Citrus Sinensis ID: 026711

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLRS
ccccccHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccEEEccccccccccEEEEEEcccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHcccHHccccccccEEEEEEccccccccEEEEEEcccccEEEEEEEccccHHHccccccccccHHHHHHHHHHHHHHcccccEEEEccccEEEEcccccHHHHHHHHHHHHHHHHHccEEEEEEEEEccccEcccccc
makrpswvCTLITQLSLCLALYVALNlgqpqksiyqrtngissnrkglDFYFIsvtggfrplEQQTLLLKQMEDVAKSYDARFVIntselgeddplkqnatwlfpslkvpwyttkaskekevgcfqeqirlphgealdiigvntgslqgkiptalpsasgDLLLNWLKSALEatngqwcivvgfhplvICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFifsipgkivpflrs
MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTselgeddplkqnatwlfpslkvPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSipgkivpflrs
MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLRS
*****SWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFL**
*****SW**TLITQLSLCLALYVALNLGQP******************DFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALP*ASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLR*
MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLRS
****PSWVCTLITQLSLCLALYVALNLGQPQKS************KGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLRS
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSIPGKIVPFLRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
224091690296 predicted protein [Populus trichocarpa] 0.888 0.702 0.544 3e-60
255565017299 conserved hypothetical protein [Ricinus 0.914 0.715 0.530 1e-56
297735903309 unnamed protein product [Vitis vinifera] 0.893 0.676 0.528 8e-55
225469734 377 PREDICTED: uncharacterized protein LOC10 0.893 0.554 0.528 1e-54
224142415258 predicted protein [Populus trichocarpa] 0.756 0.686 0.581 4e-54
147820982283 hypothetical protein VITISV_025335 [Viti 0.893 0.738 0.528 4e-54
449442983288 PREDICTED: uncharacterized protein LOC10 0.871 0.708 0.460 1e-44
449493689288 PREDICTED: uncharacterized protein LOC10 0.871 0.708 0.460 1e-44
125554322298 hypothetical protein OsI_21928 [Oryza sa 0.910 0.714 0.409 1e-43
55771378298 unknown protein [Oryza sativa Japonica G 0.888 0.697 0.404 3e-43
>gi|224091690|ref|XP_002309329.1| predicted protein [Populus trichocarpa] gi|222855305|gb|EEE92852.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 150/215 (69%), Gaps = 7/215 (3%)

Query: 1   MAKRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFR 60
           M K+ SW CT + Q+SL +A Y+ALNL QPQ S+Y    G    R  LD YF+SV GG+R
Sbjct: 1   MEKKRSWACTFVLQVSLFIAFYLALNLDQPQTSLYNSRKG---TRTPLDVYFLSVRGGYR 57

Query: 61  PLEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEK 120
           PL Q+ LLLKQME VA  Y ARFV+N SELGEDDPL QNA+ LFP  K+PWY+T+ SK +
Sbjct: 58  PLNQRALLLKQMEKVANIYKARFVMNISELGEDDPLTQNASRLFPPQKIPWYSTRVSKGR 117

Query: 121 EVGCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCI 180
           E GCF EQI +  G+ L ++G++TG LQ  + +     +G   LNWL   LEAT   W I
Sbjct: 118 EGGCFLEQINITCGKTLTVVGLDTGLLQDFMGSTSGFKNGQ--LNWLTETLEATTNSWII 175

Query: 181 VVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGV 215
           V G+HP+VIC+  +E++EAK+IY  LH+IFMK+GV
Sbjct: 176 VSGYHPVVICD--KERVEAKQIYGALHNIFMKYGV 208

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255565017|ref|XP_002523501.1| conserved hypothetical protein [Ricinus communis] gi|223537208|gb|EEF38840.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297735903|emb|CBI18679.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225469734|ref|XP_002270656.1| PREDICTED: uncharacterized protein LOC100257638 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142415|ref|XP_002324553.1| predicted protein [Populus trichocarpa] gi|222865987|gb|EEF03118.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147820982|emb|CAN67945.1| hypothetical protein VITISV_025335 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442983|ref|XP_004139260.1| PREDICTED: uncharacterized protein LOC101208944 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449493689|ref|XP_004159413.1| PREDICTED: uncharacterized protein LOC101230039 [Cucumis sativus] Back     alignment and taxonomy information
>gi|125554322|gb|EAY99927.1| hypothetical protein OsI_21928 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|55771378|dbj|BAD72545.1| unknown protein [Oryza sativa Japonica Group] gi|55773903|dbj|BAD72508.1| unknown protein [Oryza sativa Japonica Group] gi|215768936|dbj|BAH01165.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
TAIR|locus:505006537285 AT4G30993 "AT4G30993" [Arabido 0.876 0.719 0.446 2.6e-40
TAIR|locus:505006537 AT4G30993 "AT4G30993" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 2.6e-40, P = 2.6e-40
 Identities = 95/213 (44%), Positives = 131/213 (61%)

Query:     3 KRPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPL 62
             K+ SW CT+  QLSLCL +YV+L+ G P    +   +G   N   LD +FISV GGFRPL
Sbjct:     2 KQSSWGCTIFIQLSLCLIIYVSLHSGHP--FFFSSDDG--DNATPLDLHFISVAGGFRPL 57

Query:    63 EQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPWYTTKASKEKEV 122
               QT LL+ ME VA++Y A+FV+++SE GE+DP  QNAT L  SLK+PWYT    + K  
Sbjct:    58 NHQTRLLRLMEKVAETYKAKFVVSSSEQGEEDPFLQNATRLSSSLKLPWYT----RMKGS 113

Query:   123 GCFQEQIRLPHGEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSALEATNGQWCIVV 182
             G F+E I++P G +LD++ V+TGSL+ ++     +A     L  L   L+A +G W IVV
Sbjct:   114 GYFREHIKMPFGGSLDVVFVDTGSLKQEVLGGAVNAYMISQLKGLTRILKAVDGDWRIVV 173

Query:   183 GFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGV 215
             G  PL+     +E  E K++    H I  K+GV
Sbjct:   174 GSDPLLAYTLTKEPEEPKRVARTFHQIMTKYGV 206


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.321   0.138   0.422    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      234       234   0.00087  113 3  11 22  0.39    33
                                                     32  0.43    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  615 (65 KB)
  Total size of DFA:  193 KB (2109 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  20.26u 0.14s 20.40t   Elapsed:  00:00:01
  Total cpu time:  20.26u 0.14s 20.40t   Elapsed:  00:00:01
  Start:  Sat May 11 02:50:23 2013   End:  Sat May 11 02:50:24 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VI1185
hypothetical protein (296 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 234
PTZ00422 394 glideosome-associated protein 50; Provisional 100.0
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 100.0
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.96
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 99.92
PLN02533427 probable purple acid phosphatase 99.92
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.89
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.88
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.88
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 99.88
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.85
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.84
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.83
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.77
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 99.69
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.67
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.67
COG1409301 Icc Predicted phosphohydrolases [General function 99.66
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.63
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.61
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.6
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.59
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 99.54
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.42
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.34
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.33
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.23
PRK11340271 phosphodiesterase YaeI; Provisional 99.17
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 99.16
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.08
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.89
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 98.88
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.85
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 98.76
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 98.7
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.69
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 98.66
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.61
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 98.61
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.55
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 98.53
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.36
COG1768230 Predicted phosphohydrolase [General function predi 98.36
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 98.29
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.26
COG2129226 Predicted phosphoesterases, related to the Icc pro 98.2
PF09423453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 98.16
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.16
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.13
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 97.96
PHA02546 340 47 endonuclease subunit; Provisional 97.93
PRK10966 407 exonuclease subunit SbcD; Provisional 97.91
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 97.91
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 97.89
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 97.86
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 97.85
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 97.81
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.8
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 97.79
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 97.78
KOG3662 410 consensus Cell division control protein/predicted 97.78
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 97.7
COG1408284 Predicted phosphohydrolases [General function pred 97.68
PRK09453182 phosphodiesterase; Provisional 97.65
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 97.65
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 97.64
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 97.6
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 97.55
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 97.53
COG3540522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 97.5
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 97.49
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 97.47
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 97.46
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.46
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 97.43
PHA02239235 putative protein phosphatase 97.43
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.43
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 97.38
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.33
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 97.31
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.21
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 97.2
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.18
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 97.14
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 97.09
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 97.08
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.86
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 96.85
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 96.84
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 96.78
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 96.76
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 96.74
PRK09968218 serine/threonine-specific protein phosphatase 2; P 96.74
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 96.7
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 96.65
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 96.65
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 96.52
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 96.47
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 95.77
COG1692266 Calcineurin-like phosphoesterase [General function 95.7
PRK04036504 DNA polymerase II small subunit; Validated 95.57
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.51
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 95.46
KOG4419 602 consensus 5' nucleotidase [Nucleotide transport an 95.22
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 95.03
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 94.61
COG0622172 Predicted phosphoesterase [General function predic 94.59
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 94.54
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 94.29
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 94.05
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 93.34
COG2908237 Uncharacterized protein conserved in bacteria [Fun 93.25
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 92.92
PTZ00480320 serine/threonine-protein phosphatase; Provisional 92.02
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 91.63
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 91.58
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 91.49
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 91.07
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 90.66
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 89.78
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 89.2
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 88.25
cd07381239 MPP_CapA CapA and related proteins, metallophospha 87.0
KOG2476 528 consensus Uncharacterized conserved protein [Funct 81.84
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-34  Score=257.60  Aligned_cols=174  Identities=18%  Similarity=0.213  Sum_probs=141.1

Q ss_pred             CccEEEEEEeC-CCCCChhHHHHHHHHHHHHHhCCCceEEEcCCC------CCCchhhHhhhhc---cCC--CCCCeEEe
Q 026711           47 GLDFYFISVTG-GFRPLEQQTLLLKQMEDVAKSYDARFVINTSEL------GEDDPLKQNATWL---FPS--LKVPWYTT  114 (234)
Q Consensus        47 ~~~~~F~~~gd-G~~~~~~q~~~~~~i~~~~~~~~~dfvl~~GD~------~~~d~~~~~~~~~---~~~--l~~P~~~v  114 (234)
                      ...++|+++|| | +|...|..++++|.+++++.++||||.+|||      +.+|++|++.|+.   .++  +++|||+|
T Consensus        24 ~~~l~F~~vGDwG-~g~~~Q~~VA~~M~~~~~~~~~~FVls~GDNF~~Gv~sv~Dp~f~~~FE~vY~~~s~~L~~Pwy~v  102 (394)
T PTZ00422         24 KAQLRFASLGNWG-TGSKQQKLVASYLKQYAKNERVTFLVSPGSNFPGGVDGLNDPKWKHCFENVYSEESGDMQIPFFTV  102 (394)
T ss_pred             CCeEEEEEEecCC-CCchhHHHHHHHHHHHHHhCCCCEEEECCccccCCCCCccchhHHhhHhhhccCcchhhCCCeEEe
Confidence            35789999999 8 4788999999999999999999999999998      4679999998886   344  89999999


Q ss_pred             cccCCCcccCc----------------------------eEEEeCCC-----------------------CCceEEEEEe
Q 026711          115 KASKEKEVGCF----------------------------QEQIRLPH-----------------------GEALDIIGVN  143 (234)
Q Consensus       115 ~GNHD~~~g~~----------------------------~~~~~~P~-----------------------~~~~~~i~lD  143 (234)
                      +|||| +.|+.                            ..+|.||.                       +..+.|++||
T Consensus       103 LGNHD-y~Gn~~AQi~r~~~~y~~~~~~~~~~y~~~~~~~~RW~mP~~yY~~~~~f~~~~~~~~~~~~~~~~~v~fifiD  181 (394)
T PTZ00422        103 LGQAD-WDGNYNAELLKGQNVYLNGHGQTDIEYDSNNDIYPKWIMPNYWYHYFTHFTDTSGPSLLKSGHKDMSVAFIFID  181 (394)
T ss_pred             CCccc-ccCCchhhhccccccccccccccccccccccccCCCccCCchhheeeeeeecccccccccccCCCCEEEEEEEE
Confidence            99999 55541                            12577773                       2348999999


Q ss_pred             CCCCcCCCCCCCCCCcHHHHHHHHHHHHHhcc--CCeEEEEeeccccccCcccchHHHHHhHHHHHHHHHHhCccEEEEe
Q 026711          144 TGSLQGKIPTALPSASGDLLLNWLKSALEATN--GQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFI  221 (234)
Q Consensus       144 T~~~~~~~~~~~~~~~~~~ql~wL~~~L~~~~--~~~~IV~~HhP~~~~~~~~~~~~~~~~~~~l~~ll~k~~Vd~vf~~  221 (234)
                      |+++...+.   +.+...++++||+++|+.++  ++|+||++|||+||.+.|+.+.+   +...|+|||++|+||+|||+
T Consensus       182 T~~l~~~~~---~~~~~~~~w~~L~~~L~~a~k~a~WkIVvGHhPIySsG~hg~~~~---L~~~L~PLL~ky~VdlYisG  255 (394)
T PTZ00422        182 TWILSSSFP---YKKVSERAWQDLKATLEYAPKIADYIIVVGDKPIYSSGSSKGDSY---LSYYLLPLLKDAQVDLYISG  255 (394)
T ss_pred             CchhcccCC---ccccCHHHHHHHHHHHHhhccCCCeEEEEecCceeecCCCCCCHH---HHHHHHHHHHHcCcCEEEEc
Confidence            998765432   23346689999999997543  57999999999999998776554   67789999999999999999


Q ss_pred             cCcCCee
Q 026711          222 FSIPGKI  228 (234)
Q Consensus       222 ~~~~~~~  228 (234)
                      |-|=.+-
T Consensus       256 HDH~lq~  262 (394)
T PTZ00422        256 YDRNMEV  262 (394)
T ss_pred             cccceEE
Confidence            8875443

>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>KOG4419 consensus 5' nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
1ute_A313 Protein (II purple acid phosphatase); tartrate res 5e-06
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure
 Score = 45.4 bits (107), Expect = 5e-06
 Identities = 33/194 (17%), Positives = 54/194 (27%), Gaps = 48/194 (24%)

Query: 64  QQTLLLKQMEDVAKSYDARFVINT-------SELGEDDPLKQNATWLF-----PSL-KVP 110
           ++    K +    K+  A F+++              D   +           PSL  VP
Sbjct: 27  REMANAKAIATTVKTLGADFILSLGDNFYFTGVHDAKDK--RFQETFEDVFSDPSLRNVP 84

Query: 111 WYTTKASKEKEVGCFQEQIRLPH---------------------GEALDIIGVNTGSLQG 149
           W+    + +   G    QI                           ++ I  ++T +L G
Sbjct: 85  WHVLAGNHDHL-GNVSAQIAYSKISKRWNFPSPYYRLRFKIPRSNVSVAIFMLDTVTLCG 143

Query: 150 K--------IPTALPSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKK 201
                           A     L W+K  L A    + +V G +P+    EH       K
Sbjct: 144 NSDDFVSQQPERPRNLALARTQLAWIKKQLAAAKEDYVLVAGHYPVWSIAEHGPTHCLVK 203

Query: 202 IYEPLHHIFMKFGV 215
              PL        V
Sbjct: 204 QLLPL---LTTHKV 214

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 99.96
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.91
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 99.87
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.84
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 99.84
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.83
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.81
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.8
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 99.59
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.48
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.39
2q8u_A336 Exonuclease, putative; structural genomics, joint 99.2
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.08
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 98.97
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.93
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.8
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.77
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.68
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.64
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 98.61
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.6
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.58
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 98.57
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.56
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 98.48
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 97.9
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 97.88
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 97.88
3qfk_A 527 Uncharacterized protein; structural genomics, cent 97.86
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 97.86
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 97.71
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 97.68
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 97.65
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 97.65
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 97.57
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 97.4
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 97.34
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 97.26
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 97.23
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 96.99
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 96.95
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 96.69
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 96.55
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 96.54
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 96.31
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 96.15
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 96.12
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 96.09
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 95.92
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 95.88
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 95.85
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 95.44
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 94.25
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 94.21
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 94.15
1qv9_A283 F420-dependent methylenetetrahydromethanopterin de 84.49
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 81.68
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
Probab=99.96  E-value=1.5e-29  Score=222.94  Aligned_cols=173  Identities=18%  Similarity=0.155  Sum_probs=132.9

Q ss_pred             ccEEEEEEeC-CCCCChhHHHHHHHHHHHHHhCCCceEEEcCCC---C---CCchhhHhhhhc-c----CCCCCCeEEec
Q 026711           48 LDFYFISVTG-GFRPLEQQTLLLKQMEDVAKSYDARFVINTSEL---G---EDDPLKQNATWL-F----PSLKVPWYTTK  115 (234)
Q Consensus        48 ~~~~F~~~gd-G~~~~~~q~~~~~~i~~~~~~~~~dfvl~~GD~---~---~~d~~~~~~~~~-~----~~l~~P~~~v~  115 (234)
                      ..++|+++|| | .+...|..++++|.+.+++.+|||||++||+   |   .+++.|++.++. +    ..+++|||.|+
T Consensus         2 ~~l~f~~igD~g-~g~~~q~~va~~m~~~~~~~~pd~vl~~GD~~y~G~~~~~d~~~~~~f~~~~~~~~~~~~~P~~~vl   80 (342)
T 3tgh_A            2 CQLRFASLGDWG-KDTKGQILNAKYFKQFIKNERVTFIVSPGSNFIDGVKGLNDPAWKNLYEDVYSEEKGDMYMPFFTVL   80 (342)
T ss_dssp             CCEEEEECCSCB-SCCHHHHHHHHHHHHHHHHTTCCEEEECSCSBTTCCCSTTCTHHHHHTTTTSCCGGGTTCSEEEECC
T ss_pred             ceEEEEEEecCC-CCCchHHHHHHHHHHHHhhcCCCEEEECCCcccCCCCcCccHHHHHHHHHHhhhhhhhhCCCEEEeC
Confidence            3689999999 7 4677899999999999988999999999998   2   246778877765 2    24689999999


Q ss_pred             ccCCCcccC------c----------------------eEEEeCCCC-------------------C----ceEEEEEeC
Q 026711          116 ASKEKEVGC------F----------------------QEQIRLPHG-------------------E----ALDIIGVNT  144 (234)
Q Consensus       116 GNHD~~~g~------~----------------------~~~~~~P~~-------------------~----~~~~i~lDT  144 (234)
                      |||| +.++      |                      ..+|.||.-                   +    .++||+|||
T Consensus        81 GNHD-~~~~~~aq~~~~~~~~~~~~~~~~~~~~~~~~~~~rw~~P~~yY~~~~~f~~~~~~~~~~~g~~~~~v~fi~LDT  159 (342)
T 3tgh_A           81 GTRD-WTGNYNAQLLKGQGIYIEKNGETSIEKDADATNYPKWIMPNYWYHYFTHFTVSSGPSIVKTGHKDLAAAFIFIDT  159 (342)
T ss_dssp             CHHH-HTSCHHHHHHHHHC---------------CCCSSCEEECSSSSEEEEEEEEEC---------CEEEEEEEEECCT
T ss_pred             CCCc-cCCCchHhhhhhhcccccccccccccccccccCCCCccCCcceEEEEEEeeccccccccccCCCCceEEEEEEeC
Confidence            9999 4333      1                      234777621                   1    589999999


Q ss_pred             CCCcCCCCCCC-CCCcHHHHHHHHHHHHHhccCCeEEEEeeccccccCcccchHHHHHhHHHHHHHHHHhCccEEEEecC
Q 026711          145 GSLQGKIPTAL-PSASGDLLLNWLKSALEATNGQWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFS  223 (234)
Q Consensus       145 ~~~~~~~~~~~-~~~~~~~ql~wL~~~L~~~~~~~~IV~~HhP~~~~~~~~~~~~~~~~~~~l~~ll~k~~Vd~vf~~~~  223 (234)
                      +.+...+.... .....++|++||+++|+  +++|+||++|||+|+.+.++.+..   +++.|.++|++|+|++|||+|-
T Consensus       160 ~~l~~~~~~~~~~~~~~~~Ql~WLe~~L~--~~~~~IV~~HhP~~~~~~~~~~~~---l~~~l~~ll~~~~VdlvlsGH~  234 (342)
T 3tgh_A          160 WVLSSNFPYKKIHEKAWNDLKSQLSVAKK--IADFIIVVGDQPIYSSGYSRGSSY---LAYYLLPLLKDAEVDLYISGHD  234 (342)
T ss_dssp             TTTSTTCSCHHHHHHHHHHHHHHHHHHHH--HCSEEEEECSSCSSCSSTTCCCHH---HHHHTHHHHHHTTCCEEEECSS
T ss_pred             cccccCCcccccchHHHHHHHHHHHHhhc--cCCcEEEEECCCCCCCCCCCCcHH---HHHHHHHHHHHcCCCEEEECCC
Confidence            97654322100 02346799999999994  468999999999999887654433   5788999999999999999998


Q ss_pred             cCCe
Q 026711          224 IPGK  227 (234)
Q Consensus       224 ~~~~  227 (234)
                      |=..
T Consensus       235 H~~~  238 (342)
T 3tgh_A          235 NNME  238 (342)
T ss_dssp             SSEE
T ss_pred             ccee
Confidence            7543
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A* Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 234
d1utea_302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 0.003
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Mammalian purple acid phosphatase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score = 35.5 bits (80), Expect = 0.003
 Identities = 32/216 (14%), Positives = 58/216 (26%), Gaps = 46/216 (21%)

Query: 47  GLDFYFISVTGGFRP----LEQQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATW 102
            L F  +   GG         ++    K +    K+  A F+++  +      +      
Sbjct: 4   ILRFVAVGDWGGVPNAPFHTAREMANAKAIATTVKTLGADFILSLGDNFYFTGVHDAKDK 63

Query: 103 LF-----------PSLKVPWYTTKASKEKEVGC--------FQEQIRLPH---------- 133
            F               VPW+    + +               ++   P           
Sbjct: 64  RFQETFEDVFSDPSLRNVPWHVLAGNHDHLGNVSAQIAYSKISKRWNFPSPYYRLRFKIP 123

Query: 134 --GEALDIIGVNTGSLQGKIPTALPS--------ASGDLLLNWLKSALEATNGQWCIVVG 183
               ++ I  ++T +L G     +          A     L W+K  L A    + +V G
Sbjct: 124 RSNVSVAIFMLDTVTLCGNSDDFVSQQPERPRNLALARTQLAWIKKQLAAAKEDYVLVAG 183

Query: 184 FHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSF 219
            +P+    EH       K   PL        V    
Sbjct: 184 HYPVWSIAEHGPTHCLVKQLLPLLT---THKVTAYL 216

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 99.94
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.93
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.86
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.84
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.76
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.62
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.57
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.6
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 98.48
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.11
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.06
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 97.96
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.89
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 97.65
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 97.45
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 97.41
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.21
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 97.19
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.11
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 90.0
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 89.67
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 89.04
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 87.08
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 84.59
d1u6ka1282 F420-dependent methylenetetrahydromethanopterin de 83.88
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 83.78
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.94  E-value=1.4e-26  Score=199.57  Aligned_cols=163  Identities=19%  Similarity=0.245  Sum_probs=114.1

Q ss_pred             CccEEEEEEeC-CCCCChhHHHHHHHHHHH-HHhCCCceEEEcCCCC-------CCchhhHhhhhccC--CCCCCeEEec
Q 026711           47 GLDFYFISVTG-GFRPLEQQTLLLKQMEDV-AKSYDARFVINTSELG-------EDDPLKQNATWLFP--SLKVPWYTTK  115 (234)
Q Consensus        47 ~~~~~F~~~gd-G~~~~~~q~~~~~~i~~~-~~~~~~dfvl~~GD~~-------~~d~~~~~~~~~~~--~l~~P~~~v~  115 (234)
                      +.+++|+++|| |.. ..    ..+.+.+. ....+|||||++||+.       .+..+|...++.+.  ...+|+++++
T Consensus         5 ~~p~~F~v~GD~g~~-~~----~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~wd~~~~~~~~~~~~~P~~~~~   79 (312)
T d2qfra2           5 DVPYTFGLIGDLGQS-FD----SNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTA   79 (312)
T ss_dssp             SCCEEEEEECSCCSB-HH----HHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECC
T ss_pred             CCCEEEEEEeeCCCC-Cc----hHHHHHHHHHcCCCCCEEEECCCCCcCCCCcccchHHHHHHHHHHHHHhhcceEEEec
Confidence            45799999999 753 11    12233332 4457899999999984       12345666555422  2468999999


Q ss_pred             ccCCCccc----------CceEEEeCCC--------------CCceEEEEEeCCCCcCCCCCCCCCCcHHHHHHHHHHHH
Q 026711          116 ASKEKEVG----------CFQEQIRLPH--------------GEALDIIGVNTGSLQGKIPTALPSASGDLLLNWLKSAL  171 (234)
Q Consensus       116 GNHD~~~g----------~~~~~~~~P~--------------~~~~~~i~lDT~~~~~~~~~~~~~~~~~~ql~wL~~~L  171 (234)
                      ||||....          .|..+|.||.              -++++||+|||+...         ....+|++||+++|
T Consensus        80 GNHD~~~~~~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~~---------~~~~~Q~~WL~~~L  150 (312)
T d2qfra2          80 GNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAY---------GRGTPQYTWLKKEL  150 (312)
T ss_dssp             CGGGTCCBGGGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSCC---------STTSHHHHHHHHHH
T ss_pred             ccccccccccccccccccchhhhccCCccccCCCCCceEEEEECCEEEEEeeccccc---------cchHHHHHHHHHHH
Confidence            99992110          1334466662              167999999997421         12347999999999


Q ss_pred             HhccC---CeEEEEeeccccccCcccchHHHHHhHHHHHHHHHHhCccEEEEecCc
Q 026711          172 EATNG---QWCIVVGFHPLVICEEHEEQLEAKKIYEPLHHIFMKFGVVRSFFIFSI  224 (234)
Q Consensus       172 ~~~~~---~~~IV~~HhP~~~~~~~~~~~~~~~~~~~l~~ll~k~~Vd~vf~~~~~  224 (234)
                      +++++   +|+||++|||+|+.+.++.. +...+++.|++||++|+||+||++|-|
T Consensus       151 ~~~~~~~~~w~iv~~H~P~y~~~~~~~~-~~~~~r~~l~~l~~~~~Vdlv~~GH~H  205 (312)
T d2qfra2         151 RKVKRSETPWLIVLMHSPLYNSYNHHFM-EGEAMRTKFEAWFVKYKVDVVFAGHVH  205 (312)
T ss_dssp             HTCCTTTCCEEEEECSSCSSCCBSTTTT-TTHHHHHHHHHHHHHTTCSEEEECSSS
T ss_pred             HHHhhcCCCEEEEEccccccccCCCCcc-cchhHHHHHHHHHHHcCcEEEEEccCc
Confidence            97543   59999999999998664422 223467889999999999999998876
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1u6ka1 c.127.1.1 (A:2-283) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure