Citrus Sinensis ID: 026806

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MKAADSICGNNNAYNASNSSASVFEESEESDESIDINRDIFATKREKINQMHEADDDILAQKNVTVCHSNTTNLASRDSAESMIKTTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALMPHNLMNGESYRREENLALFQSRYASSSSLNVKASSSKKFRQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcHHHHHccccccccccccccccHHHHcc
ccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccEccccccccccccccccccccccccccccc
mkaadsicgnnnaynasnssasvfeeseesdesidINRDIFATKREKINQMHEADDDILAQKNVTVChsnttnlasrdSAESMIKTtqnsgivinesgtgaritkdGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALmphnlmngesyrrEENLALFQSRyasssslnvkassskkfrq
mkaadsicgnnnaynasnssaSVFEeseesdesidiNRDIFATKREKINQMHEADDDILAQKNVTVCHSNTtnlasrdsAESMIKttqnsgivinesgtgaritkdgeelklakrrqsnresarrsrmrkqEEFKKLQKAVEELKAESAVLKDELLSLsakygklkdenEAIVEELKLRHRADAISYLEALMPHNLMNGESYRREENLALFQsryasssslnvkassskkfrq
MKAADSICGnnnaynasnssasvfeeseesdesIDINRDIFATKREKINQMHEADDDILAQKNVTVCHSNTTNLASRDSAESMIKTTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALMPHNLMNGESYRREENLALFQSRYAsssslnvkassskkFRQ
*********************************************************ILAQKNVTVCH**************************************************************************************LLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALMPHNLM************************************
**********************************************************************************************************************************QEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVE*L*********************************************************
MKAADSICGNNNAYNASN***************IDINRDIFATKREKINQMHEADDDILAQKNVTVCHSNTTNLASRDSAESMIKTTQNSGIVINESGTGARITKDGEELK*************************LQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALMPHNLMNGESYRREENLALFQSRYA*****************
********************************************************************************************************************************RKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEALMPH******SYRREEN**L***********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAADSICGNNNAYNASNSSASVFEESEESDESIDINRDIFATKREKINQMHEADDDILAQKNVTVCHSNTTNLASRDSAESMIKTTQNSGIVINESGTGARITKDGEELKLAKRRQSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYGKLKDENEAIVEELKLRHRADAISYLEALMPHNLMNGESYRREENLALFQSRYASSSSLNVKASSSKKFRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query233 2.2.26 [Sep-21-2011]
P42774315 G-box-binding factor 1 OS yes no 0.442 0.326 0.490 9e-15
Q99142265 Transcriptional activator N/A no 0.476 0.418 0.404 4e-10
P42775360 G-box-binding factor 2 OS no no 0.300 0.194 0.514 8e-10
P42776382 G-box-binding factor 3 OS no no 0.296 0.180 0.507 8e-10
Q99091296 Light-inducible protein C N/A no 0.553 0.435 0.308 7e-09
Q99089411 Common plant regulatory f N/A no 0.463 0.262 0.368 2e-07
P25032354 DNA-binding protein EMBP- N/A no 0.317 0.209 0.44 5e-07
P23922349 Transcription factor HBP- N/A no 0.291 0.194 0.455 3e-06
Q9FUD3277 Basic leucine zipper 9 OS no no 0.330 0.277 0.35 3e-05
P12959 453 Regulatory protein opaque N/A no 0.210 0.108 0.469 0.0001
>sp|P42774|GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana GN=GBF1 PE=2 SV=2 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 86  TTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELK 145
           T  N G+ +  S  G  + KD  ELK  KR+QSNRESARRSR+RKQ E ++LQ+ VE L 
Sbjct: 200 TNLNIGMDLWSSQAGVPV-KDERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLS 258

Query: 146 AESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLE 189
            E+  L+DEL  LS++  KLK EN +I +EL+    A+A++ LE
Sbjct: 259 NENQSLRDELQRLSSECDKLKSENNSIQDELQRVLGAEAVANLE 302
Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Arabidopsis thaliana (taxid: 3702)
>sp|Q99142|TAF1_TOBAC Transcriptional activator TAF-1 (Fragment) OS=Nicotiana tabacum GN=TAF1 PE=2 SV=1 Back     alignment and function description
>sp|P42775|GBF2_ARATH G-box-binding factor 2 OS=Arabidopsis thaliana GN=GBF2 PE=1 SV=1 Back     alignment and function description
>sp|P42776|GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana GN=GBF3 PE=1 SV=2 Back     alignment and function description
>sp|Q99091|CPRF3_PETCR Light-inducible protein CPRF3 OS=Petroselinum crispum GN=CPRF3 PE=2 SV=1 Back     alignment and function description
>sp|Q99089|CPRF1_PETCR Common plant regulatory factor 1 OS=Petroselinum crispum GN=CPRF1 PE=2 SV=1 Back     alignment and function description
>sp|P25032|EMBP1_WHEAT DNA-binding protein EMBP-1 OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
156070786 345 unknown [Petunia integrifolia subsp. inf 0.630 0.426 0.387 1e-14
633152267 G-box binding factor 1B [Brassica napus] 0.442 0.385 0.5 3e-14
633150313 G-box binding factor 1A [Brassica napus] 0.442 0.329 0.480 1e-13
156070764 355 unknown [Solanum melongena] 0.733 0.481 0.365 1e-13
224134370 375 predicted protein [Populus trichocarpa] 0.437 0.272 0.490 2e-13
15450988315 Unknown protein [Arabidopsis thaliana] g 0.442 0.326 0.490 4e-13
30690752313 G-box binding factor 1 [Arabidopsis thal 0.442 0.329 0.490 4e-13
16286315 G-box binding factor 1 [Arabidopsis thal 0.442 0.326 0.490 5e-13
15234506315 G-box binding factor 1 [Arabidopsis thal 0.442 0.326 0.490 5e-13
297798222312 G-box binding factor 1 [Arabidopsis lyra 0.472 0.352 0.469 5e-13
>gi|156070786|gb|ABU45199.1| unknown [Petunia integrifolia subsp. inflata] Back     alignment and taxonomy information
 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 88/173 (50%), Gaps = 26/173 (15%)

Query: 37  NRDIFATKREKINQMHEADDDILAQKNVTVCHSNT-----------TNL--------ASR 77
           N +  A K+   NQM    D   AQ N +  +  T           TNL        AS 
Sbjct: 164 NHEFAANKKGSFNQM--LADGASAQNNPSGANYQTSVPGNPVTMPATNLNIGMDVWNASS 221

Query: 78  DSAESMIKTTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKL 137
            +  +M      +G VI +     +  +D  ELK  KR+QSNRESARRSR+RKQ E ++L
Sbjct: 222 TAPGAMNMQPNATGPVITD-----KWVQDERELKRQKRKQSNRESARRSRLRKQAECEEL 276

Query: 138 QKAVEELKAESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLEA 190
           Q+ VE L  E++ LKDEL  LS +  KL  EN +I EEL      DA+S LE+
Sbjct: 277 QRKVETLSNENSTLKDELRRLSEECEKLTSENNSIKEELTRWCGPDAVSKLES 329

Source: Petunia integrifolia subsp. inflata

Species: Petunia integrifolia

Genus: Petunia

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|633152|emb|CAA58773.1| G-box binding factor 1B [Brassica napus] Back     alignment and taxonomy information
>gi|633150|emb|CAA58774.1| G-box binding factor 1A [Brassica napus] Back     alignment and taxonomy information
>gi|156070764|gb|ABU45179.1| unknown [Solanum melongena] Back     alignment and taxonomy information
>gi|224134370|ref|XP_002327821.1| predicted protein [Populus trichocarpa] gi|222836906|gb|EEE75299.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15450988|gb|AAK96765.1| Unknown protein [Arabidopsis thaliana] gi|17978767|gb|AAL47377.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30690752|ref|NP_849510.1| G-box binding factor 1 [Arabidopsis thaliana] gi|16226375|gb|AAL16150.1|AF428382_1 At4g37294/C7A10_630 [Arabidopsis thaliana] gi|332661295|gb|AEE86695.1| G-box binding factor 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|16286|emb|CAA45356.1| G-box binding factor 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15234506|ref|NP_195391.1| G-box binding factor 1 [Arabidopsis thaliana] gi|3915710|sp|P42774.2|GBF1_ARATH RecName: Full=G-box-binding factor 1; AltName: Full=bZIP transcription factor 41; Short=AtbZIP41 gi|1657243|emb|CAA68197.1| G-box binding factor 1 [Arabidopsis thaliana] gi|2464907|emb|CAB16806.1| G-box-binding factor 1 [Arabidopsis thaliana] gi|7270621|emb|CAB80339.1| G-box-binding factor 1 [Arabidopsis thaliana] gi|57336397|emb|CAH58736.1| Z-box binding factor 2 protein [Arabidopsis thaliana] gi|332661294|gb|AEE86694.1| G-box binding factor 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798222|ref|XP_002866995.1| G-box binding factor 1 [Arabidopsis lyrata subsp. lyrata] gi|297312831|gb|EFH43254.1| G-box binding factor 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
TAIR|locus:2115250315 GBF1 "G-box binding factor 1" 0.442 0.326 0.490 2e-17
TAIR|locus:2124938360 GBF2 "G-box binding factor 2" 0.394 0.255 0.413 9.9e-12
TAIR|locus:2063020382 GBF3 "G-box binding factor 3" 0.296 0.180 0.507 1.5e-11
TAIR|locus:2018411173 bZIP44 "AT1G75390" [Arabidopsi 0.480 0.647 0.368 1.1e-09
TAIR|locus:2031705389 bZIP68 "basic region/leucine z 0.351 0.210 0.397 1.1e-09
TAIR|locus:2062455409 bZIP16 "basic region/leucine z 0.351 0.200 0.414 1.2e-09
TAIR|locus:2097315156 bZIP5 "AT3G49760" [Arabidopsis 0.399 0.596 0.326 8.7e-08
TAIR|locus:2012413138 bZIP "AT1G68880" [Arabidopsis 0.330 0.557 0.392 1.4e-07
TAIR|locus:2159325206 bZIP70 "AT5G60830" [Arabidopsi 0.403 0.456 0.34 2.9e-07
TAIR|locus:2096024146 BZIP53 "AT3G62420" [Arabidopsi 0.399 0.636 0.364 5.6e-07
TAIR|locus:2115250 GBF1 "G-box binding factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 51/104 (49%), Positives = 69/104 (66%)

Query:    86 TTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELK 145
             T  N G+ +  S  G  + KD  ELK  KR+QSNRESARRSR+RKQ E ++LQ+ VE L 
Sbjct:   200 TNLNIGMDLWSSQAGVPV-KDERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLS 258

Query:   146 AESAVLKDELLSLSAKYGKLKDENEAIVEELKLRHRADAISYLE 189
              E+  L+DEL  LS++  KLK EN +I +EL+    A+A++ LE
Sbjct:   259 NENQSLRDELQRLSSECDKLKSENNSIQDELQRVLGAEAVANLE 302
GO:0003677 "DNA binding" evidence=IEA;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=IMP
GO:0010629 "negative regulation of gene expression" evidence=IEP
GO:0090342 "regulation of cell aging" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
TAIR|locus:2124938 GBF2 "G-box binding factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063020 GBF3 "G-box binding factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018411 bZIP44 "AT1G75390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031705 bZIP68 "basic region/leucine zipper transcription factor 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062455 bZIP16 "basic region/leucine zipper transcription factor 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097315 bZIP5 "AT3G49760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012413 bZIP "AT1G68880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159325 bZIP70 "AT5G60830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096024 BZIP53 "AT3G62420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-11
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-09
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 2e-05
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 0.002
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 58.0 bits (141), Expect = 1e-11
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 108 EELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKD 167
           E+ K  +RR+ NRE+ARRSR RK+ E ++L++ VE+L+AE+  LK E+  L  +  KLK 
Sbjct: 2   EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKS 61

Query: 168 ENEA 171
           E E 
Sbjct: 62  ELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
KOG3584348 consensus cAMP response element binding protein an 99.5
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.38
smart0033865 BRLZ basic region leucin zipper. 99.34
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.31
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.12
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.01
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 98.82
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.0
KOG0837279 consensus Transcriptional activator of the JUN fam 97.98
KOG4571294 consensus Activating transcription factor 4 [Trans 97.73
KOG3119269 consensus Basic region leucine zipper transcriptio 97.18
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.87
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 95.51
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.13
PRK13169110 DNA replication intiation control protein YabA; Re 94.79
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.52
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.18
PRK1542279 septal ring assembly protein ZapB; Provisional 93.97
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 93.86
COG307479 Uncharacterized protein conserved in bacteria [Fun 93.72
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.35
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 93.05
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 93.03
PRK10884206 SH3 domain-containing protein; Provisional 92.92
PRK13169110 DNA replication intiation control protein YabA; Re 92.71
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 92.56
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 92.18
TIGR0244965 conserved hypothetical protein TIGR02449. Members 92.06
COG4026290 Uncharacterized protein containing TOPRIM domain, 91.7
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 91.56
TIGR0220985 ftsL_broad cell division protein FtsL. This model 91.23
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 91.12
COG4467114 Regulator of replication initiation timing [Replic 91.04
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 91.03
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.02
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 90.91
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 90.58
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 90.41
PF1374789 DUF4164: Domain of unknown function (DUF4164) 89.97
PRK00888105 ftsB cell division protein FtsB; Reviewed 89.41
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 88.72
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 88.56
PF0499997 FtsL: Cell division protein FtsL; InterPro: IPR007 88.55
PRK10884206 SH3 domain-containing protein; Provisional 88.52
PRK13922 276 rod shape-determining protein MreC; Provisional 86.23
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 86.21
PRK0211973 hypothetical protein; Provisional 86.02
PF15294278 Leu_zip: Leucine zipper 85.6
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 84.69
PRK00888105 ftsB cell division protein FtsB; Reviewed 84.54
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 84.48
smart0033865 BRLZ basic region leucin zipper. 84.47
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 84.04
PRK0279372 phi X174 lysis protein; Provisional 83.61
KOG1962216 consensus B-cell receptor-associated protein and r 83.14
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 83.0
PF15058 200 Speriolin_N: Speriolin N terminus 82.79
PRK0029568 hypothetical protein; Provisional 82.49
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 82.48
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 82.23
COG4467114 Regulator of replication initiation timing [Replic 82.08
KOG4797123 consensus Transcriptional regulator [Transcription 81.97
PRK0432574 hypothetical protein; Provisional 81.88
PRK0073668 hypothetical protein; Provisional 81.69
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 81.69
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 81.57
PRK0440675 hypothetical protein; Provisional 81.37
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 81.33
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 81.23
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 81.12
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 80.91
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.76
COG2919117 Septum formation initiator [Cell division and chro 80.69
PF10186 302 Atg14: UV radiation resistance protein and autopha 80.68
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 80.59
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 80.54
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information 
Probab=99.50  E-value=6.2e-14  Score=128.94  Aligned_cols=134  Identities=19%  Similarity=0.099  Sum_probs=100.1

Q ss_pred             cccccCCccchhhhhh----hhhhhhhchhHHHHhHhh-------------cch-hhhhccccccccCCCCCCCCCcccc
Q 026806           21 ASVFEESEESDESIDI----NRDIFATKREKINQMHEA-------------DDD-ILAQKNVTVCHSNTTNLASRDSAES   82 (233)
Q Consensus        21 ~~~~~~~~~~~~~~~~----~~~~~~~~r~~~~~m~~~-------------~d~-~~~q~n~t~c~g~~~~l~~~~~~~~   82 (233)
                      ..++-+.+++++..++    ++...+..+.++.++++.             .+| ..++...|+       -++.+.+..
T Consensus       193 s~gvqglq~~~~T~S~~s~Q~~~t~Lq~~a~~~~~~~qi~~p~~qv~~~q~atgd~qs~~i~tg-------~sssps~tl  265 (348)
T KOG3584|consen  193 SDGVQGLQTLTMTNSGPSTQQGTTILQYTAQTIDGAQQILVPSNQVVVPQAATGDMQSYQIRTG-------YSSSPSATL  265 (348)
T ss_pred             CCccccccccCcccCCCCCCCceeeEeecccccccceeeeccccceeecccccCcccchhhccc-------ccCCCcccc
Confidence            5678889999988777    777777777777666442             111 222222221       123333344


Q ss_pred             ccccccCCCcccccCCCCCCcccchHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 026806           83 MIKTTQNSGIVINESGTGARITKDGEELKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKY  162 (233)
Q Consensus        83 ~p~t~ln~g~~~~~~~~~~~~~~Dere~KR~RRk~sNRESARRSR~RKq~~leeLe~~V~~L~~EN~~L~~el~~L~~~~  162 (233)
                      .|...+..++++..++.+.   .||-.+||+-|.++|||+||.+|+|||+|+.+||.+|++|+.+|..|.+||..|.+.|
T Consensus       266 ~pg~~~~~~~~~ltsp~~~---aee~trKRevRLmKNREAARECRRKKKEYVKCLENRVAVLENQNKaLIEELKtLKeLY  342 (348)
T KOG3584|consen  266 TPGVVMMGSPSYLTSPTQG---AEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKALIEELKTLKELY  342 (348)
T ss_pred             CCceEEecCcccccCCCcc---chhhhhHHHHHHHhhHHHHHHHHHhHhHHHHHHHhHHHHHhcccHHHHHHHHHHHHHh
Confidence            5666666666666666654   6888899999999999999999999999999999999999999999999999998877


Q ss_pred             HH
Q 026806          163 GK  164 (233)
Q Consensus       163 ~~  164 (233)
                      ..
T Consensus       343 c~  344 (348)
T KOG3584|consen  343 CH  344 (348)
T ss_pred             hc
Confidence            54

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF04999 FtsL: Cell division protein FtsL; InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>KOG4797 consensus Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG2919 Septum formation initiator [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 5e-08
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 2e-07
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 5e-07
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 7e-07
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 1e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 3e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 3e-05
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 4e-05
2wt7_B90 Transcription factor MAFB; transcription, transcri 6e-05
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-04
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
 Score = 47.4 bits (113), Expect = 5e-08
 Identities = 18/58 (31%), Positives = 33/58 (56%)

Query: 110 LKLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKYGKLKD 167
           +K  K+ + N+ +A R R +K+ E + L    +EL+ ++  LK+   SL+ +   LKD
Sbjct: 1   MKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKD 58
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.53
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.32
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.25
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.21
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.17
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.01
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.93
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.57
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.57
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.48
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.1
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.64
1deb_A54 APC protein, adenomatous polyposis coli protein; c 95.77
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.61
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.26
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 95.18
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 94.13
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.87
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 91.77
3m48_A33 General control protein GCN4; leucine zipper, synt 91.29
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 91.02
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 90.48
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 90.21
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 89.2
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 89.11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.49
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 87.19
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.87
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 86.77
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 86.62
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 86.08
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.97
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 85.85
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 85.59
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 85.57
3cve_A72 Homer protein homolog 1; coiled coil, alternative 85.51
1uo4_A34 General control protein GCN4; four helix bundle, c 85.5
2bni_A34 General control protein GCN4; four helix bundle, a 85.44
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 85.38
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 85.15
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.6
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 84.51
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.44
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 84.0
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 83.96
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 83.86
2hy6_A34 General control protein GCN4; protein design, para 83.84
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 82.84
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 82.57
2wt7_B90 Transcription factor MAFB; transcription, transcri 82.28
1fmh_A33 General control protein GCN4; coiled coil, leucine 82.19
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 82.04
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 81.91
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 81.58
3u06_A 412 Protein claret segregational; motor domain, stalk 81.53
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 80.05
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.53  E-value=9.3e-15  Score=103.18  Aligned_cols=52  Identities=38%  Similarity=0.473  Sum_probs=48.8

Q ss_pred             HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 026806          111 KLAKRRQSNRESARRSRMRKQEEFKKLQKAVEELKAESAVLKDELLSLSAKY  162 (233)
Q Consensus       111 KR~RRk~sNRESARRSR~RKq~~leeLe~~V~~L~~EN~~L~~el~~L~~~~  162 (233)
                      ||.+||++||+||++||+||++|+++|+.+|..|+.+|..|..++..|.+.+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5889999999999999999999999999999999999999999999887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 88.13
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=88.13  E-value=0.11  Score=36.87  Aligned_cols=28  Identities=29%  Similarity=0.561  Sum_probs=23.1

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHH
Q 026806          110 LKLAKRRQSNRESARRSRMRKQEEFKKL  137 (233)
Q Consensus       110 ~KR~RRk~sNRESARRSR~RKq~~leeL  137 (233)
                      .+--||+=+|+.+|+.+|+||....++|
T Consensus        47 irDIRRRGKNKvAAqnCRKRKld~~d~l   74 (74)
T d1sknp_          47 IRKIRRRGKNKVAARTCRQRRTDRHDKM   74 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHhcccHHHHHHHHHhhhhhhccC
Confidence            4466889999999999999998776543