Citrus Sinensis ID: 026854


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MISMTRKITDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDAIES
ccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHc
cccHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHccccccEccHHHHHHcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEEEEcHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccHcccccccccHHHHHcc
MISMTRKITDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSklssgdskcgskvlhadkskdnslYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVAtiyapeiyptsarttgagVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASsllfpfetkgrELKDAVDAIES
mismtrkitdklksgfssFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVlhadkskdnsLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASsllfpfetkgrelKDAVDAIES
MISMTRKITDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPtsarttgagvasavgrvggMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDAIES
************KSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKL***********L******DNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFET**************
********************TLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGREL*********
********TDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKL*********KVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDAIES
**S**RKI***LKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVD**ES
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISMTRKITDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDAIES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q940M4500 Organic cation/carnitine yes no 0.935 0.434 0.554 4e-63
Q2XWK0548 Synaptic vesicle 2-relate N/A no 0.879 0.372 0.373 7e-30
P30638520 Putative transporter ZK63 yes no 0.883 0.394 0.349 7e-30
Q8N4V2548 Synaptic vesicle 2-relate yes no 0.875 0.370 0.376 8e-30
Q5R5T8548 Synaptic vesicle 2-relate yes no 0.875 0.370 0.376 9e-30
Q9Z2I7548 Synaptic vesicle 2-relate yes no 0.857 0.363 0.369 3e-29
Q8BFT9548 Synaptic vesicle 2-relate yes no 0.857 0.363 0.365 6e-29
Q1JP63548 Synaptic vesicle 2-relate yes no 0.875 0.370 0.376 2e-28
Q1LVS8506 Putative transporter SVOP no no 0.883 0.405 0.304 3e-21
Q8N434492 Putative transporter SVOP no no 0.939 0.443 0.285 6e-19
>sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 Back     alignment and function desciption
 Score =  241 bits (614), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 157/220 (71%), Gaps = 3/220 (1%)

Query: 10  DKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHA 69
           DK + GFS    L S  L++ T+LLWV+FF NAF+YYG VLLT++L++  ++C       
Sbjct: 275 DK-EPGFS-LLALLSPTLMKRTLLLWVVFFGNAFAYYGVVLLTTELNNSHNRCYPTEKQL 332

Query: 70  DKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAV 129
             S D + Y DVFI SFAE PGL++SA +VD++GRK SM  M    CIFLLPL+ HQS  
Sbjct: 333 RNSNDVN-YRDVFIASFAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSHQSPF 391

Query: 130 VTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVT 189
           +TTVLLFG R+C +   TV  IYAPEIYPT+ RTTG GV S+VGR+GG++CPLVAVGLV 
Sbjct: 392 ITTVLLFGGRICISAAFTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVH 451

Query: 190 SCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDA 229
            CH  +AV+LFEVV +++     LFPFET GR+L D++ A
Sbjct: 452 GCHQTIAVLLFEVVILVSGICVCLFPFETSGRDLTDSISA 491




High affinity carnitine transporter involved in the active cellular uptake of carnitine. Also transports organic cations.
Arabidopsis thaliana (taxid: 3702)
>sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 Back     alignment and function description
>sp|P30638|YOU1_CAEEL Putative transporter ZK637.1 OS=Caenorhabditis elegans GN=ZK637.1 PE=3 SV=5 Back     alignment and function description
>sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 Back     alignment and function description
>sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 Back     alignment and function description
>sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 Back     alignment and function description
>sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
224118680 492 predicted protein [Populus trichocarpa] 0.987 0.465 0.694 9e-83
224118546 493 predicted protein [Populus trichocarpa] 0.991 0.466 0.647 4e-77
147767934 461 hypothetical protein VITISV_042940 [Viti 0.978 0.492 0.627 1e-74
225443470 495 PREDICTED: synaptic vesicle 2-related pr 0.978 0.458 0.622 8e-74
255574249 497 sugar transporter, putative [Ricinus com 0.987 0.460 0.646 1e-73
255573803 498 sugar transporter, putative [Ricinus com 0.887 0.413 0.611 2e-69
383932368 482 MFS [Gossypium hirsutum] 0.862 0.414 0.655 4e-69
224095094 485 predicted protein [Populus trichocarpa] 0.922 0.441 0.595 6e-66
224122710 503 predicted protein [Populus trichocarpa] 0.922 0.425 0.586 6e-65
357120730 507 PREDICTED: synaptic vesicle 2-related pr 0.913 0.418 0.553 7e-65
>gi|224118680|ref|XP_002331421.1| predicted protein [Populus trichocarpa] gi|222873635|gb|EEF10766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  312 bits (799), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 187/229 (81%)

Query: 1   MISMTRKITDKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDS 60
           ++S TR +    KSGFSSF  LFS KLIRTT+LLW+LFF NAFSYYG +LLTS+LSS + 
Sbjct: 255 LLSSTRNLVSDFKSGFSSFVMLFSSKLIRTTLLLWLLFFGNAFSYYGIILLTSELSSEEG 314

Query: 61  KCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLL 120
           KC S VL ++  +D+SLY++VFITS AELPG++LSAIIVD+ GRKLSM  MFVLACIFLL
Sbjct: 315 KCASTVLRSENLQDDSLYINVFITSLAELPGILLSAIIVDRFGRKLSMAFMFVLACIFLL 374

Query: 121 PLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVC 180
           PLVFHQ A +TT LLFG RMCA GT TVA IYAPE+YPT  R TGAGVA+AVGR+GGMVC
Sbjct: 375 PLVFHQHATLTTALLFGARMCAIGTFTVAAIYAPEVYPTVIRATGAGVANAVGRIGGMVC 434

Query: 181 PLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDA 229
           PLVAVGLV  CHL+ A+ILFEVV V+++   LLFPFET GREL D++ A
Sbjct: 435 PLVAVGLVAGCHLKEAIILFEVVIVISVVCVLLFPFETSGRELSDSLAA 483




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224118546|ref|XP_002331389.1| predicted protein [Populus trichocarpa] gi|222873603|gb|EEF10734.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147767934|emb|CAN64534.1| hypothetical protein VITISV_042940 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443470|ref|XP_002273636.1| PREDICTED: synaptic vesicle 2-related protein [Vitis vinifera] gi|297735684|emb|CBI18371.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574249|ref|XP_002528039.1| sugar transporter, putative [Ricinus communis] gi|223532569|gb|EEF34357.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255573803|ref|XP_002527821.1| sugar transporter, putative [Ricinus communis] gi|223532795|gb|EEF34573.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|383932368|gb|AFH57281.1| MFS [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224095094|ref|XP_002310344.1| predicted protein [Populus trichocarpa] gi|222853247|gb|EEE90794.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122710|ref|XP_002330449.1| predicted protein [Populus trichocarpa] gi|222871861|gb|EEF08992.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357120730|ref|XP_003562078.1| PREDICTED: synaptic vesicle 2-related protein-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2089270500 NiaP "nicotinate transporter" 0.935 0.434 0.495 1.7e-50
ZFIN|ZDB-GENE-070705-359411 svopb "SV2 related protein hom 0.887 0.501 0.328 9.7e-25
WB|WBGene00014021520 svop-1 [Caenorhabditis elegans 0.952 0.425 0.307 1.1e-24
UNIPROTKB|Q8N4V2548 SVOP "Synaptic vesicle 2-relat 0.875 0.370 0.344 2.2e-24
RGD|620277548 Svop "SV2 related protein" [Ra 0.875 0.370 0.334 7.9e-24
UNIPROTKB|F1LPX1548 Svop "Synaptic vesicle 2-relat 0.875 0.370 0.334 7.9e-24
UNIPROTKB|Q9Z2I7548 Svop "Synaptic vesicle 2-relat 0.875 0.370 0.334 7.9e-24
UNIPROTKB|F6XK47483 SVOP "Uncharacterized protein" 0.875 0.420 0.334 8.1e-24
UNIPROTKB|E2QZ16548 SVOP "Uncharacterized protein" 0.875 0.370 0.334 1.3e-23
MGI|MGI:1915916548 Svop "SV2 related protein" [Mu 0.875 0.370 0.330 1.7e-23
TAIR|locus:2089270 NiaP "nicotinate transporter" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 1.7e-50, P = 1.7e-50
 Identities = 109/220 (49%), Positives = 141/220 (64%)

Query:    10 DKLKSGFSSFFTLFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHA 69
             DK + GFS    L S  L++ T+LLWV+FF NAF+YYG VLLT++L++  ++C       
Sbjct:   275 DK-EPGFS-LLALLSPTLMKRTLLLWVVFFGNAFAYYGVVLLTTELNNSHNRCYPTEKQL 332

Query:    70 DKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAV 129
               S D + Y DVFI SFAE PGL++SA +VD++GRK SM  M    CIFLLPL+ HQS  
Sbjct:   333 RNSNDVN-YRDVFIASFAEFPGLLISAAMVDRLGRKASMASMLFTCCIFLLPLLSHQSPF 391

Query:   130 VTTVLLFGVRMCATGTITVATIYAPEIYPXXXXXXXXXXXXXXXXXXXMVCPLVAVGLVT 189
             +TTVLLFG R+C +   TV  IYAPEIYP                   ++CPLVAVGLV 
Sbjct:   392 ITTVLLFGGRICISAAFTVVYIYAPEIYPTAVRTTGVGVGSSVGRIGGILCPLVAVGLVH 451

Query:   190 SCHLRLAVILFEVVFVLAIASSLLFPFETKGRELKDAVDA 229
              CH  +AV+LFEVV +++     LFPFET GR+L D++ A
Sbjct:   452 GCHQTIAVLLFEVVILVSGICVCLFPFETSGRDLTDSISA 491




GO:0005215 "transporter activity" evidence=IEA
GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006810 "transport" evidence=IEA
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0090416 "nicotinate transporter activity" evidence=IDA
GO:0090417 "N-methylnicotinate transporter activity" evidence=IDA
GO:2001142 "nicotinate transport" evidence=IDA
GO:2001143 "N-methylnicotinate transport" evidence=IDA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
ZFIN|ZDB-GENE-070705-359 svopb "SV2 related protein homolog b (rat)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00014021 svop-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N4V2 SVOP "Synaptic vesicle 2-related protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620277 Svop "SV2 related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPX1 Svop "Synaptic vesicle 2-related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z2I7 Svop "Synaptic vesicle 2-related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6XK47 SVOP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ16 SVOP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915916 Svop "SV2 related protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
TIGR00898505 TIGR00898, 2A0119, cation transport protein 6e-32
TIGR00895398 TIGR00895, 2A0115, benzoate transport 3e-16
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-10
TIGR01299742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 6e-10
PRK11551406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 3e-08
TIGR00883394 TIGR00883, 2A0106, metabolite-proton symporter 6e-07
TIGR00887502 TIGR00887, 2A0109, phosphate:H+ symporter 8e-07
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 1e-06
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-06
PRK03893496 PRK03893, PRK03893, putative sialic acid transport 2e-05
PRK12307426 PRK12307, PRK12307, putative sialic acid transport 3e-05
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 3e-05
PRK10406432 PRK10406, PRK10406, alpha-ketoglutarate transporte 1e-04
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 7e-04
TIGR00891405 TIGR00891, 2A0112, putative sialic acid transporte 0.001
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
 Score =  121 bits (305), Expect = 6e-32
 Identities = 61/206 (29%), Positives = 99/206 (48%), Gaps = 23/206 (11%)

Query: 22  LFSRKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDV 81
             +  L +TT+ L +L+F  AFSYYG VL    L                    ++Y+D+
Sbjct: 320 FRTPNLRKTTLCLMMLWFTTAFSYYGLVLDLGNLGG------------------NIYLDL 361

Query: 82  FITSFAELPGLILSAIIVDKIGRKLSMVLMFVLA--CIFLLPLVFHQSAVVTTVLLFGVR 139
           FI+   ELP  +++ +++D++GR+ +M    +LA   + LL  V      + T L    +
Sbjct: 362 FISGLVELPAKLITLLLIDRLGRRYTMAASLLLAGVALLLLLFVPVDLYFLRTALAVLGK 421

Query: 140 MCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVIL 199
              T    +  +Y  E+YPT  R  G GV S + RVG ++ P +    +    L L ++L
Sbjct: 422 FGITSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSIISPFLV--YLGEKWLFLPLVL 479

Query: 200 FEVVFVLAIASSLLFPFETKGRELKD 225
           F  + +LA   +L  P ETKG  L +
Sbjct: 480 FGGLALLAGILTLFLP-ETKGVPLPE 504


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505

>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|233168 TIGR00883, 2A0106, metabolite-proton symporter Back     alignment and domain information
>gnl|CDD|129965 TIGR00887, 2A0109, phosphate:H+ symporter Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|179668 PRK03893, PRK03893, putative sialic acid transporter; Provisional Back     alignment and domain information
>gnl|CDD|237051 PRK12307, PRK12307, putative sialic acid transporter; Provisional Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182433 PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.9
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.9
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.9
KOG0569485 consensus Permease of the major facilitator superf 99.89
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.89
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.88
PRK03545 390 putative arabinose transporter; Provisional 99.88
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.88
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.88
PRK11663 434 regulatory protein UhpC; Provisional 99.87
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.87
TIGR00891 405 2A0112 putative sialic acid transporter. 99.87
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.87
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.86
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.86
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.86
PRK10091 382 MFS transport protein AraJ; Provisional 99.86
PRK10504 471 putative transporter; Provisional 99.86
PRK10642490 proline/glycine betaine transporter; Provisional 99.86
PRK10054 395 putative transporter; Provisional 99.86
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.86
PRK03893 496 putative sialic acid transporter; Provisional 99.85
TIGR00895 398 2A0115 benzoate transport. 99.85
PRK12307 426 putative sialic acid transporter; Provisional 99.85
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.85
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.85
TIGR00893 399 2A0114 d-galactonate transporter. 99.85
PLN00028 476 nitrate transmembrane transporter; Provisional 99.85
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.85
PRK03699 394 putative transporter; Provisional 99.84
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.84
TIGR00900 365 2A0121 H+ Antiporter protein. 99.84
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.83
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.83
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.83
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.83
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.83
PRK10489417 enterobactin exporter EntS; Provisional 99.83
PRK09874 408 drug efflux system protein MdtG; Provisional 99.82
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.82
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.82
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.82
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.82
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.82
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.82
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.82
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.82
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.82
TIGR00898505 2A0119 cation transport protein. 99.82
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.82
PRK11043 401 putative transporter; Provisional 99.81
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.81
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.81
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.81
PRK10642 490 proline/glycine betaine transporter; Provisional 99.8
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.8
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.8
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.8
PRK05122 399 major facilitator superfamily transporter; Provisi 99.8
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.79
PRK12382 392 putative transporter; Provisional 99.79
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.79
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.79
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.79
PRK03633 381 putative MFS family transporter protein; Provision 99.79
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.79
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.78
PRK12307426 putative sialic acid transporter; Provisional 99.78
PRK09705 393 cynX putative cyanate transporter; Provisional 99.78
PRK15075 434 citrate-proton symporter; Provisional 99.78
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.77
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.77
PRK10489 417 enterobactin exporter EntS; Provisional 99.77
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.77
PRK09705393 cynX putative cyanate transporter; Provisional 99.77
PRK09952438 shikimate transporter; Provisional 99.77
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.77
PRK11663434 regulatory protein UhpC; Provisional 99.77
PRK09952 438 shikimate transporter; Provisional 99.76
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.76
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.76
PRK15075434 citrate-proton symporter; Provisional 99.76
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.75
PRK10133 438 L-fucose transporter; Provisional 99.75
PRK05122399 major facilitator superfamily transporter; Provisi 99.75
PRK15011393 sugar efflux transporter B; Provisional 99.75
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.75
PRK09528420 lacY galactoside permease; Reviewed 99.75
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.74
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.74
PRK03699394 putative transporter; Provisional 99.74
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.74
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.74
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.73
PRK03545390 putative arabinose transporter; Provisional 99.73
TIGR00897402 2A0118 polyol permease family. This family of prot 99.73
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.72
PTZ00207 591 hypothetical protein; Provisional 99.72
TIGR00898 505 2A0119 cation transport protein. 99.72
TIGR00893399 2A0114 d-galactonate transporter. 99.72
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.71
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.71
KOG2615 451 consensus Permease of the major facilitator superf 99.7
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 99.7
PRK11010 491 ampG muropeptide transporter; Validated 99.7
PRK09874408 drug efflux system protein MdtG; Provisional 99.7
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.7
PRK12382392 putative transporter; Provisional 99.7
KOG2532 466 consensus Permease of the major facilitator superf 99.69
PRK15011 393 sugar efflux transporter B; Provisional 99.69
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 99.69
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.69
KOG0254513 consensus Predicted transporter (major facilitator 99.69
PRK03633381 putative MFS family transporter protein; Provision 99.69
PRK03893496 putative sialic acid transporter; Provisional 99.69
PRK11902 402 ampG muropeptide transporter; Reviewed 99.68
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.68
TIGR00895398 2A0115 benzoate transport. 99.68
TIGR00805 633 oat sodium-independent organic anion transporter. 99.68
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.67
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.67
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.67
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.67
TIGR00901 356 2A0125 AmpG-related permease. 99.67
PRK09528 420 lacY galactoside permease; Reviewed 99.67
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.67
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.66
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.66
KOG0254 513 consensus Predicted transporter (major facilitator 99.66
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.66
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.66
TIGR00891405 2A0112 putative sialic acid transporter. 99.65
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.65
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.65
PLN00028476 nitrate transmembrane transporter; Provisional 99.64
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.64
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.64
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.64
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.64
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.64
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.64
TIGR00900365 2A0121 H+ Antiporter protein. 99.64
PRK11010491 ampG muropeptide transporter; Validated 99.63
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.63
PRK10504471 putative transporter; Provisional 99.63
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.62
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.62
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.62
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.61
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.61
COG2270438 Permeases of the major facilitator superfamily [Ge 99.6
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.6
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.59
TIGR00896355 CynX cyanate transporter. This family of proteins 99.59
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.59
KOG0569 485 consensus Permease of the major facilitator superf 99.57
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.57
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.56
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.55
KOG2533 495 consensus Permease of the major facilitator superf 99.55
PRK10054395 putative transporter; Provisional 99.54
TIGR00901356 2A0125 AmpG-related permease. 99.54
PRK11646400 multidrug resistance protein MdtH; Provisional 99.53
PRK11902402 ampG muropeptide transporter; Reviewed 99.53
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.53
PRK11043401 putative transporter; Provisional 99.53
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.53
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.52
PRK09848448 glucuronide transporter; Provisional 99.52
PRK10091382 MFS transport protein AraJ; Provisional 99.51
PRK09669444 putative symporter YagG; Provisional 99.51
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.51
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 99.5
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 99.5
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 99.5
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.5
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.49
PRK10133438 L-fucose transporter; Provisional 99.49
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.49
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.48
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 99.48
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 99.48
PF13347428 MFS_2: MFS/sugar transport protein 99.48
PRK10429473 melibiose:sodium symporter; Provisional 99.48
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.47
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.46
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.46
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.46
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.44
PRK11195393 lysophospholipid transporter LplT; Provisional 99.42
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.42
KOG2532466 consensus Permease of the major facilitator superf 99.42
PRK11462460 putative transporter; Provisional 99.41
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.4
PRK09669 444 putative symporter YagG; Provisional 99.38
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.38
COG2211467 MelB Na+/melibiose symporter and related transport 99.36
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 99.34
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.34
PRK10429 473 melibiose:sodium symporter; Provisional 99.34
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.33
KOG2533495 consensus Permease of the major facilitator superf 99.29
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.28
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.28
PRK11462 460 putative transporter; Provisional 99.28
KOG3762618 consensus Predicted transporter [General function 99.24
PF13347 428 MFS_2: MFS/sugar transport protein 99.23
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 99.22
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.21
PRK11652394 emrD multidrug resistance protein D; Provisional 99.19
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.19
KOG2325 488 consensus Predicted transporter/transmembrane prot 99.15
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.15
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.15
KOG2816 463 consensus Predicted transporter ADD1 (major facili 99.14
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.12
COG2211 467 MelB Na+/melibiose symporter and related transport 99.05
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.04
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 99.03
PRK09848 448 glucuronide transporter; Provisional 99.01
KOG2563 480 consensus Permease of the major facilitator superf 98.91
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.89
KOG2563480 consensus Permease of the major facilitator superf 98.87
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.76
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.73
COG0477 338 ProP Permeases of the major facilitator superfamil 98.7
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.7
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.64
PF1283277 MFS_1_like: MFS_1 like family 98.64
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.63
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.56
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.52
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 98.47
PTZ00207591 hypothetical protein; Provisional 98.44
KOG3764464 consensus Vesicular amine transporter [Intracellul 98.44
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 98.3
TIGR00805633 oat sodium-independent organic anion transporter. 98.26
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.24
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.17
KOG2615451 consensus Permease of the major facilitator superf 98.13
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.09
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.07
KOG1330493 consensus Sugar transporter/spinster transmembrane 98.05
KOG3098461 consensus Uncharacterized conserved protein [Funct 98.03
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.02
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.99
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.96
KOG0637 498 consensus Sucrose transporter and related proteins 97.87
KOG3626 735 consensus Organic anion transporter [Secondary met 97.87
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.87
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.85
KOG2816463 consensus Predicted transporter ADD1 (major facili 97.83
PRK03612 521 spermidine synthase; Provisional 97.79
KOG3626735 consensus Organic anion transporter [Secondary met 97.72
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 97.72
KOG3098 461 consensus Uncharacterized conserved protein [Funct 97.67
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.56
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 97.53
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.37
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.36
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 97.36
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.32
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.24
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 96.88
COG3202 509 ATP/ADP translocase [Energy production and convers 96.85
KOG3762 618 consensus Predicted transporter [General function 96.71
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 96.67
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 96.42
KOG2325488 consensus Predicted transporter/transmembrane prot 96.39
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 96.15
KOG3097 390 consensus Predicted membrane protein [Function unk 95.7
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 95.6
KOG0637498 consensus Sucrose transporter and related proteins 95.27
KOG3574510 consensus Acetyl-CoA transporter [Inorganic ion tr 94.62
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 93.85
KOG4332454 consensus Predicted sugar transporter [Carbohydrat 93.73
KOG3880 409 consensus Predicted small molecule transporter inv 93.39
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 93.27
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 93.18
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 92.89
KOG3810433 consensus Micronutrient transporters (folate trans 92.73
KOG1479 406 consensus Nucleoside transporter [Nucleotide trans 90.35
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 88.81
KOG3810 433 consensus Micronutrient transporters (folate trans 88.3
PRK10263 1355 DNA translocase FtsK; Provisional 87.62
COG5336116 Uncharacterized protein conserved in bacteria [Fun 82.26
PF11947153 DUF3464: Protein of unknown function (DUF3464); In 82.07
PF02990521 EMP70: Endomembrane protein 70; InterPro: IPR00424 80.69
TIGR00880141 2_A_01_02 Multidrug resistance protein. 80.45
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
Probab=99.90  E-value=3.2e-22  Score=167.48  Aligned_cols=145  Identities=25%  Similarity=0.342  Sum_probs=121.6

Q ss_pred             hHHHHHHHHhhhhhHHHHHHHHHhhhchHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHhhhhhhhhhccccc
Q 026854           77 LYVDVFITSFAELPGLILSAIIVDKIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEI  156 (232)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~g~l~dr~grr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~e~  156 (232)
                      ......+..++.+++.++.|+++||+|||++++++.++.+++.+++.+.++...+++..++.+++.++.++..+++++|+
T Consensus       597 ~~~~~~l~~l~~i~G~il~g~L~Dr~GRr~~l~~~~~lsai~~ll~~~~~s~~~ll~~~~l~g~~~~~~~~~~~a~~aEl  676 (742)
T TIGR01299       597 IYFVNFLGTLAVLPGNIVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVEL  676 (742)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34556677899999999999999999999999999999999888888776666666667777877778888999999999


Q ss_pred             cccchhhhhhHHHHHhhhhhhchhHHHHHHHhhccchhHHHHHHHHHHHHHHHHHhcccccccCCCc
Q 026854          157 YPTSARTTGAGVASAVGRVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETKGREL  223 (232)
Q Consensus       157 ~p~~~r~~~~~~~~~~~~~g~~~~~~i~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~  223 (232)
                      +|++.|++++|+.+..+++|++++|.+++.+.+. +...++++.+++.++++++.++ +|||+++.+
T Consensus       677 ~Pt~~Rgta~Gi~~~~~rlGaiigp~i~g~L~~~-~~~~pf~i~a~~lll~~ll~~~-LPET~~~~l  741 (742)
T TIGR01299       677 YPSDKRATAFGFLNALCKAAAVLGILIFGSFVGI-TKAAPILFASAALACGGLLALK-LPDTRGQVL  741 (742)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-hhHHHHHHHHHHHHHHHHHHHh-CCCCccccc
Confidence            9999999999999999999999999999988775 4556777777777776666554 499987653



This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.

>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG3097 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3880 consensus Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11947 DUF3464: Protein of unknown function (DUF3464); InterPro: IPR021855 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF02990 EMP70: Endomembrane protein 70; InterPro: IPR004240 The transmembrane 9 superfamily protein (TM9SF) may function as a channel or small molecule transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.91
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.9
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.9
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.87
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.86
2xut_A 524 Proton/peptide symporter family protein; transport 99.83
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.82
2cfq_A417 Lactose permease; transport, transport mechanism, 99.8
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.78
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.77
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.63
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.54
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.47
2xut_A524 Proton/peptide symporter family protein; transport 99.28
2g9p_A26 Antimicrobial peptide latarcin 2A; helix-hinge-hel 81.83
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.91  E-value=3.5e-23  Score=165.65  Aligned_cols=184  Identities=15%  Similarity=0.049  Sum_probs=157.5

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCccccccCCCCchhhHHHHHHHHhhhhhHHHHHHHHHhhhch
Q 026854           25 RKLIRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGR  104 (232)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~gr  104 (232)
                      +..++.+....+..+......+......|.+.++.            .+..+.++..+...++..++.++.|+++||+||
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~s~~~~g~~~~~~~~~~~~~~~~~G~l~dr~g~   91 (451)
T 1pw4_A           24 RLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQG------------FSRGDLGFALSGISIAYGFSKFIMGSVSDRSNP   91 (451)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTSHHHHHHHTTSST------------TCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh------------ccHhHHHHHHHHHHHHHHHHHHhHHHHHHhcCc
Confidence            34455566666666666666666777788776432            456778899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHh----hhhHHHHHHHHHHHHHHHhhhhhhhhhccccccccchhhhhhHHHHHhhhhhhchh
Q 026854          105 KLSMVLMFVLACIFLLPLVF----HQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVC  180 (232)
Q Consensus       105 r~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~e~~p~~~r~~~~~~~~~~~~~g~~~~  180 (232)
                      |++++++..+.+++.+...+    .++.+.+++.+++.|++.+...+...++++|++|+++|+++.++.+....+|..++
T Consensus        92 r~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g  171 (451)
T 1pw4_A           92 RVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIP  171 (451)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSH
T ss_pred             hHHHHHHHHHHHHHHHHHHhhhhccccHHHHHHHHHHHHHHhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHH
Confidence            99999999999999999988    88888999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhccc-hhHHHHHHHHHHHHHHHHHhcccccccC
Q 026854          181 PLVAVGLVTSCH-LRLAVILFEVVFVLAIASSLLFPFETKG  220 (232)
Q Consensus       181 ~~i~~~l~~~~g-~~~~~~~~~~~~~~~~~~~~~~~~e~~~  220 (232)
                      |.+++++.+..| |+..+++.+++.++..+..++..||+++
T Consensus       172 ~~~~~~l~~~~g~w~~~f~~~~~~~~~~~~~~~~~~~~~~~  212 (451)
T 1pw4_A          172 PLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQ  212 (451)
T ss_dssp             HHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSST
T ss_pred             HHHHHHHHHHhccHHHHHHHHHHHHHHHHHHHHhhccCCHh
Confidence            999999889888 9999999888887777666666676543



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2g9p_A Antimicrobial peptide latarcin 2A; helix-hinge-helix, antimicrobial protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1pw4a_447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 1e-06
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 46.6 bits (109), Expect = 1e-06
 Identities = 20/125 (16%), Positives = 41/125 (32%), Gaps = 1/125 (0%)

Query: 101 KIGRKLSMVLMFVLACIFLLPLVFHQSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTS 160
             G      +  V     +  +    +  V  + +  +     G + +  ++A E+ P  
Sbjct: 316 NRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIGLHALELAPKK 375

Query: 161 ARTTGAGVASAVGRVGGMVC-PLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETK 219
           A  T AG     G +GG V    +    V         ++     +LA+   ++     K
Sbjct: 376 AAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVVMIGEK 435

Query: 220 GRELK 224
            R  +
Sbjct: 436 RRHEQ 440


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.88
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.81
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.79
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.65
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.88  E-value=5.1e-22  Score=156.49  Aligned_cols=179  Identities=15%  Similarity=0.050  Sum_probs=143.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCccccccCCCCchhhHHHHHHHHhhhhhHHHHHHHHHhhhchHHH
Q 026854           28 IRTTVLLWVLFFANAFSYYGAVLLTSKLSSGDSKCGSKVLHADKSKDNSLYVDVFITSFAELPGLILSAIIVDKIGRKLS  107 (232)
Q Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~grr~~  107 (232)
                      |+.+..+++.++........+....|.. ++.+           .+.++.++..+...++..++.+++|+++||+|||++
T Consensus        24 w~i~~~~~~~~~~~~~~~~~~~~~~p~~-~~~g-----------~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~   91 (447)
T d1pw4a_          24 WQIFLGIFFGYAAYYLVRKNFALAMPYL-VEQG-----------FSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVF   91 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSHHHHHHHT-TSST-----------TCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhC-----------cCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHH
Confidence            3334434444444444444555666744 4454           899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhh----hhHHHHHHHHHHHHHHHhhhhhhhhhccccccccchhhhhhHHHHHhhhhhhchhHHH
Q 026854          108 MVLMFVLACIFLLPLVFH----QSAVVTTVLLFGVRMCATGTITVATIYAPEIYPTSARTTGAGVASAVGRVGGMVCPLV  183 (232)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~g~~~~~~~~~~~~~~~e~~p~~~r~~~~~~~~~~~~~g~~~~~~i  183 (232)
                      +.++.++..++.+.....    ++.+.+.+.+++.|++.+...+....+++|++|+++|++++++.+....+|..++|.+
T Consensus        92 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~  171 (447)
T d1pw4a_          92 LPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLL  171 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHH
T ss_pred             HHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhh
Confidence            999999998888877663    3566788889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcc-chhHHHHHHHHHHHHHHHHHhcccccc
Q 026854          184 AVGLVTSC-HLRLAVILFEVVFVLAIASSLLFPFET  218 (232)
Q Consensus       184 ~~~l~~~~-g~~~~~~~~~~~~~~~~~~~~~~~~e~  218 (232)
                      .+.+.+.. +|+..+++.+.+..+..++.+...+|+
T Consensus       172 ~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~  207 (447)
T d1pw4a_         172 FLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDT  207 (447)
T ss_dssp             HHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCS
T ss_pred             hhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccc
Confidence            88877654 678778887777777766666665554



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure