +P 
Sbjct: 121 TTGSVNTTAADKRRLAKDSLAFNCKNAAFRKLFPEYVEKHDQELHSEQLVSSQ----APQ 176

Query: 181 EENSRPKVEKVG--SGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL 237
           E+ SR K+EK G  S ED K +D PK+ R+NRKQ FPTWM+LLLVSIFG+VMALPLLQL
Sbjct: 177 EDKSRAKLEKHGDSSVEDAKRVDAPKDERRNRKQPFPTWMMLLLVSIFGVVMALPLLQL 235

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359806739|ref|NP_001241297.1| uncharacterized protein LOC100789952 [Glycine max] gi|255647570|gb|ACU24248.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356520176|ref|XP_003528740.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Glycine max] Back     alignment and taxonomy information
>gi|410994608|gb|AFV96170.1| ubiquitin conjugating enzyme J2 [Camellia oleifera] Back     alignment and taxonomy information
>gi|297742924|emb|CBI35791.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255586333|ref|XP_002533817.1| ubiquitin-conjugating enzyme E2 j2, putative [Ricinus communis] gi|223526254|gb|EEF28570.1| ubiquitin-conjugating enzyme E2 j2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225441969|ref|XP_002264017.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297850126|ref|XP_002892944.1| ubiquitin-conjugating enzyme 32 [Arabidopsis lyrata subsp. lyrata] gi|297338786|gb|EFH69203.1| ubiquitin-conjugating enzyme 32 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220062|ref|NP_173172.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana] gi|145323930|ref|NP_001077554.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana] gi|75313457|sp|Q9SHI7.1|UBC34_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 34; AltName: Full=Ubiquitin carrier protein 34 gi|5734741|gb|AAD50006.1|AC007651_1 Similar to Ubiquitin Conjugating Enzyme [Arabidopsis thaliana] gi|21536906|gb|AAM61238.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana] gi|27765034|gb|AAO23638.1| At1g17280 [Arabidopsis thaliana] gi|110742918|dbj|BAE99355.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana] gi|332191446|gb|AEE29567.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana] gi|332191447|gb|AEE29568.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357514351|ref|XP_003627464.1| Ubiquitin carrier protein E2 [Medicago truncatula] gi|217075280|gb|ACJ86000.1| unknown [Medicago truncatula] gi|355521486|gb|AET01940.1| Ubiquitin carrier protein E2 [Medicago truncatula] gi|388490584|gb|AFK33358.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
TAIR|locus:2020392237 UBC34 "AT1G17280" [Arabidopsis 1.0 1.0 0.742 4.2e-95
TAIR|locus:2177502243 UBC33 "AT5G50430" [Arabidopsis 0.995 0.971 0.704 4e-90
UNIPROTKB|E1BZ66259 UBE2J2 "Uncharacterized protei 0.746 0.683 0.483 2.1e-45
UNIPROTKB|B1AMF0196 UBE2J2 "Ubiquitin-conjugating 0.725 0.877 0.494 4.4e-45
UNIPROTKB|Q8N2K1259 UBE2J2 "Ubiquitin-conjugating 0.725 0.664 0.494 4.4e-45
CGD|CAL0004643243 orf19.7347 [Candida albicans ( 0.848 0.827 0.420 5.6e-45
UNIPROTKB|J9NYP5259 UBE2J2 "Uncharacterized protei 0.725 0.664 0.488 7.1e-45
UNIPROTKB|Q2TA03259 UBE2J2 "Ubiquitin-conjugating 0.725 0.664 0.488 9.1e-45
UNIPROTKB|F1RJF5259 UBE2J2 "Uncharacterized protei 0.725 0.664 0.488 9.1e-45
MGI|MGI:2153608259 Ube2j2 "ubiquitin-conjugating 0.725 0.664 0.488 9.1e-45
TAIR|locus:2020392 UBC34 "AT1G17280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 946 (338.1 bits), Expect = 4.2e-95, P = 4.2e-95
 Identities = 176/237 (74%), Positives = 195/237 (82%)

Query:     1 MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKF 60
             MAEKAC+KRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGS GTPFAGG+YYGKIKF
Sbjct:     1 MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF 60

Query:    61 PPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDXXX 120
             PPEYPYKPPGI M TPNGRFMTQKK+CLSMSDFHPESWNPMWSVSSILTGLLSFMMD   
Sbjct:    61 PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120

Query:   121 XXXXXXXXXEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPN 180
                       EKQRLAK+SLAFNCK PAFRKLFPEYVEKYN+QQLAEQ  ++  +PESP 
Sbjct:   121 TTGSVNTTVIEKQRLAKSSLAFNCKTPAFRKLFPEYVEKYNQQQLAEQATTQLTTPESPQ 180

Query:   181 EENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL 237
             + +++ + EK        +    KE +KN KQ  P W++LLLVS+FG+VMALPLLQL
Sbjct:   181 KSDTKVESEKTIDPTKGDSEGGLKERKKNNKQGLPAWIILLLVSVFGVVMALPLLQL 237
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS;IDA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IDA
TAIR|locus:2177502 UBC33 "AT5G50430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZ66 UBE2J2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B1AMF0 UBE2J2 "Ubiquitin-conjugating enzyme E2 J2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N2K1 UBE2J2 "Ubiquitin-conjugating enzyme E2 J2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
CGD|CAL0004643 orf19.7347 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYP5 UBE2J2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TA03 UBE2J2 "Ubiquitin-conjugating enzyme E2 J2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJF5 UBE2J2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2153608 Ube2j2 "ubiquitin-conjugating enzyme E2J 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6BYG4UBC6_DEBHA6, ., 3, ., 2, ., 1, 90.42120.94930.9297yesno
Q6FQK7UBC6_CANGA6, ., 3, ., 2, ., 1, 90.52290.72570.6991yesno
Q54LP7UB2J2_DICDI6, ., 3, ., 2, ., 1, 90.50900.68770.6763yesno
Q2TA03UB2J2_BOVIN6, ., 3, ., 2, ., 1, 90.51740.72570.6640yesno
Q9FK29UBC33_ARATH6, ., 3, ., 2, ., 1, 90.74071.00.9753nono
Q8N2K1UB2J2_HUMAN6, ., 3, ., 2, ., 1, 90.52320.72570.6640yesno
O42646UBC6_SCHPO6, ., 3, ., 2, ., 1, 90.52430.68770.7180yesno
Q74Z34UBC6_ASHGO6, ., 3, ., 2, ., 1, 90.37390.97460.9545yesno
Q6P073UB2J2_MOUSE6, ., 3, ., 2, ., 1, 90.51740.72570.6640yesno
Q9SHI7UBC34_ARATH6, ., 3, ., 2, ., 1, 90.78901.01.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.190.979
3rd Layer6.3.20.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00290005
hypothetical protein (235 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_LG_I001037
hypothetical protein (1054 aa)
     •  0.800
eugene3.00090669
hypothetical protein (1110 aa)
     •  0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-42
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 3e-33
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 3e-31
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 4e-31
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 3e-15
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 3e-09
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information 
 Score =  140 bits (355), Expect = 2e-42
 Identities = 47/153 (30%), Positives = 74/153 (48%), Gaps = 14/153 (9%)

Query: 7   VKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPY 66
            KRLQKE + L K+P S + A P   ++LEWH  + G   TP+ GG +   I+FP +YP+
Sbjct: 1   SKRLQKELKDLKKDPPSGISAEPVEENLLEWHGTIRGPPDTPYEGGIFKLDIEFPEDYPF 60

Query: 67  KPPGILMIT--PNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGS 124
           KPP +  +T   +       K+CLS+   H   W+P +++ ++L  L S + +  P    
Sbjct: 61  KPPKVRFVTKIYHPNVDENGKICLSILKTH--GWSPAYTLRTVLLSLQSLLNE--PNPSD 116

Query: 125 VNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYV 157
                 E  +L K           F+K   E+ 
Sbjct: 117 --PLNAEAAKLYKE------NREEFKKKAREWT 141

This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD. Length = 141
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
KOG0894244 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 100.0
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 100.0
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 100.0
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0423223 consensus Ubiquitin-protein ligase [Posttranslatio 99.98
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0428314 consensus Non-canonical ubiquitin conjugating enzy 99.96
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 99.95
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.95
KOG0429258 consensus Ubiquitin-conjugating enzyme-related pro 99.75
KOG08951101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.72
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.65
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 99.11
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 98.7
KOG0897122 consensus Predicted ubiquitin-conjugating enzyme [ 98.69
KOG3357167 consensus Uncharacterized conserved protein [Funct 98.29
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.06
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 97.92
KOG2391 365 consensus Vacuolar sorting protein/ubiquitin recep 97.21
PF14462122 Prok-E2_E: Prokaryotic E2 family E 96.71
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 95.53
smart00591107 RWD domain in RING finger and WD repeat containing 95.06
PF14457162 Prok-E2_A: Prokaryotic E2 family A 89.03
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-52  Score=348.97  Aligned_cols=237  Identities=60%  Similarity=1.024  Sum_probs=204.8

Q ss_pred             CCcHHHHHHHHHHHHHHhhCCCCCEEEEeCCCCceeEEEEEEcCCCCCCCCcEEEEEEECCCCCCCCCCceeecCCCcee
Q 026499            1 MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRF   80 (237)
Q Consensus         1 Mas~~~~kRL~kE~~~l~~~~~~gi~v~p~~~nl~~W~~~i~GP~gTpYegG~f~~~i~fP~~YP~~pP~v~F~tPn~~v   80 (237)
                      ||++++.+||+|||+.|+++|.++|.++|.++|+.+||.+|.||+||||+||.|+..|.||.+||++||.|+++|||+++
T Consensus         1 ma~k~a~kRl~keY~~l~k~Pv~~i~A~P~p~nILEWHYvl~GpedTPy~GG~YhGkl~FP~eyP~KPPaI~MiTPNGRF   80 (244)
T KOG0894|consen    1 MASKAAVKRLQKEYRALCKDPVPYIVARPNPNNILEWHYVLRGPEDTPYYGGYYHGKLIFPPEYPFKPPAITMITPNGRF   80 (244)
T ss_pred             CcchHHHHHHHHHHHHHHhCCchhhccCCCccceeeeEEEeeCCCCCCccCceeeeEEeCCCCCCCCCCeeEEECCCCce
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCceEeeccCCCCCCCCCCccchhhhhhhhccccccCCCCCCCCCChHHHHHHHHHHHHHhccChHHHHHHHHHHHHHH
Q 026499           81 MTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKY  160 (237)
Q Consensus        81 ~~~G~ICl~iL~~~~~~WsP~~~i~~vL~~I~~lL~~pnp~~~~~~~~~a~~~~la~~s~~~~~~~~~f~~~~r~~v~k~  160 (237)
                      -.+-++||+|.++|++.|+|+|++++||.+|.++|.+..|..+++++...+|+++|+.|..|+++...|++.+.|+|++|
T Consensus        81 ktntRLCLSiSDfHPdsWNP~WsVStILtGLlSFM~e~~pTtGSI~tS~~~kr~lA~~SlaFN~kn~~F~~lFPE~Vee~  160 (244)
T KOG0894|consen   81 KTNTRLCLSISDFHPDSWNPGWSVSTILTGLLSFMTEDSPTTGSIETSDQDKRMLAKSSLAFNLKNPKFCELFPEVVEEY  160 (244)
T ss_pred             ecCceEEEeccccCcCcCCCcccHHHHHHHHHHHHhcCCCccCcccccHHHHHHHHHhhhhhccCChHHHHHhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhHHhhhhhcCC-CCC---CCCCCCCcccccC-CCCCCcccCCCchHHhhcccC-CCchHHHHHHHHHHHHHHhhcc
Q 026499          161 NEQQLAEQRVSEQLS-PES---PNEENSRPKVEKV-GSGEDMKTIDTPKEARKNRKQ-SFPTWMLLLLVSIFGIVMALPL  234 (237)
Q Consensus       161 a~~~~~~~~~~~~~~-~~~---~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  234 (237)
                      .+++..+++...++. .++   ..........++. ..+..-....+++..++|.|+ -.|.|..++++++||++||+||
T Consensus       161 nq~~~a~~~a~~~~t~~e~~~~p~~~~~~v~~e~~l~~~~~~~a~~~l~~~~~n~k~~gl~~~~~~~~~v~~g~a~~~~~  240 (244)
T KOG0894|consen  161 NQEQLAKQAAAVQGTTPEANGVPAAEFALVENEEILDLGHGRGAEGGLKNLPFNSKQDGLPGWALLALLVFFGFAAALPL  240 (244)
T ss_pred             HHHHHHhhhhcccCCCcCcccCcchhhhccCccceecCCcccccchhhccccccchhccccchhHHHHHHHHHHHHHHhh
Confidence            999988873332221 111   1112222222222 111112223455667777666 6799999999999999999999


Q ss_pred             CCC
Q 026499          235 LQL  237 (237)
Q Consensus       235 ~~~  237 (237)
                      +|+
T Consensus       241 ~~~  243 (244)
T KOG0894|consen  241 VQL  243 (244)
T ss_pred             hcc
Confidence            986

>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3357 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
2f4w_A187 Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 1 1e-47
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 2e-13
1jas_A152 Hsubc2b Length = 152 5e-13
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 6e-13
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 7e-13
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 7e-13
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 7e-13
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 7e-13
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 7e-13
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 7e-13
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 8e-13
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 8e-13
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 9e-13
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 9e-13
1x23_A155 Crystal Structure Of Ubch5c Length = 155 9e-13
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-12
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-12
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 2e-12
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 2e-12
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-12
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 3e-12
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 3e-12
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-12
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 3e-12
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 3e-12
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 4e-12
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 5e-12
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 7e-12
3jvz_A146 E2~ubiquitin-Hect Length = 146 1e-11
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 1e-11
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 1e-11
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-11
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 2e-11
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 2e-11
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 5e-11
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 8e-11
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 2e-10
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 3e-10
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 4e-09
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 8e-09
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 1e-08
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 2e-08
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 2e-08
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 2e-08
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 2e-08
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 3e-08
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 5e-08
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 1e-07
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 2e-07
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 2e-07
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 2e-07
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 2e-07
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 2e-07
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 4e-07
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 5e-07
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 2e-06
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 2e-06
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 2e-06
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 3e-06
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 3e-06
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 4e-06
2fo3_A125 Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Le 5e-06
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 5e-06
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 6e-06
2a7l_A136 Structure Of The Human Hypothetical Ubiquitin-Conju 7e-06
2y9m_A172 Pex4p-Pex22p Structure Length = 172 7e-06
2y9o_A172 Pex4p-Pex22p Mutant I Structure Length = 172 7e-06
2y9p_A172 Pex4p-Pex22p Mutant Ii Structure Length = 172 7e-06
2h2y_A136 Crystal Structure Of Ubiquitin Conjugating Enzyme E 8e-06
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 1e-05
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 1e-05
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 2e-05
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 3e-05
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 3e-05
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 4e-05
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 4e-05
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 4e-05
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 4e-05
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 4e-05
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 4e-05
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 5e-05
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 5e-05
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 5e-05
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 5e-05
1c4z_D154 Structure Of E6ap: Insights Into Ubiquitination Pat 2e-04
3sqv_C156 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 2e-04
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 3e-04
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 3e-04
2kjh_A152 Nmr Based Structural Model Of The Ubch8-Ubiquitin C 4e-04
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 5e-04
1wzv_A155 Crystal Structure Of Ubch8 Length = 155 6e-04
>pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 187 Back     alignment and structure 
Iteration: 1

 Score =  186 bits (471), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 119/172 (69%)
Query: 2   AEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFP 61
           A     +RL+++Y  + K+PV ++ A P P++ILEWHYV+ G   TP+ GGYY+GK+ FP
Sbjct: 11  APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP 70
Query: 62  PEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDXXXX 121
            E+P+KPP I MITPNGRF    +LCLS++DFHP++WNP WSVS+ILTGLLSFM++    
Sbjct: 71  REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPT 130
Query: 122 XXXXXXXXEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQ 173
                     K++LA  SLAFN K+  F +LFPE VE+  ++Q A+  +S +
Sbjct: 131 LGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR 182
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2FO3|A Chain A, Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Length = 125 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 Back     alignment and structure
>pdb|2Y9M|A Chain A, Pex4p-Pex22p Structure Length = 172 Back     alignment and structure
>pdb|2Y9O|A Chain A, Pex4p-Pex22p Mutant I Structure Length = 172 Back     alignment and structure
>pdb|2Y9P|A Chain A, Pex4p-Pex22p Mutant Ii Structure Length = 172 Back     alignment and structure
>pdb|2H2Y|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2 From Plasmodium Falciparum Length = 136 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 Back     alignment and structure
>pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 2e-79
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 1e-27
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 3e-27
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 4e-27
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 8e-27
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 9e-27
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 4e-26
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 7e-26
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 1e-25
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 1e-25
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 3e-25
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 5e-25
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 1e-24
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 1e-24
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 1e-24
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 2e-24
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 3e-24
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-24
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 4e-24
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 4e-24
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 5e-24
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 6e-24
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 9e-24
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-23
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 1e-23
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 1e-23
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 2e-23
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 2e-23
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 2e-23
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 8e-23
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 8e-23
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 9e-23
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 1e-22
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 7e-22
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 7e-22
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 7e-22
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-21
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 1e-21
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 3e-21
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 8e-21
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 6e-20
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 9e-20
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 1e-19
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 2e-19
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 3e-19
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 3e-19
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 3e-19
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 4e-19
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 7e-18
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 2e-17
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
 Score =  235 bits (602), Expect = 2e-79
 Identities = 90/175 (51%), Positives = 126/175 (72%)

Query: 2   AEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFP 61
           A     +RL+++Y  + K+PV ++ A P P++ILEWHYV+ G   TP+ GGYY+GK+ FP
Sbjct: 11  APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP 70

Query: 62  PEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPT 121
            E+P+KPP I MITPNGRF    +LCLS++DFHP++WNP WSVS+ILTGLLSFM++  PT
Sbjct: 71  REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPT 130

Query: 122 TGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSP 176
            GS+ T+   K++LA  SLAFN K+  F +LFPE VE+  ++Q A+  +S +   
Sbjct: 131 LGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQT 185
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 100.0
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 100.0
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 100.0
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 100.0
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 100.0
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 100.0
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 100.0
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 100.0
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.9
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.69
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.67
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.24
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 95.57
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 94.97
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 94.81
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 92.59
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 91.11
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 90.79
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 88.45
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 86.62
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
Probab=100.00  E-value=7.9e-44  Score=294.74  Aligned_cols=152  Identities=26%  Similarity=0.561  Sum_probs=139.3

Q ss_pred             CCcHHHHHHHHHHHHHHhhCCCCCEEEEeCCCCceeEEEEEEcCCCCCCCCcEEEEEEECCCCCCCCCCceeecCC--Cc
Q 026499            1 MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITP--NG   78 (237)
Q Consensus         1 Mas~~~~kRL~kE~~~l~~~~~~gi~v~p~~~nl~~W~~~i~GP~gTpYegG~f~~~i~fP~~YP~~pP~v~F~tP--n~   78 (237)
                      |++ .+.+||++|+++|++++++||++.+.++|+++|+++|.||+||||+||+|+|+|.||++||++||+|+|.|+  |+
T Consensus         1 Ms~-~a~~RL~kEl~~l~~~~~~gi~~~p~~~nl~~W~~~I~GP~~tpYegG~f~l~i~fp~~YP~~PP~v~F~t~i~HP   79 (169)
T 1ayz_A            1 MST-PARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHP   79 (169)
T ss_dssp             -CC-HHHHHHHHHHHHHHHSCCTTEEEEEETTEEEEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEESSCCCCT
T ss_pred             CCh-HHHHHHHHHHHHHHhCCCCCEEEEecCCccccceEEEECCCCCCcCCCEEEEEEECcccCCCCCCccccccCCccC
Confidence            776 678999999999999999999999999999999999999999999999999999999999999999999994  34


Q ss_pred             eecCCceEeeccCCCCCCCCCCccchhhhhhhhccccccCCCCCCCCCChHHHHHHHHHHHHHhccChHHHHHHHHHHHH
Q 026499           79 RFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVE  158 (237)
Q Consensus        79 ~v~~~G~ICl~iL~~~~~~WsP~~~i~~vL~~I~~lL~~pnp~~~~~~~~~a~~~~la~~s~~~~~~~~~f~~~~r~~v~  158 (237)
                      +|+.+|+||+++|+   ++|+|+++|.+||++|++||.+|||+++ +|..+|.         +|.++++.|.++||+||+
T Consensus        80 NI~~~G~ICl~iL~---~~WsP~~~i~~vL~si~~ll~~Pn~~~P-~n~~aa~---------~~~~d~~~y~~~~r~~~~  146 (169)
T 1ayz_A           80 NVYANGEICLDILQ---NRWTPTYDVASILTSIQSLFNDPNPASP-ANVEAAT---------LFKDHKSQYVKRVKETVE  146 (169)
T ss_dssp             TBCTTSBBCCGGGT---TTCCTTCCHHHHHHHHHHHHTCCCCSSC-SSHHHHH---------HHHHCHHHHHHHHHHHHH
T ss_pred             CCCCCCeEeehhhc---cCCCCcCcHHHHHHHHHHHHhCCCCCcH-HHHHHHH---------HHHHCHHHHHHHHHHHHH
Confidence            47889999999997   8999999999999999999999999997 5655553         788999999999999999


Q ss_pred             HHhhhhhH
Q 026499          159 KYNEQQLA  166 (237)
Q Consensus       159 k~a~~~~~  166 (237)
                      +|+.....
T Consensus       147 ~~a~~~~~  154 (169)
T 1ayz_A          147 KSWEDDMD  154 (169)
T ss_dssp             HHHHHHTC
T ss_pred             HHcCCCcc
Confidence            99986654
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 2e-47
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 3e-25
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 8e-25
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 2e-24
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 7e-24
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 1e-23
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 2e-23
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 3e-23
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 3e-22
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 1e-21
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 2e-21
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-21
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 3e-21
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 4e-21
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 5e-21
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 7e-21
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-20
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-20
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 3e-20
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 7e-20
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-19
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 2e-19
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 1e-18
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 2e-18
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 3e-18
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 2e-17
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 2e-17
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 3e-17
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 3e-17
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 4e-17
d1uzxa_152 d.20.1.2 (A:) Vacuolar protein sorting-associated 6e-05
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 J2 [TaxId: 9606]

 Score =  152 bits (384), Expect = 2e-47
 Identities = 86/154 (55%), Positives = 117/154 (75%)

Query: 7   VKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPY 66
            +RL+++Y  + K+PV ++ A P P++ILEWHYV+ G   TP+ GGYY+GK+ FP E+P+
Sbjct: 3   TQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPF 62

Query: 67  KPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVN 126
           KPP I MITPNGRF    +LCLS++DFHP++WNP WSVS+ILTGLLSFM++  PT GS+ 
Sbjct: 63  KPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIE 122

Query: 127 TTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKY 160
           T+   K++LA  SLAFN K+  F +LFPE VE+ 
Sbjct: 123 TSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEI 156
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 100.0
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 100.0
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.97
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.96
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.74
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.62
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 98.66
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 95.73
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 83.95
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 83.31
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 80.02
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 T [TaxId: 9606]

Probab=100.00  E-value=4.1e-42  Score=277.97  Aligned_cols=150  Identities=23%  Similarity=0.516  Sum_probs=137.7

Q ss_pred             HHHHHHHHHHHHHhhCCCCCEEEEeCCCCceeEEEEEEcCCCCCCCCcEEEEEEECCCCCCCCCCceeecCC--CceecC
Q 026499            5 ACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITP--NGRFMT   82 (237)
Q Consensus         5 ~~~kRL~kE~~~l~~~~~~gi~v~p~~~nl~~W~~~i~GP~gTpYegG~f~~~i~fP~~YP~~pP~v~F~tP--n~~v~~   82 (237)
                      ++.+||++|+++|++++++||++.|+++|+++|+++|.||+||||+||+|++.|.||++||++||+|+|.||  |++|+.
T Consensus         2 ~~~~Rl~kE~~~l~~~~~~gi~~~p~~~~~~~w~~~I~Gp~~TpY~gg~f~~~i~~p~~YP~~pP~v~f~t~i~HPnV~~   81 (154)
T d1yh2a1           2 QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDS   81 (154)
T ss_dssp             HHHHHHHHHHHHHHHSCCTTEEEEESSSCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTSSCCEEEESSCCCBTTBCT
T ss_pred             cHHHHHHHHHHHHHHCcCCCEEEEECCcchhhhhceEeCCCCCCCCCCEEEEEEecCccccCCCceeeccCCCCcCCcCC
Confidence            467999999999999999999999999999999999999999999999999999999999999999999996  555899


Q ss_pred             CceEeeccCCCCC-CCCCCccchhhhhhhhccccccCCCCCCCCCChHHHHHHHHHHHHHhccChHHHHHHHHHHHHHHh
Q 026499           83 QKKLCLSMSDFHP-ESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYN  161 (237)
Q Consensus        83 ~G~ICl~iL~~~~-~~WsP~~~i~~vL~~I~~lL~~pnp~~~~~~~~~a~~~~la~~s~~~~~~~~~f~~~~r~~v~k~a  161 (237)
                      +|.||+++|+... +.|+|++++.+||++|++||.+|+++++ .|.++++         +|.+|++.|.++||+||+|||
T Consensus        82 ~g~icl~~l~~~~~~~w~p~~~i~~il~~i~~ll~~p~~~~p-~n~eaa~---------~~~~~~~~f~~~~r~~~~k~a  151 (154)
T d1yh2a1          82 AGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDP-LMADISS---------EFKYNKPAFLKNARQWTEKHA  151 (154)
T ss_dssp             TCBBCCGGGSCTTTSCCCTTSCHHHHHHHHHHHHHSCCTTSC-SCHHHHH---------HHHHCHHHHHHHHHHHHHHHS
T ss_pred             CCCcccccccCCccccCCccccHHHHHHHHHHHhccCCCCCc-hhHHHHH---------HHHHCHHHHHHHHHHHHHHHh
Confidence            9999999997543 5899999999999999999999999987 5555543         788999999999999999999


Q ss_pred             hhh
Q 026499          162 EQQ  164 (237)
Q Consensus       162 ~~~  164 (237)
                      +++
T Consensus       152 ~~~  154 (154)
T d1yh2a1         152 RQK  154 (154)
T ss_dssp             CCC
T ss_pred             cCC
Confidence            763
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure