Citrus Sinensis ID: 026559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQINS
cHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEcHHHHHcccEEEEEEEEcEEccccccccccccccEEEEEEcccEEEEEEccccccccccEEEEEEEEEEEEEccccccccEEEEcccccccccc
cccHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEEEEHHHHHcccEEEEEEcccEEcccccccccccccccEEEEcccccEEEEEcccccccccccEEEEEEEEEEEEccccccccEEEEEccccccccc
MAHRRARLLFLLCALCYALNVIAGKSYYEvlqvprgasdEQIKRAYRKLALkyhpdknqgneEANKRFAEINNAyevlsdsetrniydtygeeglkqhaagggrgggmgvNIQDIFssffgggpmeedekivkgdDVIVELDATLEdlymggslkvwreknvikpapgkrrcncrnevyhkqigpgmFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFkcdwqins
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLAlkyhpdknqgneEANKRFAEINNayevlsdsetRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLymggslkvwreknvikpapgkrrcncRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIkfkcdwqins
MAHrrarllfllcalcyalNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAgggrgggmgVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQINS
*****ARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKY****************EINNAYEVLSD*ETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQI**
****RARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEE****************VNIQDIF***********************ELDATLEDLYMGGSLKVWREKNVIKPAPGKR***CRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFI**********
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQINS
*AHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGP*******VKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGxxxxxxxxxxxxxxxxxxxxxETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQINS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query237 2.2.26 [Sep-21-2011]
Q99KV1 358 DnaJ homolog subfamily B yes no 0.856 0.567 0.479 6e-48
Q6TUG0 358 DnaJ homolog subfamily B yes no 0.856 0.567 0.479 6e-48
Q3ZBA6 358 DnaJ homolog subfamily B yes no 0.856 0.567 0.479 9e-48
Q5RAJ6 358 DnaJ homolog subfamily B yes no 0.856 0.567 0.479 9e-48
Q9UBS4 358 DnaJ homolog subfamily B yes no 0.856 0.567 0.479 9e-48
P81999 358 DnaJ homolog subfamily B yes no 0.805 0.533 0.488 2e-46
Q8MPX3 355 DnaJ homolog dnj-20 OS=Ca yes no 0.894 0.597 0.411 2e-33
Q626I7 382 DnaJ homolog dnj-20 OS=Ca N/A no 0.907 0.562 0.403 4e-31
Q5NVI9 396 DnaJ homolog subfamily A no no 0.818 0.489 0.412 1e-30
P63036 397 DnaJ homolog subfamily A no no 0.822 0.491 0.412 4e-30
>sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 Back     alignment and function desciption
 Score =  191 bits (484), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 140/221 (63%), Gaps = 18/221 (8%)

Query: 10  FLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFA 69
           F L  L     VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  + +A ++F 
Sbjct: 9   FCLLLLYLIGTVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQ 68

Query: 70  EINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAGGGRGGGMGVNIQDIFS-------SFFG 121
           ++  AYEVLSDSE R  YDTYGEEGLK  H +  G          DIFS         FG
Sbjct: 69  DLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFG 118

Query: 122 GGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHK 181
           G P ++D  I +G D+IV+L+ TLE++Y G  ++V R K V + APGKR+CNCR E+   
Sbjct: 119 GTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTT 178

Query: 182 QIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDG 222
           Q+GPG FQ   E VCD+C NVK   E   + V+IE G++DG
Sbjct: 179 QLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDG 219
Serves as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.
Mus musculus (taxid: 10090)
>sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 Back     alignment and function description
>sp|P81999|DJB11_CANFA DnaJ homolog subfamily B member 11 OS=Canis familiaris GN=DNAJB11 PE=1 SV=2 Back     alignment and function description
>sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=4 SV=2 Back     alignment and function description
>sp|Q626I7|DNJ20_CAEBR DnaJ homolog dnj-20 OS=Caenorhabditis briggsae GN=dnj-20 PE=4 SV=1 Back     alignment and function description
>sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 Back     alignment and function description
>sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
356505618 343 PREDICTED: dnaJ homolog subfamily B memb 0.932 0.644 0.860 1e-111
356572775 343 PREDICTED: dnaJ homolog subfamily B memb 0.932 0.644 0.847 1e-108
255642409217 unknown [Glycine max] 0.915 1.0 0.858 1e-108
225437515 345 PREDICTED: dnaJ homolog subfamily B memb 0.936 0.643 0.879 1e-107
449436439 344 PREDICTED: dnaJ homolog subfamily B memb 0.945 0.651 0.846 1e-105
224064488 345 predicted protein [Populus trichocarpa] 0.915 0.628 0.881 1e-105
224131018 349 predicted protein [Populus trichocarpa] 0.932 0.633 0.874 1e-103
255548499 345 Chaperone protein dnaJ, putative [Ricinu 0.940 0.646 0.887 1e-102
297821166 346 DNAJ heat shock family protein [Arabidop 0.953 0.653 0.820 1e-100
15228802 346 DNAJ heat shock family protein [Arabidop 0.953 0.653 0.820 1e-100
>gi|356505618|ref|XP_003521587.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max] Back     alignment and taxonomy information
 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 208/223 (93%), Gaps = 2/223 (0%)

Query: 1   MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG 60
           MA R A LLFLLCALCY+L  IAGKSYY++LQ+ +GASDEQIKRAYRKLALKYHPDKN G
Sbjct: 1   MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG 60

Query: 61  NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF 120
           NEEANK+FAEI+NAYEVLSDSE RNIYD YGEEGLKQHAA GGRGGGM  N QDIFS+FF
Sbjct: 61  NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGGRGGGM--NFQDIFSTFF 118

Query: 121 GGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYH 180
           GGGPMEE+EKIVKGDD++V+LDATLEDLYMGG+LKVWREKNV+KPAPGKRRCNCRNEVYH
Sbjct: 119 GGGPMEEEEKIVKGDDLVVDLDATLEDLYMGGTLKVWREKNVLKPAPGKRRCNCRNEVYH 178

Query: 181 KQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQ 223
           KQIGPGMFQQMTEQVC+QC NVKY REGYF+TVDIEKGMQDGQ
Sbjct: 179 KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQ 221

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356572775|ref|XP_003554541.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max] Back     alignment and taxonomy information
>gi|255642409|gb|ACU21468.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225437515|ref|XP_002275221.1| PREDICTED: dnaJ homolog subfamily B member 11 [Vitis vinifera] gi|147769615|emb|CAN72389.1| hypothetical protein VITISV_040417 [Vitis vinifera] gi|297743958|emb|CBI36928.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436439|ref|XP_004136000.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus] gi|449507850|ref|XP_004163147.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224064488|ref|XP_002301501.1| predicted protein [Populus trichocarpa] gi|222843227|gb|EEE80774.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224131018|ref|XP_002320981.1| predicted protein [Populus trichocarpa] gi|118486904|gb|ABK95286.1| unknown [Populus trichocarpa] gi|222861754|gb|EEE99296.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548499|ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223545786|gb|EEF47290.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297821166|ref|XP_002878466.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] gi|297324304|gb|EFH54725.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228802|ref|NP_191819.1| DNAJ heat shock family protein [Arabidopsis thaliana] gi|7362740|emb|CAB83110.1| putative protein [Arabidopsis thaliana] gi|20453120|gb|AAM19802.1| AT3g62600/F26K9_30 [Arabidopsis thaliana] gi|21593230|gb|AAM65179.1| unknown [Arabidopsis thaliana] gi|21928031|gb|AAM78044.1| At3g62600/F26K9_30 [Arabidopsis thaliana] gi|332646847|gb|AEE80368.1| DNAJ heat shock family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
TAIR|locus:2081725 346 ATERDJ3B [Arabidopsis thaliana 0.869 0.595 0.822 3.5e-91
RGD|1307373 358 Dnajb11 "DnaJ (Hsp40) homolog, 0.860 0.569 0.488 1.1e-48
UNIPROTKB|Q9UBS4 358 DNAJB11 "DnaJ homolog subfamil 0.860 0.569 0.488 1.8e-48
MGI|MGI:1915088 358 Dnajb11 "DnaJ (Hsp40) homolog, 0.860 0.569 0.488 1.8e-48
UNIPROTKB|Q3ZBA6 358 DNAJB11 "DnaJ homolog subfamil 0.860 0.569 0.488 2.9e-48
UNIPROTKB|F1SFJ8 358 DNAJB11 "Uncharacterized prote 0.860 0.569 0.488 2.9e-48
UNIPROTKB|P81999 358 DNAJB11 "DnaJ homolog subfamil 0.856 0.567 0.485 7.7e-48
UNIPROTKB|F1NVY5 364 DNAJB11 "Uncharacterized prote 0.852 0.554 0.473 1.8e-46
UNIPROTKB|F1PXX5 358 DNAJB11 "DnaJ homolog subfamil 0.843 0.558 0.478 2.3e-46
UNIPROTKB|J9P8A9269 DNAJB11 "DnaJ homolog subfamil 0.843 0.743 0.478 2.3e-46
TAIR|locus:2081725 ATERDJ3B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 909 (325.0 bits), Expect = 3.5e-91, P = 3.5e-91
 Identities = 171/208 (82%), Positives = 189/208 (90%)

Query:    21 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSD 80
             V+AGKSYY+VLQVP+GASDEQIKRAYRKLALKYHPDKNQGNEEA ++FAEINNAYEVLSD
Sbjct:    21 VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD 80

Query:    81 SETRNIYDTYGEEGLKQHAAXXXXXXXXX-VNIQDIFSSFFGGGPMEEDEKIVKGDDVIV 139
              E R IY+ YGEEGLKQ +A          +N+QDIFSSFFGGG MEE+EK+VKGDDVIV
Sbjct:    81 EEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGGSMEEEEKVVKGDDVIV 140

Query:   140 ELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQC 199
             EL+ATLEDLYMGGS+KVWREKNVIKPAPGKR+CNCRNEVYH+QIGPGMFQQMTEQVCD+C
Sbjct:   141 ELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDKC 200

Query:   200 QNVKYEREGYFVTVDIEKGMQDGQ-VSF 226
              NVKYEREGYFVTVDIEKGM+DG+ VSF
Sbjct:   201 PNVKYEREGYFVTVDIEKGMKDGEEVSF 228
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS;RCA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005788 "endoplasmic reticulum lumen" evidence=IDA
GO:0052033 "pathogen-associated molecular pattern dependent induction by symbiont of host innate immune response" evidence=IMP
GO:0006984 "ER-nucleus signaling pathway" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0005783 "endoplasmic reticulum" evidence=IDA
RGD|1307373 Dnajb11 "DnaJ (Hsp40) homolog, subfamily B, member 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBS4 DNAJB11 "DnaJ homolog subfamily B member 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915088 Dnajb11 "DnaJ (Hsp40) homolog, subfamily B, member 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBA6 DNAJB11 "DnaJ homolog subfamily B member 11" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFJ8 DNAJB11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81999 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVY5 DNAJB11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXX5 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8A9 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028084001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_42, whole genome shotgun sequence); (345 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00006855001
SubName- Full=Chromosome undetermined scaffold_178, whole genome shotgun sequence; (899 aa)
  •  •  0.871
GSVIVG00032542001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (895 aa)
  •  •  0.869
GSVIVG00006252001
SubName- Full=Chromosome chr1 scaffold_166, whole genome shotgun sequence; (392 aa)
     •  0.800
GSVIVG00017185001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (482 aa)
  •     0.483
GSVIVG00005738001
SubName- Full=Chromosome chr3 scaffold_157, whole genome shotgun sequence; (626 aa)
  •     0.481
GSVIVG00004141001
SubName- Full=Chromosome undetermined scaffold_611, whole genome shotgun sequence; (468 aa)
  •     0.480
GSVIVG00012517001
SubName- Full=Chromosome undetermined scaffold_388, whole genome shotgun sequence; Flags- Fragm [...] (372 aa)
  •     0.478
GSVIVG00017724001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (538 aa)
  •     0.476
GSVIVG00037232001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (658 aa)
  •     0.475
GSVIVG00006687001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (667 aa)
  •     0.475

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 3e-57
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-45
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-45
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-35
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 4e-35
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-34
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 3e-34
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 4e-34
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-33
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-33
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 8e-33
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-32
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-31
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 4e-31
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-31
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-30
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-30
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-29
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-29
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 5e-29
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 9e-29
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-28
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-27
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-27
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-26
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-26
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 9e-26
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-24
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-23
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-22
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 5e-22
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-21
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 5e-21
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-20
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-19
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-16
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 5e-15
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 3e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-07
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 4e-06
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 1e-05
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 3e-05
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 2e-04
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 4e-04
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 0.002
PRK03578176 PRK03578, hscB, co-chaperone HscB; Provisional 0.002
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  185 bits (473), Expect = 3e-57
 Identities = 78/227 (34%), Positives = 110/227 (48%), Gaps = 25/227 (11%)

Query: 23  AGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSE 82
           A + YYE+L V + AS+E+IK+AYRKLA KYHPD+N G++EA ++F EIN AYEVLSD E
Sbjct: 2   AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPE 61

Query: 83  TRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEK--IVKGDDVIVE 140
            R  YD +G  G K    GG   GG G +  DIF  FFGGG           +G D+   
Sbjct: 62  KRAAYDQFGHAGFKAGGFGGFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYN 121

Query: 141 LDATLEDLYMGGSLKVWREKNVI---------KPAPGKRRC-NCR-NEVYHKQIGPGMFQ 189
           L+ TLE+   G   ++   ++V          KP    + C  C  +         G F 
Sbjct: 122 LEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFFS 181

Query: 190 QMT------------EQVCDQCQNVKYEREGYFVTVDIEKGMQDGQV 224
                          +  C +C+     ++   ++V+I  G+ DG  
Sbjct: 182 FQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDR 228

Length = 371
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14296 372 chaperone protein DnaJ; Provisional 100.0
PRK14288 369 chaperone protein DnaJ; Provisional 100.0
PRK14285 365 chaperone protein DnaJ; Provisional 100.0
PRK14298 377 chaperone protein DnaJ; Provisional 100.0
PRK14286 372 chaperone protein DnaJ; Provisional 100.0
PRK14282 369 chaperone protein DnaJ; Provisional 100.0
PRK14287 371 chaperone protein DnaJ; Provisional 100.0
PRK14276 380 chaperone protein DnaJ; Provisional 100.0
PRK14280 376 chaperone protein DnaJ; Provisional 100.0
PRK14278 378 chaperone protein DnaJ; Provisional 100.0
PRK14297 380 chaperone protein DnaJ; Provisional 100.0
PRK14277 386 chaperone protein DnaJ; Provisional 100.0
PRK14279 392 chaperone protein DnaJ; Provisional 100.0
PTZ00037 421 DnaJ_C chaperone protein; Provisional 100.0
PRK10767 371 chaperone protein DnaJ; Provisional 100.0
PRK14301 373 chaperone protein DnaJ; Provisional 100.0
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14284 391 chaperone protein DnaJ; Provisional 100.0
PRK14294 366 chaperone protein DnaJ; Provisional 100.0
PRK14281 397 chaperone protein DnaJ; Provisional 100.0
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14295 389 chaperone protein DnaJ; Provisional 100.0
PRK14291 382 chaperone protein DnaJ; Provisional 100.0
PRK14290 365 chaperone protein DnaJ; Provisional 100.0
PRK14289 386 chaperone protein DnaJ; Provisional 100.0
PRK14283 378 chaperone protein DnaJ; Provisional 100.0
PRK14292 371 chaperone protein DnaJ; Provisional 100.0
PRK14300 372 chaperone protein DnaJ; Provisional 100.0
PRK14293 374 chaperone protein DnaJ; Provisional 100.0
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PRK14299 291 chaperone protein DnaJ; Provisional 100.0
PRK10266 306 curved DNA-binding protein CbpA; Provisional 100.0
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.98
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.83
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.78
PHA03102153 Small T antigen; Reviewed 99.78
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.75
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.75
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.73
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.72
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.7
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.63
PRK05014171 hscB co-chaperone HscB; Provisional 99.55
PRK01356166 hscB co-chaperone HscB; Provisional 99.53
PRK00294173 hscB co-chaperone HscB; Provisional 99.51
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
PRK03578176 hscB co-chaperone HscB; Provisional 99.5
PTZ00100116 DnaJ chaperone protein; Provisional 99.46
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.44
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.39
PHA02624 647 large T antigen; Provisional 99.38
PRK01773173 hscB co-chaperone HscB; Provisional 99.12
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.06
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.98
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 98.96
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.93
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.52
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.51
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.47
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 98.08
PRK14284391 chaperone protein DnaJ; Provisional 97.9
PRK14291382 chaperone protein DnaJ; Provisional 97.9
PRK14282369 chaperone protein DnaJ; Provisional 97.88
PRK14300372 chaperone protein DnaJ; Provisional 97.86
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 97.79
PRK14285365 chaperone protein DnaJ; Provisional 97.77
PRK14290365 chaperone protein DnaJ; Provisional 97.73
PRK14295389 chaperone protein DnaJ; Provisional 97.72
PRK14279392 chaperone protein DnaJ; Provisional 97.72
PRK14276380 chaperone protein DnaJ; Provisional 97.64
PRK14294366 chaperone protein DnaJ; Provisional 97.64
PRK14286372 chaperone protein DnaJ; Provisional 97.61
PRK14299291 chaperone protein DnaJ; Provisional 97.6
PRK14278378 chaperone protein DnaJ; Provisional 97.59
PRK14281397 chaperone protein DnaJ; Provisional 97.58
PRK14301373 chaperone protein DnaJ; Provisional 97.58
PRK10266306 curved DNA-binding protein CbpA; Provisional 97.58
PRK14288369 chaperone protein DnaJ; Provisional 97.56
PRK14297380 chaperone protein DnaJ; Provisional 97.54
PRK14280376 chaperone protein DnaJ; Provisional 97.53
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 97.52
PRK14287371 chaperone protein DnaJ; Provisional 97.51
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.47
PRK14298377 chaperone protein DnaJ; Provisional 97.45
KOG0431453 consensus Auxilin-like protein and related protein 97.45
PRK14283378 chaperone protein DnaJ; Provisional 97.4
PRK10767371 chaperone protein DnaJ; Provisional 97.38
PRK14277386 chaperone protein DnaJ; Provisional 97.38
PRK14289386 chaperone protein DnaJ; Provisional 97.35
PRK14296372 chaperone protein DnaJ; Provisional 97.31
PTZ00037421 DnaJ_C chaperone protein; Provisional 97.31
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 97.29
PRK14292371 chaperone protein DnaJ; Provisional 97.24
PRK14293374 chaperone protein DnaJ; Provisional 97.13
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 96.96
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.82
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.12
PLN03165111 chaperone protein dnaJ-related; Provisional 95.74
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.53
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 90.94
PF1344662 RPT: A repeated domain in UCH-protein 86.96
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 86.38
KOG0724 335 consensus Zuotin and related molecular chaperones 84.9
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 82.01
PF14687112 DUF4460: Domain of unknown function (DUF4460) 81.72
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-61  Score=420.29  Aligned_cols=214  Identities=37%  Similarity=0.627  Sum_probs=183.9

Q ss_pred             hCCCCcceecCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHHHhhcccccccccccccccccccccCC
Q 026559           22 IAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAG  101 (237)
Q Consensus        22 ~~~~~~y~iLgv~~~a~~~eIk~ayr~la~~~hPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~yD~~G~~~~~~~~~~  101 (237)
                      ++.+|||+||||+++||.+|||+||||||++||||+|+.+++|+++|++|++||||||||+||++||+||+.++++...+
T Consensus         1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g   80 (371)
T COG0484           1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG   80 (371)
T ss_pred             CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence            35789999999999999999999999999999999999877899999999999999999999999999999998732222


Q ss_pred             CCCCCCccCChhhhhhhccCCCCC--CCccccccCCceEEEEcccHHHHhcCceeEEEeeee-eecCCCCC---------
Q 026559          102 GGRGGGMGVNIQDIFSSFFGGGPM--EEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKN-VIKPAPGK---------  169 (237)
Q Consensus       102 ~~~~~~~~~~~~d~F~~fFg~~~~--~~~~~~~kg~di~~~l~vtLee~~~G~~~~i~~~~~-v~~~c~G~---------  169 (237)
                      +++.++|+.++.|||++|||++..  .+.+++++|.|+++.|+|||+|||.|++++|.+++. .|..|+|+         
T Consensus        81 g~g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~  160 (371)
T COG0484          81 GFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPK  160 (371)
T ss_pred             CCCcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCC
Confidence            211233333789999999975542  234457899999999999999999999999999986 58899887         


Q ss_pred             --ccccccceEEEEEecCceeEEee------------eccCCCCCCceEEEeeEEEEEEecCCCCCCcEEEEeeecccCC
Q 026559          170 --RRCNCRNEVYHKQIGPGMFQQMT------------EQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQI  235 (237)
Q Consensus       170 --~~C~g~G~v~~~~~~~g~~~~~~------------~~~C~~C~G~g~~~~~~~~~V~Ip~G~~~G~~i~l~g~g~~~~  235 (237)
                        ++|+|+|.+...+.. |++++.+            +++|+.|+|.|++++.++++|+||+|+.+|++|+++|+|++..
T Consensus       161 tC~tC~G~G~v~~~~~~-g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~  239 (371)
T COG0484         161 TCPTCNGSGQVRTVQRT-GFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGP  239 (371)
T ss_pred             cCCCCCCcCeEEEEEee-eEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCC
Confidence              568999988776543 6555433            8999999999999999999999999999999999999999987


Q ss_pred             C
Q 026559          236 N  236 (237)
Q Consensus       236 ~  236 (237)
                      |
T Consensus       240 ~  240 (371)
T COG0484         240 N  240 (371)
T ss_pred             C
Confidence            5

>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-19
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 6e-19
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-18
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-18
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-18
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-18
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-18
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 8e-16
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 7e-15
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 9e-15
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-14
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-14
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-14
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 5e-14
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 7e-14
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 5e-12
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-11
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 7e-10
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-08
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-07
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 3e-07
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 3e-07
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 1e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-06
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-04
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (1%)
Query: 27 YYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGN-EEANKRFAEINNAYEVLSDSETRN 85
          YYEVL VPR AS E IK+AYRKLALK+HPDKN  N EEA +RF ++  AYEVLSD++ R+
Sbjct: 11 YYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRD 70
Query: 86 IYDTYG 91
          IYD YG
Sbjct: 71 IYDRYG 76
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-43
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-43
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-41
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-41
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 6e-40
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 8e-40
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-37
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-37
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 7e-37
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-36
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-35
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-34
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-34
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-34
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 5e-34
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-33
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-33
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-33
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 8e-33
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-31
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-28
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-28
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 7e-28
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-20
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-19
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 9e-18
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 7e-17
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 3e-16
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-16
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-15
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-13
2guz_A71 Mitochondrial import inner membrane translocase su 4e-12
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 7e-11
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 4e-09
3agx_A 181 DNAJ homolog subfamily B member 1; chaperone; 1.85 2e-06
2q2g_A 180 HSP40 protein, heat shock 40 kDa protein, putative 7e-05
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score =  148 bits (375), Expect = 2e-43
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 5/136 (3%)

Query: 25  KSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETR 84
           K YY +L V      + IK AYR+LA KYHPD ++ N +A  +F ++  A+EVL D + R
Sbjct: 28  KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKEN-DAEAKFKDLAEAWEVLKDEQRR 86

Query: 85  NIYDTYGEEGLKQHAAGGGR---GGGMGVNIQDIFSSFFG-GGPMEEDEKIVKGDDVIVE 140
             YD   +           +         +  DIFSS FG        +   +G D+ +E
Sbjct: 87  AEYDQLWQHRNDPGFGRQRQTHEQSYSQQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIE 146

Query: 141 LDATLEDLYMGGSLKV 156
           +   LE+     +  +
Sbjct: 147 VAVFLEETLAEQTRTI 162
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 100.0
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.92
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.89
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.89
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.89
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.88
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.88
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.87
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.87
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.87
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 99.87
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.87
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.87
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.87
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.85
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.84
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.81
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.78
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.78
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.78
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.78
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.76
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.76
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.74
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.74
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.72
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.71
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.7
2guz_A71 Mitochondrial import inner membrane translocase su 99.69
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.66
3agx_A 181 DNAJ homolog subfamily B member 1; chaperone; 1.85 99.59
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.4
2q2g_A 180 HSP40 protein, heat shock 40 kDa protein, putative 99.37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.2
1c3g_A 170 Heat shock protein 40; beta sheets, short helices, 99.18
2guz_B65 Mitochondrial import inner membrane translocase su 99.03
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 98.42
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 98.25
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 97.84
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 97.81
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 97.8
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.73
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 97.6
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 97.52
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 94.35
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 92.31
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 87.74
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=5.7e-40  Score=286.57  Aligned_cols=180  Identities=27%  Similarity=0.369  Sum_probs=58.4

Q ss_pred             hCCCCcceecCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHHHhhcccccccccccccccccccccCC
Q 026559           22 IAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAG  101 (237)
Q Consensus        22 ~~~~~~y~iLgv~~~a~~~eIk~ayr~la~~~hPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~yD~~G~~~~~~~~~~  101 (237)
                      +..+|||+||||+++|+.+|||+|||+||++||||+++.+ .|+++|++|++||++|+||.+|+.||+|+..+.......
T Consensus        25 m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~-~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~  103 (329)
T 3lz8_A           25 MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKEN-DAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGR  103 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCCh-HHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccc
Confidence            3458999999999999999999999999999999999865 488999999999999999999999999854421111000


Q ss_pred             -CC-CCCCc-cCChhhhhhhccCCCC-CCCccccccCCceEEEEcccHHHHhcCceeEEEeeeeeecCCCCCccccccce
Q 026559          102 -GG-RGGGM-GVNIQDIFSSFFGGGP-MEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNE  177 (237)
Q Consensus       102 -~~-~~~~~-~~~~~d~F~~fFg~~~-~~~~~~~~kg~di~~~l~vtLee~~~G~~~~i~~~~~v~~~c~G~~~C~g~G~  177 (237)
                       .+ .+++| +.++.|+|++|||++. ....+.+.+|.|+.++|.|||+|+|+|++++|.+++.+|+         +.| 
T Consensus       104 ~~~~~~~~f~~~~f~diF~~~Fg~~g~~~~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~---------g~G-  173 (329)
T 3lz8_A          104 QRQTHEQSYSQQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN---------VFG-  173 (329)
T ss_dssp             ---------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC---------SCC-
T ss_pred             ccccccCCcCCCchhhhhHhhhcCcCCCCCCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec---------CCe-
Confidence             00 01112 1267899999998632 1112335689999999999999999999999999887642         112 


Q ss_pred             EEEEEecCceeEEeeeccCCCCCCceEEEeeEEEEEEecCCCCCCcEEEEeeecccCCC
Q 026559          178 VYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQVSFIKFKCDWQIN  236 (237)
Q Consensus       178 v~~~~~~~g~~~~~~~~~C~~C~G~g~~~~~~~~~V~Ip~G~~~G~~i~l~g~g~~~~~  236 (237)
                                              ..++...++++|+||||+++|++|+|+|+|++..|
T Consensus       174 ------------------------~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~  208 (329)
T 3lz8_A          174 ------------------------MIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGEN  208 (329)
T ss_dssp             -------------------------CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC--
T ss_pred             ------------------------EEEEecceEEEEeCCCCCCCCCEEEEcccccCCCC
Confidence                                    12234467899999999999999999999998653
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 9e-24
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-20
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-19
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-19
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 7e-17
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-16
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-15
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-15
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 88.5 bits (219), Expect = 9e-24
 Identities = 38/75 (50%), Positives = 55/75 (73%)

Query: 23 AGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSE 82
          A + YYE+L V + A + +I++AY++LA+KYHPD+NQG++EA  +F EI  AYEVL+DS+
Sbjct: 1  AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60

Query: 83 TRNIYDTYGEEGLKQ 97
           R  YD YG    +Q
Sbjct: 61 KRAAYDQYGHAAFEQ 75
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.86
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.85
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.74
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.73
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.46
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.46
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.39
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 98.1
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 98.09
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 97.9
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=3.7e-27  Score=161.19  Aligned_cols=73  Identities=49%  Similarity=0.971  Sum_probs=68.9

Q ss_pred             CCCcceecCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHHHhhcccccccccccccccccc
Q 026559           24 GKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLK   96 (237)
Q Consensus        24 ~~~~y~iLgv~~~a~~~eIk~ayr~la~~~hPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~yD~~G~~~~~   96 (237)
                      .+|||+||||+++||.+|||+|||++++++|||+++.++.+++.|++|++||+||+||.+|..||+||..++.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            5899999999999999999999999999999999987777889999999999999999999999999988764
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure