Citrus Sinensis ID: 026621


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
cccccccccccEEEEEEEEEEEEcccccEEEEEEccccEEEEEccccccccccEEEccEEccccccEEEccEEEEccEEEEEcccccccccEEEcccccccccEEEEEEEEcccccccEEccccEEEcccEEEEEEEccccccccccEEEEEEEEccccccccccEEEEEEEEEEEcccccccEEEEEEEEEccccccccccccccccccccccccEEEccEEEEEEEEEEEEEcc
cccccccccccEEEEEEEEEEEEcccccEEEEEEccccEEEcccccccccccccccHHHcccccccEEEccEEEEEEEEEEEccccccccccccccccccccccEEEEEEcccHcccccccccEEEEcccEEEEEEEEcccccccccEEEEEEEEccccccccccEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccccEEHHHcccccccEEEccEEEEEEEEEEEEccc
mvdtsslglgweVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLewgfdqfipleefndasngylvgdtcVFGAEVLVKERNKCKGECLFLAKltsasnykhVWKIENFSKLEAKLYESEVFvagnqkwkiklypkgqgvgrgsHISVYLALADlstitrdskiYVHFTLRIRDQVLSKHNEKKASTWlstssedwgwSTFVELSYFnkaengflmndVCIVEAEVLRISKAL
mvdtsslglgwEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLakltsasnykhVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKAstwlstssedwgWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
******LGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRI****
*VDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLS**************SEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
*****SLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKC********KLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
Q9FPT1 1116 Ubiquitin carboxyl-termin no no 0.521 0.110 0.346 6e-17
Q84WU2 1115 Ubiquitin carboxyl-termin no no 0.542 0.114 0.333 2e-16
Q8RY18 1055 MATH domain-containing pr no no 0.504 0.112 0.310 9e-11
Q8T1261304 Probable inactive serine/ no no 0.724 0.131 0.242 2e-07
Q86AY4449 TNF receptor-associated f no no 0.474 0.249 0.307 4e-06
Q54FG0460 TNF receptor-associated f no no 0.491 0.252 0.296 0.0002
P11467460 RING finger protein DG17 no no 0.491 0.252 0.312 0.0003
Q54C11437 TNF receptor-associated f no no 0.419 0.226 0.272 0.0004
Q86KX6595 TNF receptor-associated f no no 0.546 0.216 0.292 0.0004
>sp|Q9FPT1|UBP12_ARATH Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabidopsis thaliana GN=UBP12 PE=1 SV=2 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 75/127 (59%), Gaps = 4/127 (3%)

Query: 104 KHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITR 163
           K  W I NFS+   + + S+VFV G  KW+I ++PKG  V    H+S+YL ++D +++  
Sbjct: 56  KFTWTIPNFSRQNTRKHYSDVFVVGGYKWRILIFPKGNNV---DHLSMYLDVSDAASLPY 112

Query: 164 DSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSE-DWGWSTFVELSYFNKAENGFLMNDV 222
               Y  F+L + +Q+ +++  +K +     + E DWG+++F+ LS       G+L+ND 
Sbjct: 113 GWSRYAQFSLAVVNQIHTRYTVRKETQHQFNARESDWGFTSFMPLSELYDPSRGYLVNDT 172

Query: 223 CIVEAEV 229
            +VEAEV
Sbjct: 173 VLVEAEV 179




Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2
>sp|Q84WU2|UBP13_ARATH Ubiquitin carboxyl-terminal hydrolase 13 OS=Arabidopsis thaliana GN=UBP13 PE=1 SV=1 Back     alignment and function description
>sp|Q8RY18|Y5436_ARATH MATH domain-containing protein At5g43560 OS=Arabidopsis thaliana GN=At5g43560 PE=1 SV=1 Back     alignment and function description
>sp|Q8T126|FNKC_DICDI Probable inactive serine/threonine-protein kinase fnkC OS=Dictyostelium discoideum GN=fnkC PE=3 SV=1 Back     alignment and function description
>sp|Q86AY4|Y2340_DICDI TNF receptor-associated factor family protein DDB_G0272340 OS=Dictyostelium discoideum GN=DDB_G0272340 PE=3 SV=2 Back     alignment and function description
>sp|Q54FG0|Y0883_DICDI TNF receptor-associated factor family protein DDB_G0290883 OS=Dictyostelium discoideum GN=DDB_G0290883 PE=3 SV=1 Back     alignment and function description
>sp|P11467|DG17_DICDI RING finger protein DG17 OS=Dictyostelium discoideum GN=zfaA PE=2 SV=2 Back     alignment and function description
>sp|Q54C11|Y3202_DICDI TNF receptor-associated factor family protein DDB_G0293202 OS=Dictyostelium discoideum GN=DDB_G0293202 PE=2 SV=1 Back     alignment and function description
>sp|Q86KX6|Y2348_DICDI TNF receptor-associated factor family protein DDB_G0272348 OS=Dictyostelium discoideum GN=DDB_G0272348 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
297830352309 hypothetical protein ARALYDRAFT_479214 [ 0.949 0.724 0.539 3e-68
21537273309 unknown [Arabidopsis thaliana] 0.949 0.724 0.539 1e-67
18401489309 TRAF-like family protein [Arabidopsis th 0.911 0.695 0.547 1e-65
11994555304 unnamed protein product [Arabidopsis tha 0.911 0.707 0.547 2e-65
255556544 455 nucleic acid binding protein, putative [ 0.949 0.492 0.552 3e-64
449441502316 PREDICTED: BTB/POZ and MATH domain-conta 0.987 0.737 0.523 3e-63
449522688316 PREDICTED: BTB/POZ and MATH domain-conta 0.987 0.737 0.523 4e-63
356519881310 PREDICTED: uncharacterized protein LOC10 0.957 0.729 0.532 2e-61
357479139311 Ubiquitin carboxyl-terminal hydrolase [M 0.953 0.723 0.513 2e-58
224100507249 predicted protein [Populus trichocarpa] 0.957 0.907 0.497 5e-56
>gi|297830352|ref|XP_002883058.1| hypothetical protein ARALYDRAFT_479214 [Arabidopsis lyrata subsp. lyrata] gi|297328898|gb|EFH59317.1| hypothetical protein ARALYDRAFT_479214 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/230 (53%), Positives = 165/230 (71%), Gaps = 6/230 (2%)

Query: 1   MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEF 60
           + D+SSL  GWEVY +FRL++LDQNKD +LILQ   G ERRFH +K EWGFD+FIP   F
Sbjct: 76  LADSSSLSPGWEVYAVFRLYLLDQNKDNYLILQ---GNERRFHAVKREWGFDKFIPTGTF 132

Query: 61  NDASNGYLVGDTCVFGAEVLV-KERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKL 119
           +DASNGYL+ DTC+FGA+V V KER   +GECL + K   A++ KHVWKIENFSKL+ + 
Sbjct: 133 SDASNGYLMEDTCMFGADVFVSKERRSGRGECLSMIK--DATSSKHVWKIENFSKLDKES 190

Query: 120 YESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQV 179
           Y+S  F AG++KWK++ YP G   G G+H+S+YL L D  TI+  +KI+V FT+RI DQ+
Sbjct: 191 YDSNAFFAGDRKWKVRFYPTGTKQGTGTHLSIYLTLVDPETISDGTKIFVEFTIRIFDQL 250

Query: 180 LSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEV 229
             +H   K + W S SS + GW  +V + YF +  +G L+ DVC+VEA+V
Sbjct: 251 QGRHIAGKVTKWFSRSSSEHGWVKYVSMVYFTQPNSGLLLKDVCLVEADV 300




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|21537273|gb|AAM61614.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18401489|ref|NP_566576.1| TRAF-like family protein [Arabidopsis thaliana] gi|332642426|gb|AEE75947.1| TRAF-like family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|11994555|dbj|BAB02742.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255556544|ref|XP_002519306.1| nucleic acid binding protein, putative [Ricinus communis] gi|223541621|gb|EEF43170.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449441502|ref|XP_004138521.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449522688|ref|XP_004168358.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356519881|ref|XP_003528597.1| PREDICTED: uncharacterized protein LOC100779090 [Glycine max] Back     alignment and taxonomy information
>gi|357479139|ref|XP_003609855.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355510910|gb|AES92052.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224100507|ref|XP_002311903.1| predicted protein [Populus trichocarpa] gi|222851723|gb|EEE89270.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:2089045309 AT3G17380 "AT3G17380" [Arabido 0.949 0.724 0.543 1.2e-65
TAIR|locus:2092344379 AT3G20370 "AT3G20370" [Arabido 0.953 0.593 0.337 4.9e-30
TAIR|locus:2055998420 AT2G04170 "AT2G04170" [Arabido 0.957 0.538 0.331 6.2e-30
TAIR|locus:2098318370 AT3G28220 "AT3G28220" [Arabido 0.923 0.589 0.340 3.4e-29
TAIR|locus:2179744351 AT5G26260 "AT5G26260" [Arabido 0.957 0.643 0.318 1.2e-28
TAIR|locus:2179699350 AT5G26280 "AT5G26280" [Arabido 0.957 0.645 0.323 3.1e-28
TAIR|locus:2092329363 AT3G20360 "AT3G20360" [Arabido 0.961 0.625 0.312 1.3e-27
TAIR|locus:2016590396 ZW9 "AT1G58270" [Arabidopsis t 0.940 0.560 0.309 2.5e-26
TAIR|locus:2026745231 AT1G69660 "AT1G69660" [Arabido 0.826 0.844 0.310 3.2e-26
TAIR|locus:2056008411 AT2G04190 "AT2G04190" [Arabido 0.957 0.549 0.297 9.7e-25
TAIR|locus:2089045 AT3G17380 "AT3G17380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 668 (240.2 bits), Expect = 1.2e-65, P = 1.2e-65
 Identities = 125/230 (54%), Positives = 165/230 (71%)

Query:     1 MVDTSSLGLGWEVYVIFRLFVLDQNKDEFLILQDAMGKERRFHVLKLEWGFDQFIPLEEF 60
             + D+SSL  GWEVY +FRL++LDQNKD +LILQ   G ERRFH +K EWGFD+FIP   F
Sbjct:    76 LADSSSLSPGWEVYAVFRLYLLDQNKDNYLILQ---GNERRFHSVKREWGFDKFIPTGTF 132

Query:    61 NDASNGYLVGDTCVFGAEVLV-KERNKCKGECLFLAKLTSASNYKHVWKIENFSKLEAKL 119
             +DASNGYL+ DTC+FGA+V V KER   +GECL + K   A++ KHVWKIENFSKL+ + 
Sbjct:   133 SDASNGYLMEDTCMFGADVFVSKERRSGRGECLSMIK--DATSSKHVWKIENFSKLDKES 190

Query:   120 YESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQV 179
             Y+S  F AG++KWKI+ YP G   G G+H+S+YL L D  TI+  +KI+V FT+RI DQ+
Sbjct:   191 YDSNAFFAGDRKWKIEFYPTGTKQGTGTHLSIYLTLVDPETISDGTKIFVEFTIRIFDQL 250

Query:   180 LSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEV 229
               +H   K + W S SS + GW  +V + YF +  +G L+ DVC+VEA+V
Sbjct:   251 QGRHIAGKVTKWFSRSSSEHGWVKYVSMVYFTQPNSGLLLKDVCLVEADV 300


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2092344 AT3G20370 "AT3G20370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055998 AT2G04170 "AT2G04170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098318 AT3G28220 "AT3G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179744 AT5G26260 "AT5G26260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179699 AT5G26280 "AT5G26280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092329 AT3G20360 "AT3G20360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016590 ZW9 "AT1G58270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026745 AT1G69660 "AT1G69660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056008 AT2G04190 "AT2G04190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
cd00121126 cd00121, MATH, MATH (meprin and TRAF-C homology) d 5e-29
smart0006195 smart00061, MATH, meprin and TRAF homology 3e-09
pfam00917116 pfam00917, MATH, MATH domain 1e-08
cd03775134 cd03775, MATH_Ubp21p, Ubiquitin-specific protease 1e-08
cd00121126 cd00121, MATH, MATH (meprin and TRAF-C homology) d 4e-08
cd03773132 cd03773, MATH_TRIM37, Tripartite motif containing 3e-07
COG5077 1089 COG5077, COG5077, Ubiquitin carboxyl-terminal hydr 2e-05
pfam00917116 pfam00917, MATH, MATH domain 4e-04
cd03772137 cd03772, MATH_HAUSP, Herpesvirus-associated ubiqui 0.001
cd03774139 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP 0.002
>gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
 Score =  105 bits (264), Expect = 5e-29
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 104 KHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGRGSHISVYLALADLSTITR 163
           KH WKI NFS+LE +   S  F  G  KW+I++YP G G   G ++S+YL L    +   
Sbjct: 2   KHTWKIVNFSELEGESIYSPPFEVGGYKWRIRIYPNGDGE-SGDYLSLYLELDKGESDLE 60

Query: 164 DSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSSE-DWGWSTFVELSYFNKAENGFLMNDV 222
              +   FTL++ +Q   K   K  +    +     WG+  F+         + +L++D 
Sbjct: 61  KWSVRAEFTLKLVNQNGGKSLSKSFTHVFFSEKGSGWGFPKFISWDDLED--SYYLVDDS 118

Query: 223 CIVEAEV 229
             +E EV
Sbjct: 119 LTIEVEV 125


Meprins comprise a class of extracellular metalloproteases which are anchored to the membrane and are capable of cleaving growth factors, extracellular matrix proteins, and biologically active peptides. TRAF molecules serve as adapter proteins that link cell surface receptors of the Tumor Necrosis Factor and 1nterleukin-1/Toll-like families to downstream kinase cascades, which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems. Other members include the ubiquitin ligases, TRIM37 and SPOP, and the ubiquitin-specific proteases, HAUSP and Ubp21p. A large number of uncharacterized members mostly from lineage-specific expansions in C. elegans and rice contain MATH and BTB domains, similar to SPOP. The MATH domain has been shown to bind peptide/protein substrates in TRAFs and HAUSP. It is possible that the MATH domain in other members of this superfamily also interacts with various protein substrates. The TRAF domain may also be involved in the trimerization of TRAFs. Based on homology, it is postulated that the MATH domain in meprins may be involved in its tetramer assembly and that the MATH domain, in general, may take part in diverse modular arrangements defined by adjacent multimerization domains. Length = 126

>gnl|CDD|214496 smart00061, MATH, meprin and TRAF homology Back     alignment and domain information
>gnl|CDD|216189 pfam00917, MATH, MATH domain Back     alignment and domain information
>gnl|CDD|239744 cd03775, MATH_Ubp21p, Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast Back     alignment and domain information
>gnl|CDD|238068 cd00121, MATH, MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
>gnl|CDD|239742 cd03773, MATH_TRIM37, Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins Back     alignment and domain information
>gnl|CDD|227409 COG5077, COG5077, Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216189 pfam00917, MATH, MATH domain Back     alignment and domain information
>gnl|CDD|239741 cd03772, MATH_HAUSP, Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway Back     alignment and domain information
>gnl|CDD|239743 cd03774, MATH_SPOP, Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
cd03772137 MATH_HAUSP Herpesvirus-associated ubiquitin-specif 99.97
cd03775134 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p 99.96
cd03774139 MATH_SPOP Speckle-type POZ protein (SPOP) family, 99.95
cd03773132 MATH_TRIM37 Tripartite motif containing protein 37 99.94
cd00270149 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- 99.93
cd03780148 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A 99.92
cd00121126 MATH MATH (meprin and TRAF-C homology) domain; an 99.92
cd03779147 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A 99.91
cd03776147 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A 99.91
cd03781154 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A 99.91
cd03778164 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A 99.91
cd03777186 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A 99.91
cd03771167 MATH_Meprin Meprin family, MATH domain; Meprins ar 99.91
PF00917119 MATH: MATH domain; InterPro: IPR002083 Although ap 99.89
smart0006195 MATH meprin and TRAF homology. 99.78
cd03783167 MATH_Meprin_Alpha Meprin family, Alpha subunit, MA 99.75
cd03782167 MATH_Meprin_Beta Meprin family, Beta subunit, MATH 99.73
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 99.57
cd03772137 MATH_HAUSP Herpesvirus-associated ubiquitin-specif 99.5
cd03775134 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p 99.47
cd03774139 MATH_SPOP Speckle-type POZ protein (SPOP) family, 99.16
PF00917119 MATH: MATH domain; InterPro: IPR002083 Although ap 99.01
cd03773132 MATH_TRIM37 Tripartite motif containing protein 37 98.84
cd00270149 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- 98.81
cd00121126 MATH MATH (meprin and TRAF-C homology) domain; an 98.8
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 98.8
KOG1987 297 consensus Speckle-type POZ protein SPOP and relate 98.77
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 98.68
cd03779147 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A 98.6
cd03776147 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A 98.55
cd03780148 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A 98.51
KOG1863 1093 consensus Ubiquitin carboxyl-terminal hydrolase [P 98.45
cd03781154 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A 98.36
cd03778164 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A 98.33
cd03777186 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A 98.13
cd03771167 MATH_Meprin Meprin family, MATH domain; Meprins ar 97.91
smart0006195 MATH meprin and TRAF homology. 97.69
KOG1863 1093 consensus Ubiquitin carboxyl-terminal hydrolase [P 97.05
cd03783167 MATH_Meprin_Alpha Meprin family, Alpha subunit, MA 96.82
KOG0297391 consensus TNF receptor-associated factor [Signal t 96.51
cd03782167 MATH_Meprin_Beta Meprin family, Beta subunit, MATH 96.28
>cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway Back     alignment and domain information
Probab=99.97  E-value=3.5e-29  Score=190.50  Aligned_cols=129  Identities=22%  Similarity=0.309  Sum_probs=109.9

Q ss_pred             CCeEEEEEcccccccCceeecccEEeCCeEEEEEEecCCCCC--CCCceEEEEEEecCCCCCCCCCeEEEEEEEEEEeCC
Q 026621          102 NYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGV--GRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQV  179 (236)
Q Consensus       102 ~~~~~w~I~nfs~l~~~~~~S~~f~~gg~~W~l~~yp~G~~~--~~~~~lsiyL~~~~~~~~~~~w~~~~~f~l~l~n~~  179 (236)
                      .++++|+|+|||.+ ++.++|++|.+||++|+|++||+|...  +..++||+||.|.+.. ....|++.|+|+|+|+||.
T Consensus         2 ~~~~~~~I~~~S~l-~e~~~S~~f~vgG~~W~i~~~P~g~~~~~~~~~~lsvyL~~~~~~-~~~~w~i~a~~~~~l~~~~   79 (137)
T cd03772           2 EATFSFTVERFSRL-SESVLSPPCFVRNLPWKIMVMPRNYPDRNPHQKSVGFFLQCNAES-DSTSWSCHAQAVLRIINYK   79 (137)
T ss_pred             CcEEEEEECCcccC-CCcEECCCEEECCcceEEEEEeCCCCCCCCCCCeEEEEEeeCCcC-CCCCCeEEEEEEEEEEcCC
Confidence            46899999999999 678999999999999999999999654  2358999999997643 3348999999999999998


Q ss_pred             CC-cceeeeceeeecCCCCCCchhccccccccccCCCCceECCEEEEEEEEEEE
Q 026621          180 LS-KHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRI  232 (236)
Q Consensus       180 ~~-~~~~~~~~~~F~~~~~~~G~~~Fi~~~~L~~~~~gyl~~D~l~ie~~v~v~  232 (236)
                      ++ .+......+.|+.....|||++||+|++|+++++|||+||+|+|||+|+|=
T Consensus        80 ~~~~~~~~~~~~~f~~~~~~~G~~~fi~~~~L~~~~sgyl~~D~l~Ie~~V~~~  133 (137)
T cd03772          80 DDEPSFSRRISHLFFSKENDWGFSNFMTWSEVTDPEKGFIEDDTITLEVYVQAD  133 (137)
T ss_pred             CCcccEEEeeeeEEcCCCCCccchheeEHHHhcCCCCCcEECCEEEEEEEEEee
Confidence            53 344445557897666799999999999998777899999999999999874



It contains an N-terminal TRAF-like domain and a C-terminal catalytic protease (C19 family) domain. The tumor suppressor p53 protein is a transcription factor that responds to many cellular stress signals and is regulated primarily through ubiquitylation and subsequent degradation. MDM2 is a RING-finger E3 ubiquitin ligase that promotes p53 ubiquitinylation. p53 and MDM2 bind to the same site in the N-terminal TRAF-like domain of HAUSP in a mutually exclusive manner. HAUSP also interacts with the Epstein-Barr nuclear antigen 1 (EBNA1) protein of the Epstein-Barr virus (EBV), which efficiently immortalizes infected cells predisposing the host to a variety of cancers. EBNA1

>cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast Back     alignment and domain information
>cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP Back     alignment and domain information
>cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins Back     alignment and domain information
>cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems Back     alignment and domain information
>cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
>cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 Back     alignment and domain information
>cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 Back     alignment and domain information
>cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces Back     alignment and domain information
>PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] Back     alignment and domain information
>smart00061 MATH meprin and TRAF homology Back     alignment and domain information
>cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway Back     alignment and domain information
>cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast Back     alignment and domain information
>cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP Back     alignment and domain information
>PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] Back     alignment and domain information
>cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins Back     alignment and domain information
>cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems Back     alignment and domain information
>cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 Back     alignment and domain information
>cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 Back     alignment and domain information
>cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses Back     alignment and domain information
>cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces Back     alignment and domain information
>smart00061 MATH meprin and TRAF homology Back     alignment and domain information
>KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 2e-30
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 2e-12
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 3e-27
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 1e-10
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 7e-19
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 4e-05
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 2e-18
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 4e-06
1d00_A168 Tumor necrosis factor receptor associated protein 3e-18
1d00_A168 Tumor necrosis factor receptor associated protein 3e-06
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 3e-18
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 9e-16
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 8e-06
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 4e-15
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 6e-06
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 5e-15
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 2e-05
>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 Back     alignment and structure
 Score =  109 bits (274), Expect = 2e-30
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 4/128 (3%)

Query: 104 KHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGVGR-GSHISVYLALADLSTIT 162
              + +E FS+L   +  S      N  WKI + P+          +  +L   +  + +
Sbjct: 20  TFQFTVERFSRLSESVL-SPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQC-NAESDS 77

Query: 163 RDSKIYVHFTLRIRDQV-LSKHNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMND 221
                +    L+I +     K   ++ S        DWG+S F+  S     E GF+ +D
Sbjct: 78  TSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDD 137

Query: 222 VCIVEAEV 229
               E  V
Sbjct: 138 KVTFEVFV 145


>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 Back     alignment and structure
>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 Back     alignment and structure
>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Length = 145 Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 Back     alignment and structure
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 Back     alignment and structure
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Length = 192 Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Length = 168 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Length = 192 Back     alignment and structure
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 Back     alignment and structure
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Length = 160 Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Length = 228 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 99.98
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 99.97
4gjh_A178 TNF receptor-associated factor 5; TRAF domain, imm 99.96
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 99.95
1d00_A168 Tumor necrosis factor receptor associated protein 99.95
4ghu_A198 TNF receptor-associated factor 3; alpha/beta, inna 99.94
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 99.94
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 99.94
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 99.93
3hqi_A 312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.93
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.93
2foj_A155 Ubiquitin carboxyl-terminal hydrolase 7; MATH doma 99.56
3ivv_A145 Speckle-type POZ protein; protein binding, nucleus 99.46
4gwm_A592 Meprin A subunit beta; mulidomain structure, hydro 99.42
2f1z_A 522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.22
4gjh_A178 TNF receptor-associated factor 5; TRAF domain, imm 99.17
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.06
1d00_A168 Tumor necrosis factor receptor associated protein 98.98
1ca9_A192 TRAF2, protein (TNF receptor associated factor 2); 98.93
1lb6_A160 TNF receptor-associated factor 6; TRAF6-CD40 compl 98.85
2gkw_A192 TNF receptor-associated factor 3; CD40, NF-KB sign 98.84
4ghu_A198 TNF receptor-associated factor 3; alpha/beta, inna 98.83
1flk_A228 TNF receptor associated factor 3; TNF signaling, T 98.78
4gwm_A592 Meprin A subunit beta; mulidomain structure, hydro 92.29
>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Back     alignment and structure
Probab=99.98  E-value=5.1e-32  Score=209.22  Aligned_cols=134  Identities=20%  Similarity=0.265  Sum_probs=115.0

Q ss_pred             CCCCeEEEEEcccccccCceeecccEEeCCeEEEEEEecCCCCC-CCCceEEEEEEecCCCCCCCCCeEEEEEEEEEEeC
Q 026621          100 ASNYKHVWKIENFSKLEAKLYESEVFVAGNQKWKIKLYPKGQGV-GRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQ  178 (236)
Q Consensus       100 ~~~~~~~w~I~nfs~l~~~~~~S~~f~~gg~~W~l~~yp~G~~~-~~~~~lsiyL~~~~~~~~~~~w~~~~~f~l~l~n~  178 (236)
                      ...++|+|+|+|||.++ +.++|++|.+||++|+|++||+|+.. +.++||||||+|... ..+.+|+++|+|+|+|+||
T Consensus        16 ~~~~~~~w~I~nfS~~~-~~~~S~~f~~gg~~W~i~~yP~G~~~~~~~~~lSlyL~~~~~-~~~~~w~v~a~~~l~l~~~   93 (155)
T 2foj_A           16 RSEATFQFTVERFSRLS-ESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAE-SDSTSWSCHAQAVLKIINY   93 (155)
T ss_dssp             CSEEEEEEEESSGGGCC-SCEECCCEEETTEEEEEEEEEEC------CBEEEEEEEESTT-CCCSSCEEEEEEEEEECCS
T ss_pred             CCCcEEEEEECChhhcC-CceEcCCEEECCccEEEEEEECCCCCCCCCCEEEEEEEeCCC-CCCCCCEEEEEEEEEEEcC
Confidence            45688999999999996 77999999999999999999999765 346899999999654 4466799999999999999


Q ss_pred             CCCc-ceeeeceeeecCCCCCCchhccccccccccCCCCceECCEEEEEEEEEEEEec
Q 026621          179 VLSK-HNEKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKA  235 (236)
Q Consensus       179 ~~~~-~~~~~~~~~F~~~~~~~G~~~Fi~~~~L~~~~~gyl~~D~l~ie~~v~v~~~t  235 (236)
                      .++. +..+...++|.....+|||.+||++++|+++++|||+||+|+|+|+|+|.++|
T Consensus        94 ~~~~~~~~~~~~~~F~~~~~~wG~~~Fi~~~~L~~~~~~yl~dD~l~Ie~~V~V~~~t  151 (155)
T 2foj_A           94 RDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPH  151 (155)
T ss_dssp             SCGGGCEEEEEEEEEETTBCEEEEEEEEEHHHHTCTTTSSCBTTBEEEEEEEEECCCB
T ss_pred             CCCcceEEeccEEEeCCCCCCEeECCeEEHHHhcCcCCCceECCEEEEEEEEEEeCcc
Confidence            8865 55566778898767889999999999999888999999999999999998876



>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Back     alignment and structure
>4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} Back     alignment and structure
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Back     alignment and structure
>4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Back     alignment and structure
>3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A Back     alignment and structure
>1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A Back     alignment and structure
>1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A Back     alignment and structure
>2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A Back     alignment and structure
>1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1czya1152 b.8.1.1 (A:350-501) TNF receptor associated factor 3e-20
d1czya1152 b.8.1.1 (A:350-501) TNF receptor associated factor 1e-05
d2cr2a1146 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H 3e-20
d2cr2a1146 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H 1e-08
d1l0aa1155 b.8.1.1 (A:350-504) TNF receptor associated factor 2e-18
d1l0aa1155 b.8.1.1 (A:350-504) TNF receptor associated factor 5e-06
d1lb6a_155 b.8.1.1 (A:) TNF receptor associated factor 6 (TRA 5e-17
d1lb6a_155 b.8.1.1 (A:) TNF receptor associated factor 6 (TRA 1e-05
>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: MATH domain
domain: TNF receptor associated factor 2 (TRAF2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.1 bits (202), Expect = 3e-20
 Identities = 30/147 (20%), Positives = 56/147 (38%), Gaps = 20/147 (13%)

Query: 102 NYKHVWKIENFSKL-------EAKLYESEVFVAGNQ--KWKIKLYPKGQGVGRGSHISVY 152
           +   +WKI +F +              S  F       K  +++Y  G G GRG+H+S++
Sbjct: 2   DGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLF 61

Query: 153 LALAD-LSTITRDSKIYVHFTLRIRDQVLSKHNEKKASTWLSTSS---------EDWGWS 202
             +    +            TL + DQ   +H        +++SS            G  
Sbjct: 62  FVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCP 121

Query: 203 TFVELSYFNKAENGFLMNDVCIVEAEV 229
            F  +S   +A+N ++ +D   ++A V
Sbjct: 122 LFCPVSKM-EAKNSYVRDDAIFIKAIV 147


>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d2cr2a1146 Speckle-type poz protein SPOP {Human (Homo sapiens 99.95
d1czya1152 TNF receptor associated factor 2 (TRAF2) {Human (H 99.95
d1l0aa1155 TNF receptor associated factor 3 (TRAF3) {Human (H 99.94
d1lb6a_155 TNF receptor associated factor 6 (TRAF6) {Human (H 99.93
d2cr2a1146 Speckle-type poz protein SPOP {Human (Homo sapiens 99.28
d1czya1152 TNF receptor associated factor 2 (TRAF2) {Human (H 98.92
d1l0aa1155 TNF receptor associated factor 3 (TRAF3) {Human (H 98.87
d1lb6a_155 TNF receptor associated factor 6 (TRAF6) {Human (H 98.86
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: MATH domain
domain: Speckle-type poz protein SPOP
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=7.7e-29  Score=187.61  Aligned_cols=130  Identities=23%  Similarity=0.475  Sum_probs=109.9

Q ss_pred             CCeEEEEEccccccc---CceeecccEEeCCe---EEEEEEecCCCCCCCCceEEEEEEecCCCCCCCCCeEEEEEEEEE
Q 026621          102 NYKHVWKIENFSKLE---AKLYESEVFVAGNQ---KWKIKLYPKGQGVGRGSHISVYLALADLSTITRDSKIYVHFTLRI  175 (236)
Q Consensus       102 ~~~~~w~I~nfs~l~---~~~~~S~~f~~gg~---~W~l~~yp~G~~~~~~~~lsiyL~~~~~~~~~~~w~~~~~f~l~l  175 (236)
                      ..+|+|+|+|||.++   ++.++||.|.+||+   +|+|.+||+|.....++||||||.+.+.    ..|++.++|+|.|
T Consensus         4 ~~~~~W~I~nfs~~~~~~~~~~~Sp~F~~~~~~~~~W~l~lyp~G~~~~~~~~lSv~L~~~~~----~~~~v~~~~~~~l   79 (146)
T d2cr2a1           4 KFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSC----PKSEVRAKFKFSI   79 (146)
T ss_dssp             EEEEEEEEETGGGCCCCSSCCEECCCBCSSSCCSCCBEEEECTTCSSSSSSSBCCEEEECCCC----SSSEEEEECEEEE
T ss_pred             EEEEEEEECCchHHhhcCCCEEECCCEEeCCcCCeEEEEEEEECCCCCCCCCEEEEEEEeccC----CCceEEEEEEEEE
Confidence            357999999999886   46799999998875   8999999999987777899999999875    3699999999999


Q ss_pred             EeCCCCcce-eeeceeeecCCCCCCchhccccccccccCCCCceECCEEEEEEEEEEEEec
Q 026621          176 RDQVLSKHN-EKKASTWLSTSSEDWGWSTFVELSYFNKAENGFLMNDVCIVEAEVLRISKA  235 (236)
Q Consensus       176 ~n~~~~~~~-~~~~~~~F~~~~~~~G~~~Fi~~~~L~~~~~gyl~~D~l~ie~~v~v~~~t  235 (236)
                      +||.++... .....+.+...+.+|||++||++++|+++.+|||+||+|+|+|+|+|++.+
T Consensus        80 ~n~~~~~~~~~~~~~~~~~~~~~~~G~~~fi~~~~l~~~~~g~l~~d~l~I~~~I~v~~e~  140 (146)
T d2cr2a1          80 LNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDS  140 (146)
T ss_dssp             ECTTSCEEEEEECSCCEEEETTCEEEESCCSBHHHHSCTTTTSCTTSEEEEEEEEEEECCS
T ss_pred             EcCCCCcccceEecceEeCCCCCeeeccEEEEHHHhcCcccCceeCCEEEEEEEEEEEeCC
Confidence            999876532 222233344456889999999999999998999999999999999999765



>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure