Citrus Sinensis ID: 026637


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDICLICHL
cccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHcHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHcc
cccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHcc
mgrpdlcfdiihqvlpynqqedFIFGILAFSLLELGQMSDAEEAAKKGlkinkhdcwsqhalCHVLQHDCCFKEAVQFMEEcsstwsscssfmythnWWHVALCYLEGHSPMRKVLEIYDNHIWkelekpdavhpeVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGvqvssdiclichl
MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKqelmqtgvqvssdiclichl
MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEEcsstwsscssFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDICLICHL
*****LCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSD***AAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVS**************************GVQVSSDICLIC**
******CFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGL**************MQTGVQVSSDICLICHL
MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDICLICHL
*GRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDICLICHL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDICLICHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
Q5R3I4469 Tetratricopeptide repeat yes no 0.536 0.268 0.330 3e-12
Q5RFF7469 Tetratricopeptide repeat yes no 0.536 0.268 0.323 2e-11
A3KMP2465 Tetratricopeptide repeat yes no 0.536 0.270 0.303 2e-10
A2VD82469 Tetratricopeptide repeat N/A no 0.514 0.257 0.314 2e-10
Q6DIV2469 Tetratricopeptide repeat yes no 0.859 0.430 0.270 2e-10
A3KPN8466 Tetratricopeptide repeat yes no 0.927 0.467 0.243 6e-09
>sp|Q5R3I4|TTC38_HUMAN Tetratricopeptide repeat protein 38 OS=Homo sapiens GN=TTC38 PE=1 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 4/130 (3%)

Query: 23  FIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEEC 82
           ++ GI +F L+E      AE+ AK+ L IN  D WS H + H+ +     K+ ++FM+  
Sbjct: 181 YVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHS 240

Query: 83  SSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNAL 142
            + W   S  +  HN+WH AL YL         L IYD HI   L+  DA+   V  ++ 
Sbjct: 241 ETFWKD-SDMLACHNYWHWAL-YLIEKGEYEAALTIYDTHILPSLQANDAMLDVV--DSC 296

Query: 143 GLLLRVYVRG 152
            +L R+ + G
Sbjct: 297 SMLYRLQMEG 306





Homo sapiens (taxid: 9606)
>sp|Q5RFF7|TTC38_PONAB Tetratricopeptide repeat protein 38 OS=Pongo abelii GN=TTC38 PE=2 SV=1 Back     alignment and function description
>sp|A3KMP2|TTC38_MOUSE Tetratricopeptide repeat protein 38 OS=Mus musculus GN=Ttc38 PE=2 SV=2 Back     alignment and function description
>sp|A2VD82|TTC38_XENLA Tetratricopeptide repeat protein 38 OS=Xenopus laevis GN=ttc38 PE=2 SV=1 Back     alignment and function description
>sp|Q6DIV2|TTC38_XENTR Tetratricopeptide repeat protein 38 OS=Xenopus tropicalis GN=ttc38 PE=2 SV=1 Back     alignment and function description
>sp|A3KPN8|TTC38_DANRE Tetratricopeptide repeat protein 38 OS=Danio rerio GN=ttc38 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
224100425 472 predicted protein [Populus trichocarpa] 0.961 0.478 0.743 1e-92
357486429 468 Tetratricopeptide repeat protein [Medica 0.948 0.476 0.681 2e-89
357486431 392 Tetratricopeptide repeat protein [Medica 0.948 0.568 0.681 4e-89
225424865 468 PREDICTED: tetratricopeptide repeat prot 0.948 0.476 0.708 3e-85
356500732 468 PREDICTED: tetratricopeptide repeat prot 0.957 0.480 0.650 4e-84
18396209 468 StaR-like protein domain-containing prot 0.974 0.489 0.650 3e-83
13605637 468 At1g27150/T7N9_21 [Arabidopsis thaliana] 0.974 0.489 0.650 6e-83
21537367 468 unknown [Arabidopsis thaliana] 0.974 0.489 0.646 9e-82
449434849 469 PREDICTED: tetratricopeptide repeat prot 0.948 0.475 0.645 2e-81
356497832 469 PREDICTED: tetratricopeptide repeat prot 0.961 0.481 0.654 1e-80
>gi|224100425|ref|XP_002311871.1| predicted protein [Populus trichocarpa] gi|222851691|gb|EEE89238.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 197/226 (87%)

Query: 1   MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQH 60
           MGRPDL  D++ QVLP NQ+ED+I+G+LAFSLLELG+M+DAEEAA+KG +INK D W+QH
Sbjct: 138 MGRPDLSLDLVQQVLPRNQEEDYIYGMLAFSLLELGRMADAEEAARKGYEINKQDYWAQH 197

Query: 61  ALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYD 120
           A+CHVLQ+ C FK+AV FMEECSS+WSSC SFM THNWWHVALCYLEGH+P+RKVLE+YD
Sbjct: 198 AMCHVLQYQCRFKDAVDFMEECSSSWSSCLSFMLTHNWWHVALCYLEGHAPVRKVLEVYD 257

Query: 121 NHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHL 180
            HIWKELEK DAV PEVYLNALGLLLRVY+RGELD+F +RL  LA C+ DQANWYLE HL
Sbjct: 258 QHIWKELEKADAVPPEVYLNALGLLLRVYLRGELDIFDDRLNTLASCITDQANWYLEWHL 317

Query: 181 DLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVS 226
           D+LILWALA TGE SKAEDLL+GLKSR  KM KKKQ+ MQ  ++++
Sbjct: 318 DVLILWALAKTGEPSKAEDLLEGLKSRIQKMSKKKQQRMQKVIRLA 363




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357486429|ref|XP_003613502.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355514837|gb|AES96460.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357486431|ref|XP_003613503.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355514838|gb|AES96461.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225424865|ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein 38 [Vitis vinifera] gi|296086448|emb|CBI32037.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500732|ref|XP_003519185.1| PREDICTED: tetratricopeptide repeat protein 38-like [Glycine max] Back     alignment and taxonomy information
>gi|18396209|ref|NP_564271.1| StaR-like protein domain-containing protein [Arabidopsis thaliana] gi|8778861|gb|AAF79860.1|AC000348_13 T7N9.21 [Arabidopsis thaliana] gi|332192666|gb|AEE30787.1| StaR-like protein domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13605637|gb|AAK32812.1|AF361799_1 At1g27150/T7N9_21 [Arabidopsis thaliana] gi|27363406|gb|AAO11622.1| At1g27150/T7N9_21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21537367|gb|AAM61708.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449434849|ref|XP_004135208.1| PREDICTED: tetratricopeptide repeat protein 38-like [Cucumis sativus] gi|449478487|ref|XP_004155331.1| PREDICTED: tetratricopeptide repeat protein 38-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497832|ref|XP_003517761.1| PREDICTED: tetratricopeptide repeat protein 38-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
TAIR|locus:2205809468 AT1G27150 [Arabidopsis thalian 0.974 0.489 0.624 3.5e-75
TAIR|locus:2205764483 AT1G27110 "AT1G27110" [Arabido 0.974 0.474 0.504 2.2e-59
UNIPROTKB|Q0C3E4438 HNE_1027 "Putative uncharacter 0.791 0.424 0.316 4e-16
WB|WBGene00013216467 Y54G11A.7 [Caenorhabditis eleg 0.812 0.408 0.285 1.2e-13
MGI|MGI:2146198465 Ttc38 "tetratricopeptide repea 0.774 0.391 0.251 1e-09
UNIPROTKB|Q5LPG1456 SPO2887 "Uncharacterized prote 0.804 0.414 0.292 5.7e-09
TIGR_CMR|SPO_2887456 SPO_2887 "conserved hypothetic 0.804 0.414 0.292 5.7e-09
ZFIN|ZDB-GENE-050522-318466 ttc38 "tetratricopeptide repea 0.880 0.444 0.241 1.5e-08
TAIR|locus:2205809 AT1G27150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 758 (271.9 bits), Expect = 3.5e-75, P = 3.5e-75
 Identities = 143/229 (62%), Positives = 173/229 (75%)

Query:     1 MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQH 60
             MG+PD    ++ QVLP NQ+E +I G+LAF LLELG+M +A  A++KG +INK D W+ H
Sbjct:   137 MGQPDPFLGLVQQVLPANQEESYIHGLLAFPLLELGRMEEAAAASRKGYEINKEDAWAHH 196

Query:    61 ALCHVLQHDCCFKEAVQFMEEXXXXXXXXXXFMYTHNWWHVALCYLEGHSPMRKVLEIYD 120
              LCHVLQH+C FKEAV+FME           FMYTHNWWHVALCYLEG SPM KV EIYD
Sbjct:   197 CLCHVLQHECRFKEAVEFMEALAGTWPSCSSFMYTHNWWHVALCYLEGGSPMSKVEEIYD 256

Query:   121 NHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHL 180
             +HIWKELEK DAV PEVYLNALGLL+R+ VR  LD F +RLK LA  + +QANWYLE HL
Sbjct:   257 HHIWKELEKDDAVPPEVYLNALGLLIRLDVRDALDGFEDRLKNLAVRLTNQANWYLEWHL 316

Query:   181 DLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDI 229
             D+LI+WALA  GE S+A +LL+GLK R SK  KKKQ++MQ G+Q+   +
Sbjct:   317 DILIVWALAKVGETSRAHELLEGLKFRLSKKNKKKQQVMQKGIQLGEAV 365




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2205764 AT1G27110 "AT1G27110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C3E4 HNE_1027 "Putative uncharacterized protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
WB|WBGene00013216 Y54G11A.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:2146198 Ttc38 "tetratricopeptide repeat domain 38" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LPG1 SPO2887 "Uncharacterized protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2887 SPO_2887 "conserved hypothetical protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-318 ttc38 "tetratricopeptide repeat domain 38" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
cd05804355 cd05804, StaR_like, StaR_like; a well-conserved pr 3e-70
>gnl|CDD|100115 cd05804, StaR_like, StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
 Score =  218 bits (558), Expect = 3e-70
 Identities = 82/225 (36%), Positives = 107/225 (47%), Gaps = 6/225 (2%)

Query: 1   MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQH 60
            G  D    ++    P N    ++ G+LAF L E GQ   AEEAA++ L++N  D W+ H
Sbjct: 93  SGMRDHVARVLPLWAPENPDYWYLLGMLAFGLEEAGQYDRAEEAARRALELNPDDAWAVH 152

Query: 61  ALCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYD 120
           A+ HVL+    FKE + FME    TW  CSS +  HNWWH+AL YLE        L IYD
Sbjct: 153 AVAHVLEMQGRFKEGIAFMESWRDTW-DCSSMLRGHNWWHLALFYLERGDY-EAALAIYD 210

Query: 121 NHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDVFGNRLKVLADCVADQANWYLECHL 180
            HI    E   A      L+A  LL R+ + G     G+R + LAD  A     +     
Sbjct: 211 THIAPSAESDPA---LDLLDAASLLWRLELAGH-VDVGDRWEDLADYAAWHFPDHGLAFN 266

Query: 181 DLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQV 225
           DL    ALA  G+    + LL  LK R S     KQ     G+ +
Sbjct: 267 DLHAALALAGAGDKDALDKLLAALKGRASSADDNKQPARDVGLPL 311


A family member from Streptomyces toyocaensis, StaR is part of a gene cluster involved in the biosynthesis of glycopeptide antibiotics (GPAs), specifically A47934. It has been speculated that StaR could be a flavoprotein hydroxylating a tyrosine sidechain. Some family members have been annotated as proteins containing tetratricopeptide (TPR) repeats, which may at least indicate mostly alpha-helical secondary structure. Length = 355

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
KOG2610 491 consensus Uncharacterized conserved protein [Funct 100.0
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.96
PRK12370553 invasion protein regulator; Provisional 99.45
PRK15359144 type III secretion system chaperone protein SscB; 99.44
PRK12370553 invasion protein regulator; Provisional 99.39
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.39
PRK10370198 formate-dependent nitrite reductase complex subuni 99.34
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.29
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.29
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.26
PRK15359144 type III secretion system chaperone protein SscB; 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.24
PRK11189296 lipoprotein NlpI; Provisional 99.23
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.23
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.21
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.13
PRK11189296 lipoprotein NlpI; Provisional 99.12
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.12
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.11
PRK11906458 transcriptional regulator; Provisional 99.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.05
PRK11906458 transcriptional regulator; Provisional 99.02
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.02
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.02
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.99
PRK11788389 tetratricopeptide repeat protein; Provisional 98.97
KOG1126638 consensus DNA-binding cell division cycle control 98.97
PRK11788389 tetratricopeptide repeat protein; Provisional 98.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.94
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.91
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.89
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.89
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.88
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.85
PRK10370198 formate-dependent nitrite reductase complex subuni 98.84
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.81
PLN02789320 farnesyltranstransferase 98.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.8
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.79
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.79
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.77
KOG0547606 consensus Translocase of outer mitochondrial membr 98.77
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.69
KOG0553304 consensus TPR repeat-containing protein [General f 98.68
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.67
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.65
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.65
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.54
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.53
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.52
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.51
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.49
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.48
KOG1126638 consensus DNA-binding cell division cycle control 98.44
PF12688120 TPR_5: Tetratrico peptide repeat 98.41
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.37
PRK10803263 tol-pal system protein YbgF; Provisional 98.33
PRK14574 822 hmsH outer membrane protein; Provisional 98.32
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.27
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.27
PRK14574 822 hmsH outer membrane protein; Provisional 98.24
PF1337173 TPR_9: Tetratricopeptide repeat 98.24
PLN02789320 farnesyltranstransferase 98.23
KOG0553304 consensus TPR repeat-containing protein [General f 98.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.21
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.2
PF1337173 TPR_9: Tetratricopeptide repeat 98.19
PF1342844 TPR_14: Tetratricopeptide repeat 98.18
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.18
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.15
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.14
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.13
KOG1125579 consensus TPR repeat-containing protein [General f 98.05
KOG1129478 consensus TPR repeat-containing protein [General f 98.04
PRK04841 903 transcriptional regulator MalT; Provisional 98.03
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.03
PF12688120 TPR_5: Tetratrico peptide repeat 98.01
KOG0547606 consensus Translocase of outer mitochondrial membr 98.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.0
PRK10803263 tol-pal system protein YbgF; Provisional 98.0
PRK15331165 chaperone protein SicA; Provisional 97.99
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.97
PF1343134 TPR_17: Tetratricopeptide repeat 97.94
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.94
PRK04841 903 transcriptional regulator MalT; Provisional 97.88
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.86
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.83
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 97.81
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.74
KOG4555175 consensus TPR repeat-containing protein [Function 97.72
KOG1125579 consensus TPR repeat-containing protein [General f 97.71
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.67
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.67
KOG2076 895 consensus RNA polymerase III transcription factor 97.66
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.59
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.59
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.59
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.57
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.55
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.55
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.54
PLN03218 1060 maturation of RBCL 1; Provisional 97.5
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.45
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.44
PLN03218 1060 maturation of RBCL 1; Provisional 97.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.4
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.39
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.33
PLN03077 857 Protein ECB2; Provisional 97.32
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.31
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.3
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.27
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.25
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.23
KOG2076 895 consensus RNA polymerase III transcription factor 97.21
PLN03077 857 Protein ECB2; Provisional 97.19
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.18
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.11
KOG1128777 consensus Uncharacterized conserved protein, conta 97.09
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.06
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.05
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 96.98
PF13512142 TPR_18: Tetratricopeptide repeat 96.93
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 96.92
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.86
PF13512142 TPR_18: Tetratricopeptide repeat 96.84
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.83
PRK15331165 chaperone protein SicA; Provisional 96.78
PF1343134 TPR_17: Tetratricopeptide repeat 96.75
KOG4234271 consensus TPR repeat-containing protein [General f 96.68
KOG2003 840 consensus TPR repeat-containing protein [General f 96.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.65
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.65
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.62
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.61
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.57
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.5
COG4700251 Uncharacterized protein conserved in bacteria cont 96.47
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.47
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.45
COG4700251 Uncharacterized protein conserved in bacteria cont 96.44
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.42
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.36
KOG1129478 consensus TPR repeat-containing protein [General f 96.35
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.29
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.19
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.18
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.15
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.13
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.1
KOG2003840 consensus TPR repeat-containing protein [General f 96.09
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.89
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.85
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.82
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.68
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.64
KOG3060289 consensus Uncharacterized conserved protein [Funct 95.63
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.61
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.6
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.57
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.52
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.48
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.41
KOG4648 536 consensus Uncharacterized conserved protein, conta 95.36
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.36
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.34
KOG4555175 consensus TPR repeat-containing protein [Function 95.21
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.1
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.02
PRK10941269 hypothetical protein; Provisional 94.93
PRK10941269 hypothetical protein; Provisional 94.66
PF1342844 TPR_14: Tetratricopeptide repeat 94.64
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.64
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.55
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.53
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.12
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.09
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.05
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.98
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 93.96
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.82
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.75
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.68
COG2912269 Uncharacterized conserved protein [Function unknow 93.66
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.45
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.3
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.23
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.15
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.74
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.71
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.7
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 92.69
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 92.55
COG3898 531 Uncharacterized membrane-bound protein [Function u 92.54
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.43
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.12
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 91.91
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.89
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.81
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.48
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.31
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.23
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.19
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 91.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.96
KOG4234271 consensus TPR repeat-containing protein [General f 90.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.79
KOG1915 677 consensus Cell cycle control protein (crooked neck 90.75
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 90.66
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.44
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.41
KOG3785 557 consensus Uncharacterized conserved protein [Funct 90.2
KOG1128777 consensus Uncharacterized conserved protein, conta 89.88
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 89.75
PF03704146 BTAD: Bacterial transcriptional activator domain; 89.55
KOG3785 557 consensus Uncharacterized conserved protein [Funct 89.37
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.34
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.26
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 89.01
KOG1915677 consensus Cell cycle control protein (crooked neck 88.54
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.0
COG2912269 Uncharacterized conserved protein [Function unknow 87.57
KOG0530318 consensus Protein farnesyltransferase, alpha subun 87.14
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 87.08
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.08
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 85.84
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 85.64
KOG4340 459 consensus Uncharacterized conserved protein [Funct 85.56
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 83.75
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.39
KOG4507 886 consensus Uncharacterized conserved protein, conta 83.29
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 83.01
PF13281374 DUF4071: Domain of unknown function (DUF4071) 82.81
KOG2300629 consensus Uncharacterized conserved protein [Funct 82.8
PF1286294 Apc5: Anaphase-promoting complex subunit 5 82.7
KOG4507886 consensus Uncharacterized conserved protein, conta 82.34
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 81.99
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 81.85
KOG1310 758 consensus WD40 repeat protein [General function pr 81.44
COG4941415 Predicted RNA polymerase sigma factor containing a 81.02
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 80.09
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=4.5e-41  Score=303.28  Aligned_cols=214  Identities=34%  Similarity=0.554  Sum_probs=190.1

Q ss_pred             CCChhhHHHHHHhhcCCC----CCChhHHHHHHHHHHHhCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHH
Q 026637            1 MGRPDLCFDIIHQVLPYN----QQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAV   76 (235)
Q Consensus         1 ~G~~~~al~~~~ral~~~----p~~~~~~g~~Af~L~e~g~~~~Ae~~arrAL~L~P~dawA~halahvl~~~Gr~~egi   76 (235)
                      +|+..++++.++|++|.|    |.++|++||+||+|+|+|.|++||+.++||+++||+|+||+|+++||++|.||++||.
T Consensus       150 ~G~~~~~k~ai~kIip~wn~dlp~~sYv~GmyaFgL~E~g~y~dAEk~A~ralqiN~~D~Wa~Ha~aHVlem~~r~Keg~  229 (491)
T KOG2610|consen  150 NGNQIGKKNAIEKIIPKWNADLPCYSYVHGMYAFGLEECGIYDDAEKQADRALQINRFDCWASHAKAHVLEMNGRHKEGK  229 (491)
T ss_pred             ccchhhhhhHHHHhccccCCCCcHHHHHHHHHHhhHHHhccchhHHHHHHhhccCCCcchHHHHHHHHHHHhcchhhhHH
Confidence            689999999999999984    4568999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHchhhhccCCcchhHHHHHHHHHHHHhCCCCHHHHHHHHHhhchhhhcCCCCCchHhHhHHHHHHHHHHhcCcccc
Q 026637           77 QFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKELEKPDAVHPEVYLNALGLLLRVYVRGELDV  156 (235)
Q Consensus        77 ~~l~~a~~~w~~~~~~l~~H~~WHlAL~~le~G~~~deAl~~yd~~i~~~~~~~~~~~~~~~~da~sLL~Rl~l~G~~~~  156 (235)
                      +||.+.+..|.. +.++.+|||||.|+||+|.+ .|+.|++|||+.|+++++|         .|++|++|||++.|+++ 
T Consensus       230 eFM~~ted~Wr~-s~mlasHNyWH~Al~~iE~a-eye~aleIyD~ei~k~l~k---------~Da~a~~~~ld~dgv~~-  297 (491)
T KOG2610|consen  230 EFMYKTEDDWRQ-SWMLASHNYWHTALFHIEGA-EYEKALEIYDREIWKRLEK---------DDAVARDVYLDLDGVDL-  297 (491)
T ss_pred             HHHHhcccchhh-hhHHHhhhhHHHHHhhhccc-chhHHHHHHHHHHHHHhhc---------cchhhhhhhhhhhhHHh-
Confidence            999999999995 78999999999999999986 9999999999999998644         59999999999999985 


Q ss_pred             cccchH---HHHHHHHhhhcchhcchhhHHHHHHHhcCCCchHHHHHHHHHHHHhhcCchHHHHHHHHHHHHHHhh
Q 026637          157 FGNRLK---VLADCVADQANWYLECHLDLLILWALANTGEVSKAEDLLKGLKSRHSKMIKKKQELMQTGVQVSSDI  229 (235)
Q Consensus       157 ~g~rw~---~la~~~~~~~~~~~~~F~d~H~~~al~~ag~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~l~~~~  229 (235)
                      -.++|.   .|++.+..+..++..+.-|+-..|++....+...+.+|++ ++++-+.++  .|-.++++|.|.+.+
T Consensus       298 ~~d~~~kld~la~~l~d~a~~~~d~~~~itt~~~~~~~~~~~l~~~ll~-~~~~ls~~n--~q~~~t~gi~l~~~~  370 (491)
T KOG2610|consen  298 RSDLWRKLDKLADSLTDKAMWYQDWLFDITTIWALSKVEKTSLAHELLE-LKSLLSEDN--AQISKTKGIPLYDGM  370 (491)
T ss_pred             HHHHHHHHHhhhhhhcchhhhhhhhhhhhhHHhhhhhhhhhhhHHHHHH-HHHHhhhhh--hhhhhhhccchHHHh
Confidence            357777   5566666666666666666777999999999999999999 888877643  466799999998875



>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-05
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score = 42.1 bits (99), Expect = 8e-05
 Identities = 11/82 (13%), Positives = 26/82 (31%)

Query: 1   MGRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQH 60
             R      ++ Q      +   I   L  +L + GQ   A  A  +  ++   + +   
Sbjct: 70  QQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITA 129

Query: 61  ALCHVLQHDCCFKEAVQFMEEC 82
            L +  +  C ++       + 
Sbjct: 130 QLLNWRRRLCDWRALDVLSAQV 151


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.6
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.53
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.51
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.5
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.46
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.41
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.39
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.39
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.33
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.33
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.31
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.31
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.31
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.31
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.31
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.3
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.3
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.29
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.29
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.29
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.28
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.28
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.27
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.27
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.26
3u4t_A272 TPR repeat-containing protein; structural genomics 99.26
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.26
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.26
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.25
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.25
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.25
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.25
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.25
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.24
3k9i_A117 BH0479 protein; putative protein binding protein, 99.24
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.24
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.24
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.23
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.22
3u4t_A272 TPR repeat-containing protein; structural genomics 99.22
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.22
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.21
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.2
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.2
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.2
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.19
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.19
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.18
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.17
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.16
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.15
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.14
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.13
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.1
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.04
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.04
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.03
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.02
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.02
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.99
3k9i_A117 BH0479 protein; putative protein binding protein, 98.98
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.97
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.97
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.96
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.95
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.95
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.94
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.92
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.92
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.92
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.91
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.91
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.89
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.89
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.88
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.88
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.87
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.86
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.86
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.85
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.83
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.78
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.77
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.76
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.75
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.75
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.71
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.63
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.62
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.59
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.54
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.49
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.47
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.4
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.36
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.34
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.32
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.29
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.28
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.27
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.27
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.17
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.01
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.92
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.9
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.9
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.74
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.7
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.63
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.58
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.58
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.52
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.49
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.42
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.24
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.23
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.15
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.1
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.46
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.32
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 96.23
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.2
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.95
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.45
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.15
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.84
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.56
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.14
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.82
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.9
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.73
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.13
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.53
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 87.51
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 86.79
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.43
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.6
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 82.63
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
Probab=99.60  E-value=1e-14  Score=117.32  Aligned_cols=111  Identities=13%  Similarity=0.040  Sum_probs=103.2

Q ss_pred             HHHhhcCCCCCChhHHHHHHHHHHHhCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHchhhhccC
Q 026637           10 IIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEECSSTWSSC   89 (235)
Q Consensus        10 ~~~ral~~~p~~~~~~g~~Af~L~e~g~~~~Ae~~arrAL~L~P~dawA~halahvl~~~Gr~~egi~~l~~a~~~w~~~   89 (235)
                      .+.+++..+|+++.++..+|..+.+.|+|++|++.++++++++|+++.++..+|.++..+|++++|+..++++....|..
T Consensus        24 ~l~~al~l~p~~~~~~~~lg~~~~~~g~~~eA~~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~Ai~~~~~al~l~P~~  103 (151)
T 3gyz_A           24 TLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND  103 (151)
T ss_dssp             CTGGGCCSCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSSC
T ss_pred             CHHHHhCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHccHHHHHHHHHHHHhhCCCC
Confidence            45678889999999999999999999999999999999999999999999999999999999999999999999999986


Q ss_pred             CcchhHHHHHHHHHHHHhCCCCHHHHHHHHHhhchhh
Q 026637           90 SSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIWKE  126 (235)
Q Consensus        90 ~~~l~~H~~WHlAL~~le~G~~~deAl~~yd~~i~~~  126 (235)
                      +     ..+.++|.+++..| ++++|+..|++.+...
T Consensus       104 ~-----~~~~~lg~~~~~lg-~~~eA~~~~~~al~l~  134 (151)
T 3gyz_A          104 Y-----TPVFHTGQCQLRLK-APLKAKECFELVIQHS  134 (151)
T ss_dssp             C-----HHHHHHHHHHHHTT-CHHHHHHHHHHHHHHC
T ss_pred             c-----HHHHHHHHHHHHcC-CHHHHHHHHHHHHHhC
Confidence            5     34446999999998 9999999999999873



>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.8 bits (81), Expect = 0.003
 Identities = 14/123 (11%), Positives = 35/123 (28%)

Query: 2   GRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHA 61
           G  +       Q+         +  +L+    +  ++  +   +   +K N     +   
Sbjct: 13  GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSN 72

Query: 62  LCHVLQHDCCFKEAVQFMEECSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDN 121
           L +V +     +EA++                       VA   +EG          Y+ 
Sbjct: 73  LGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP 132

Query: 122 HIW 124
            ++
Sbjct: 133 DLY 135


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.34
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.29
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.28
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.27
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.23
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.22
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.21
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.19
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.1
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.09
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.96
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.95
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.75
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.73
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.72
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.72
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.71
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.69
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.59
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.58
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.51
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.51
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.5
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.49
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.44
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.37
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.26
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.12
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.72
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.9
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.65
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.36
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.34  E-value=1.3e-11  Score=103.73  Aligned_cols=117  Identities=14%  Similarity=0.125  Sum_probs=55.0

Q ss_pred             CChhhHHHHHHhhcCCCCCChhHHHHHHHHHHHhCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 026637            2 GRPDLCFDIIHQVLPYNQQEDFIFGILAFSLLELGQMSDAEEAAKKGLKINKHDCWSQHALCHVLQHDCCFKEAVQFMEE   81 (235)
Q Consensus         2 G~~~~al~~~~ral~~~p~~~~~~g~~Af~L~e~g~~~~Ae~~arrAL~L~P~dawA~halahvl~~~Gr~~egi~~l~~   81 (235)
                      |+.+++....+++....|..+..+..+|.++...|++++|+..+++|++++|+++.++..+|.++..+|++++|+..++.
T Consensus       217 ~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~  296 (388)
T d1w3ba_         217 RIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNT  296 (388)
T ss_dssp             TCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            44444444444444444444444444444444455555555555555555555554444555555555555555444444


Q ss_pred             chhhhccCCcchhHHHHHHHHHHHHhCCCCHHHHHHHHHhhch
Q 026637           82 CSSTWSSCSSFMYTHNWWHVALCYLEGHSPMRKVLEIYDNHIW  124 (235)
Q Consensus        82 a~~~w~~~~~~l~~H~~WHlAL~~le~G~~~deAl~~yd~~i~  124 (235)
                      +....|..     ...+..++.++...| ++++|++.|++.+.
T Consensus       297 ~~~~~~~~-----~~~~~~l~~~~~~~~-~~~~A~~~~~~al~  333 (388)
T d1w3ba_         297 ALRLCPTH-----ADSLNNLANIKREQG-NIEEAVRLYRKALE  333 (388)
T ss_dssp             HHHHCTTC-----HHHHHHHHHHHHTTT-CHHHHHHHHHHHTT
T ss_pred             hhccCCcc-----chhhhHHHHHHHHCC-CHHHHHHHHHHHHH
Confidence            44444332     122233444444444 44444444444443



>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure