Citrus Sinensis ID: 026796

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
cccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHcHEcHccccHHHHcccccccccccccEEcccccccccccccccccEEEEccEccccccccccccccEEEEEEEccccccccEHHHHHHHcccccccEEccccccHHHccHHHHHHHHHHHHHHHcccc
malssisplsikslnfcsssskgpyqlhalskpLWVACQissktesdgqfpdcsnnqcagpyaklkNWRVFVSTALAAAVVASCSSNISALADLNKYeaetrgefgigsaaqfgsADLRKAVHVKEnfrranftsadmresdfsgskfngAYLEKAVAYKAnftgadlsdTLMDRMVLNEANLTNAVLVRTVLtrsdlggaiiegadfSDAVIDLAQKQVGSKTSYFFFNIKC
malssisplsiKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENfrranftsadmresdfsgSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKqvgsktsyfffnikc
MAlssisplsikslNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRvfvstalaaavvascssnisaLADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
************************YQLHALSKPLWVACQIS**********DCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRR****************KFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNI**
MALSSISPLSIKSLNFCS**********ALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISS********PDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
****************************ALSKPLWVACQISSKT*SDGQFPDCSNN*******KLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYFFFNIKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query233 2.2.26 [Sep-21-2011]
Q8H1Q1280 Thylakoid lumenal protein yes no 0.918 0.764 0.671 8e-66
Q52118295 Uncharacterized protein i N/A no 0.429 0.338 0.342 3e-07
Q55837166 Uncharacterized protein s N/A no 0.356 0.5 0.386 7e-07
P81760236 Thylakoid lumenal 17.4 kD no no 0.330 0.326 0.292 0.0002
P73709331 Uncharacterized protein s N/A no 0.429 0.302 0.323 0.0002
Q9SE95298 FH protein interacting pr no no 0.407 0.318 0.33 0.0003
P74297574 Serine/threonine-protein N/A no 0.390 0.158 0.326 0.0008
>sp|Q8H1Q1|TL225_ARATH Thylakoid lumenal protein At1g12250, chloroplastic OS=Arabidopsis thaliana GN=At1g12250 PE=1 SV=1 Back     alignment and function desciption
 Score =  249 bits (637), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 174/222 (78%), Gaps = 8/222 (3%)

Query: 1   MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQ--- 57
           MA SS+SPL +KSL+   SSS      +   + L    Q+SS+  S+ +  D SN +   
Sbjct: 1   MAFSSLSPLPMKSLDISRSSSSVSRSPYHFQRYLLRRLQLSSR--SNLEIKDSSNTREGC 58

Query: 58  CAGPYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSAD 117
           C+   A+   W+  +S A+AAAV+AS SS + A+A+LN++EA+TRGEFGIGSAAQ+GSAD
Sbjct: 59  CSS--AESNTWKRILSAAMAAAVIAS-SSGVPAMAELNRFEADTRGEFGIGSAAQYGSAD 115

Query: 118 LRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMV 177
           L K VH  ENFRRANFTSADMRESDFSGS FNGAYLEKAVAYKANF+GADLSDTLMDRMV
Sbjct: 116 LSKTVHSNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFSGADLSDTLMDRMV 175

Query: 178 LNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQ 219
           LNEANLTNAVLVR+VLTRSDLGGA IEGADFSDAVIDL QKQ
Sbjct: 176 LNEANLTNAVLVRSVLTRSDLGGAKIEGADFSDAVIDLLQKQ 217

Arabidopsis thaliana (taxid: 3702)
>sp|Q52118|YMO3_ERWST Uncharacterized protein in mobD 3'region OS=Erwinia stewartii PE=4 SV=1 Back     alignment and function description
>sp|Q55837|Y516_SYNY3 Uncharacterized protein slr0516 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0516 PE=4 SV=1 Back     alignment and function description
>sp|P81760|TL17_ARATH Thylakoid lumenal 17.4 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=At5g53490 PE=1 SV=2 Back     alignment and function description
>sp|P73709|Y1819_SYNY3 Uncharacterized protein slr1819 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1819 PE=4 SV=1 Back     alignment and function description
>sp|Q9SE95|FIP2_ARATH FH protein interacting protein FIP2 OS=Arabidopsis thaliana GN=FIP2 PE=1 SV=1 Back     alignment and function description
>sp|P74297|SPKB_SYNY3 Serine/threonine-protein kinase B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkB PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
255583634280 conserved hypothetical protein [Ricinus 0.931 0.775 0.748 1e-83
224071571275 predicted protein [Populus trichocarpa] 0.909 0.770 0.712 1e-79
297741150261 unnamed protein product [Vitis vinifera] 0.849 0.758 0.730 4e-77
359474379 596 PREDICTED: uncharacterized protein LOC10 0.849 0.332 0.730 8e-77
449459702279 PREDICTED: thylakoid lumenal protein At1 0.922 0.770 0.694 1e-75
388505216273 unknown [Lotus japonicus] 0.858 0.732 0.691 3e-72
356540500260 PREDICTED: thylakoid lumenal protein At1 0.845 0.757 0.684 2e-69
357481963262 Thylakoid lumenal protein [Medicago trun 0.849 0.755 0.665 4e-68
357481965232 Thylakoid lumenal protein [Medicago trun 0.652 0.655 0.849 5e-67
116785652291 unknown [Picea sitchensis] 0.746 0.597 0.733 7e-66
>gi|255583634|ref|XP_002532572.1| conserved hypothetical protein [Ricinus communis] gi|223527699|gb|EEF29806.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/219 (74%), Positives = 180/219 (82%), Gaps = 2/219 (0%)

Query: 1   MALSSISPLSIKSLNFCSSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQCAG 60
           MA +SISPLSIKS+N   SSS+ PY L + SKP  + CQ++  TE + +  DCS  +   
Sbjct: 1   MAFTSISPLSIKSVNISPSSSRSPYHLPSQSKPFHILCQLA--TEREDRILDCSTTRYKV 58

Query: 61  PYAKLKNWRVFVSTALAAAVVASCSSNISALADLNKYEAETRGEFGIGSAAQFGSADLRK 120
            ++K KNWR  VSTALAAA   +    + A ADLNK+EAE RGEFGIGSAAQFGSADLRK
Sbjct: 59  HHSKPKNWRTLVSTALAAAAAVNLGFGLPAAADLNKFEAELRGEFGIGSAAQFGSADLRK 118

Query: 121 AVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNE 180
           AVHV ENFRRANFTSADMRESDFSGS FNGAYLEKAVAYKANFTGADLSDTLMDRMVLNE
Sbjct: 119 AVHVNENFRRANFTSADMRESDFSGSTFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNE 178

Query: 181 ANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQ 219
           ANLTNAVLVR+VLTRSDLGGAIIEGADFSDAVIDL QKQ
Sbjct: 179 ANLTNAVLVRSVLTRSDLGGAIIEGADFSDAVIDLTQKQ 217

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224071571|ref|XP_002303521.1| predicted protein [Populus trichocarpa] gi|222840953|gb|EEE78500.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297741150|emb|CBI31881.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474379|ref|XP_002265958.2| PREDICTED: uncharacterized protein LOC100250522 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459702|ref|XP_004147585.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] gi|449520611|ref|XP_004167327.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388505216|gb|AFK40674.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356540500|ref|XP_003538726.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357481963|ref|XP_003611267.1| Thylakoid lumenal protein [Medicago truncatula] gi|355512602|gb|AES94225.1| Thylakoid lumenal protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357481965|ref|XP_003611268.1| Thylakoid lumenal protein [Medicago truncatula] gi|355512603|gb|AES94226.1| Thylakoid lumenal protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|116785652|gb|ABK23807.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
TAIR|locus:2202033280 AT1G12250 "AT1G12250" [Arabido 0.836 0.696 0.642 1.4e-57
UNIPROTKB|Q74B06254 GSU2404 "Pentapeptide repeat d 0.454 0.417 0.353 1.3e-07
TIGR_CMR|GSU_2404254 GSU_2404 "pentapeptide repeat 0.454 0.417 0.353 1.3e-07
UNIPROTKB|Q0BZZ2245 HNE_2256 "Pentapeptide repeat 0.416 0.395 0.383 3.2e-07
TAIR|locus:2160230298 FIP2 [Arabidopsis thaliana (ta 0.429 0.335 0.33 0.00021
UNIPROTKB|Q2GFB5 607 ECH_1083 "Pentapeptide repeat 0.459 0.176 0.325 0.00029
TIGR_CMR|ECH_1083 607 ECH_1083 "pentapeptide repeat 0.459 0.176 0.325 0.00029
TAIR|locus:2202033 AT1G12250 "AT1G12250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 592 (213.5 bits), Expect = 1.4e-57, P = 1.4e-57
 Identities = 131/204 (64%), Positives = 148/204 (72%)

Query:    18 SSSSKGPYQLHALSKPLWVACQISSKTESDGQFPDCSNNQ--CAGPYAKLKNWRXXXXXX 75
             SS S+ PY  H   + L    Q+SS+  S+ +  D SN +  C    A+   W+      
Sbjct:    21 SSVSRSPY--H-FQRYLLRRLQLSSR--SNLEIKDSSNTREGCCSS-AESNTWKRILSAA 74

Query:    76 XXXXXXXXXXXXXXXLADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTS 135
                            +A+LN++EA+TRGEFGIGSAAQ+GSADL K VH  ENFRRANFTS
Sbjct:    75 MAAAVIASSSGVPA-MAELNRFEADTRGEFGIGSAAQYGSADLSKTVHSNENFRRANFTS 133

Query:   136 ADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTR 195
             ADMRESDFSGS FNGAYLEKAVAYKANF+GADLSDTLMDRMVLNEANLTNAVLVR+VLTR
Sbjct:   134 ADMRESDFSGSTFNGAYLEKAVAYKANFSGADLSDTLMDRMVLNEANLTNAVLVRSVLTR 193

Query:   196 SDLGGAIIEGADFSDAVIDLAQKQ 219
             SDLGGA IEGADFSDAVIDL QKQ
Sbjct:   194 SDLGGAKIEGADFSDAVIDLLQKQ 217
GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
UNIPROTKB|Q74B06 GSU2404 "Pentapeptide repeat domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2404 GSU_2404 "pentapeptide repeat domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BZZ2 HNE_2256 "Pentapeptide repeat domain protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TAIR|locus:2160230 FIP2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GFB5 ECH_1083 "Pentapeptide repeat protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1083 ECH_1083 "pentapeptide repeat protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H1Q1TL225_ARATHNo assigned EC number0.67110.91840.7642yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-13
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-13
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 1e-12
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-12
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-10
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-07
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 4e-06
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 1e-05
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 1e-05
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 2e-05
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 3e-05
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 3e-05
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 4e-05
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 4e-05
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 6e-05
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 1e-04
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 1e-04
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 2e-04
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 6e-04
PRK15377 782 PRK15377, PRK15377, E3 ubiquitin-protein ligase So 0.002
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 0.004
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information 
 Score = 67.2 bits (164), Expect = 2e-13
 Identities = 36/106 (33%), Positives = 53/106 (50%)

Query: 111 AQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSD 170
           A    A+L  A     N   AN + AD+  +D SG+  +GA L  A    AN +GA+LS 
Sbjct: 128 ANLTGANLSGANLNGANLSNANLSGADLSGADLSGADLSGANLSGADLRGANLSGANLSG 187

Query: 171 TLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDLA 216
             +    L+ A+L+ A L    L  ++LGGA + GA+   A +  A
Sbjct: 188 ADLRNANLSGADLSGADLTGANLVNANLGGANLFGANLLGADLSGA 233

Length = 238
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185275 PRK15377, PRK15377, E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
PRK15197291 secreted effector protein PipB; Provisional 99.75
PRK15197291 secreted effector protein PipB; Provisional 99.74
PRK15196350 secreted effector protein PipB2; Provisional 99.68
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.67
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.64
PRK09718 512 hypothetical protein; Validated 99.6
PRK09718 512 hypothetical protein; Validated 99.59
KOG1665302 consensus AFH1-interacting protein FIP2, contains 99.59
KOG1665302 consensus AFH1-interacting protein FIP2, contains 99.57
>PRK15197 secreted effector protein PipB; Provisional Back     alignment and domain information 
Probab=99.75  E-value=4.1e-19  Score=158.53  Aligned_cols=67  Identities=15%  Similarity=0.203  Sum_probs=28.2

Q ss_pred             CCCceecCCeecCCccCCceeeCcEEccceecCceecCcccccceeccceeeCcEEccccccCceec
Q 026796          108 GSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMD  174 (233)
Q Consensus       108 ls~~~f~~~dL~g~~f~~~~l~~a~f~~a~l~~a~fs~a~l~~a~f~~a~f~~a~f~ga~ls~a~~~  174 (233)
                      +.+++|.+++|++.+|.+++|.+++|.+++|++++|.+++|.+++|.+++|.+++|.+++|.+++|.
T Consensus       156 L~g~DLs~adL~gadLsgadLs~A~F~gAnL~~a~LsgA~L~~AnL~~A~f~~a~f~~Anf~~AdL~  222 (291)
T PRK15197        156 LRGVNLAHKDFQGEDLSDIDASNADFRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHADLT  222 (291)
T ss_pred             CCCCCCCCCCCCCCcCCCCcccCccccccCcCCccccccccCCcEecccchhhhhhhhceeccCcCc
Confidence            3444444444444444444444444444444444444444444444433333333333333333333

>PRK15197 secreted effector protein PipB; Provisional Back     alignment and domain information
>PRK15196 secreted effector protein PipB2; Provisional Back     alignment and domain information
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
2g0y_A184 Crystal Structure Of A Lumenal Pentapeptide Repeat 3e-09
2f3l_A184 Crystal Structure Of A Lumenal Rfr-Domain Protein ( 5e-09
2j8k_A201 Structure Of The Fusion Of Np275 And Np276, Pentape 9e-06
3du1_X257 The 2.0 Angstrom Resolution Crystal Structure Of He 1e-05
2j8i_A118 Structure Of Np275, A Pentapeptide Repeat Protein F 5e-05
2o6w_A150 Crystal Structure Of A Pentapeptide Repeat Protein 5e-04
>pdb|2G0Y|A Chain A, Crystal Structure Of A Lumenal Pentapeptide Repeat Protein From Cyanothece Sp 51142 At 2.3 Angstrom Resolution. Tetragonal Crystal Form Length = 184 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (52%)
Query: 108 GSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGAD 167
           GS+A +    L       ++   A FT+AD+ +S+FS +   GA    +    A+  GAD
Sbjct: 49  GSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGAD 108
Query: 168 LSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDAVIDL 215
           L++ L        A+LTNAVL   ++ R+    A I GADFS AV+D+
Sbjct: 109 LTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDV 156
>pdb|2F3L|A Chain A, Crystal Structure Of A Lumenal Rfr-Domain Protein (Contig83.1_1_243_746) From Cyanothece Sp. 51142 At 2.1 Angstrom Resolution Length = 184 Back     alignment and structure
>pdb|2J8K|A Chain A, Structure Of The Fusion Of Np275 And Np276, Pentapeptide Repeat Proteins From Nostoc Punctiforme Length = 201 Back     alignment and structure
>pdb|3DU1|X Chain X, The 2.0 Angstrom Resolution Crystal Structure Of Hetl, A Pentapeptide Repeat Protein Involved In Heterocyst Differentiation Regulation From The Cyanobacterium Nostoc Sp. Strain Pcc 7120 Length = 257 Back     alignment and structure
>pdb|2J8I|A Chain A, Structure Of Np275, A Pentapeptide Repeat Protein From Nostoc Punctiforme Length = 118 Back     alignment and structure
>pdb|2O6W|A Chain A, Crystal Structure Of A Pentapeptide Repeat Protein (Rfr23) From The Cyanobacterium Cyanothece 51142 Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 8e-33
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 5e-17
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 9e-14
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 1e-13
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 1e-09
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 2e-29
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 3e-11
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 5e-11
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-21
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 6e-20
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 3e-19
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 1e-18
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-18
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 4e-17
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-15
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-14
2bm5_A 186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-07
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-20
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 9e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-18
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-18
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-17
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-17
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-13
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-20
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-20
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 6e-20
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 7e-20
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-17
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-17
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-17
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 7e-14
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-12
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-19
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-19
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 5e-19
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-18
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-17
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 3e-13
2j8k_A 201 NP275-NP276; pentapeptide repeat protein, PRP, rig 4e-06
2j8k_A 201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-05
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-18
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-17
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-15
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 3e-15
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 5e-15
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 5e-18
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 5e-17
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 3e-16
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 3e-16
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 1e-09
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 8e-18
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-16
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 1e-15
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 4e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 8e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-12
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-12
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-11
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-07
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 6e-17
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 9e-15
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 3e-13
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 5e-13
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-08
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 8e-08
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 2e-14
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 3e-14
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 4e-07
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 2e-05
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 2e-14
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 3e-14
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 2e-13
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 4e-12
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 1e-11
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 2e-11
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 5e-10
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 2e-09
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
 Score =  116 bits (293), Expect = 8e-33
 Identities = 40/126 (31%), Positives = 62/126 (49%)

Query: 92  ADLNKYEAETRGEFGIGSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGA 151
            DL   + +       GS+A +    L       ++   A FT+AD+ +S+FS +   GA
Sbjct: 33  PDLGTDDDDKAMAMVTGSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGA 92

Query: 152 YLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSDA 211
               +    A+  GADL++ L        A+LTNAVL   ++ R+    A I GADFS A
Sbjct: 93  VFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLA 152

Query: 212 VIDLAQ 217
           V+D+ +
Sbjct: 153 VLDVYE 158
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.89
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.86
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 99.85
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 99.85
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.8
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 99.8
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.8
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 99.8
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 99.8
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 99.78
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.78
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 99.78
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 99.78
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.78
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 99.76
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 99.75
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 99.75
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.68
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.63
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
Probab=99.89  E-value=1.1e-23  Score=175.56  Aligned_cols=120  Identities=32%  Similarity=0.433  Sum_probs=113.0

Q ss_pred             CCCceecCCeecCCccCCceeeCcEEccceecCceecCcccccceeccceeeCcEEccccccCceecceeeccceecccE
Q 026796          108 GSAAQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAV  187 (233)
Q Consensus       108 ls~~~f~~~dL~g~~f~~~~l~~a~f~~a~l~~a~fs~a~l~~a~f~~a~f~~a~f~ga~ls~a~~~~a~f~~a~l~~a~  187 (233)
                      +++.+|++++|++++|++++|++++|.+++|.+++|++++|++++|.+++|.+++|.+++|+++.|.+++|.+|+|++|+
T Consensus        49 ~~~~~f~~~~l~~~df~~~~L~~~~f~~~~l~~a~f~~a~L~~a~f~~a~l~~a~l~~a~L~~a~l~~a~f~~a~L~~a~  128 (184)
T 2f3l_A           49 GSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAV  128 (184)
T ss_dssp             ---CEEESCBCTTCBCTTCBCTTCEEESCBCTTCBCTTCBCTTCEEESCBCTTCBCTTCBCTTCEEEEEECTTCBCTTCB
T ss_pred             ccCccccCCeECCCcCCCCCcCCCEeccCccccCCcCCCCCcEeEEeeeccCCCeEEEeecccceecCcEeCccEeCCCE
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCceecCeeeeCcEEeCceeeCeEeChhhHHhccccccc
Q 026796          188 LVRTVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSYF  227 (233)
Q Consensus       188 l~~a~l~~a~f~~a~l~gadfs~a~l~~~q~~~Lc~~~~~  227 (233)
                      |.+++|.+++|.+++|+++||++|+|++.++..+|..++.
T Consensus       129 l~~a~l~~a~f~~a~L~gadf~~a~l~~~~l~~~c~~~~g  168 (184)
T 2f3l_A          129 LTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADG  168 (184)
T ss_dssp             CTTCEEEEEECTTCBCTTCBCTTCEECHHHHHHHHTTCCC
T ss_pred             eeCCEECCCEEeCCEecCCEecCCCCCcChHHHhhccccC
Confidence            9999999999999999999999999999999999987653
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 233
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 6e-15
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 4e-11
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 1e-07
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 4e-07
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 2e-05
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 5e-12
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 1e-06
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 0.003
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 0.004
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 0.004
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: NP275-NP276
species: Nostoc punctiforme [TaxId: 272131]

 Score = 68.0 bits (165), Expect = 6e-15
 Identities = 27/100 (27%), Positives = 44/100 (44%)

Query: 111 AQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSD 170
           A    A L  A+        A    A+++ ++   +  + A + +A   +AN   ADLS 
Sbjct: 75  ADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSG 134

Query: 171 TLMDRMVLNEANLTNAVLVRTVLTRSDLGGAIIEGADFSD 210
             +    L++ANL  A L R  LT ++L  A +EG     
Sbjct: 135 ADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEG 174
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.89
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.8
d2bm5a1181 Hypothetical protein Rv3361c (MT3469) {Mycobacteri 99.73
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.73
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.7
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: Lumenal RFR-domain protein
species: Cyanothece sp. atcc 51142 [TaxId: 43989]

Probab=99.89  E-value=5.6e-24  Score=165.68  Aligned_cols=116  Identities=31%  Similarity=0.434  Sum_probs=110.7

Q ss_pred             ceecCCeecCCccCCceeeCcEEccceecCceecCcccccceeccceeeCcEEccccccCceecceeeccceecccEecC
Q 026796          111 AQFGSADLRKAVHVKENFRRANFTSADMRESDFSGSKFNGAYLEKAVAYKANFTGADLSDTLMDRMVLNEANLTNAVLVR  190 (233)
Q Consensus       111 ~~f~~~dL~g~~f~~~~l~~a~f~~a~l~~a~fs~a~l~~a~f~~a~f~~a~f~ga~ls~a~~~~a~f~~a~l~~a~l~~  190 (233)
                      ++|++++|++++|++++|.+++|.+++|++++|.+++|.+++|.++.|.+++|.+++|++++|.+++|.+++|++++|.+
T Consensus         1 A~F~~~~L~~~dfs~~~l~~a~f~~~~L~~~~f~~a~l~ga~f~~~~l~~~~~~~a~l~~a~~~~~~~~~~~~~~a~~~~   80 (132)
T d2f3la1           1 ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTE   80 (132)
T ss_dssp             CEEESCBCTTCBCTTCBCTTCEEESCBCTTCBCTTCBCTTCEEESCBCTTCBCTTCBCTTCEEEEEECTTCBCTTCBCTT
T ss_pred             CccCCCCccCCcCCCCcCCCCcccCCCCccccccccccceeeecccccccccccccccccccccccccchhhhccCCcCC
Confidence            47889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceecCeeeeCcEEeCceeeCeEeChhhHHhcccccc
Q 026796          191 TVLTRSDLGGAIIEGADFSDAVIDLAQKQVGSKTSY  226 (233)
Q Consensus       191 a~l~~a~f~~a~l~gadfs~a~l~~~q~~~Lc~~~~  226 (233)
                      ++|.+++|.+++|+++||++|.|++.+++.+|.+..
T Consensus        81 a~l~~a~~~~a~l~~adfs~a~L~~~~l~~~~~~~~  116 (132)
T d2f3la1          81 AIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRAD  116 (132)
T ss_dssp             CEEEEEECTTCBCTTCBCTTCEECHHHHHHHHTTCC
T ss_pred             CCcCCCCcCCCEECcCCCCCccCCHHHHHHHhccCc
Confidence            999999999999999999999999999999997643
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure