Citrus Sinensis ID: 026891

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MRRSLTSLVRPLTATRGFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
ccccccccccccccccccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccEEEEEEccccccccccccEEEEEEEEEEccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHcc
cccHHHHHcccHHccccccccHHHHHEEEEEcccccEcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccHccccccccHHHHHHcccEEEEEEEcccccccccccEEcccccccccccHHHHHHHHHHHHHccccEEEEEccccEEEEEEccccccccccccEEEEEEEEEEccccccccccccEEEEcHHHHHHHccHHHHHHHHHHHc
mrrsltslvrpltatrgfstnSEKIVASVLFErlpvvipkidpvVYAFQEFSFRWRQQYrrrypdefldksnsrgkgdyqmeyvpapritetdktnDRKSLQRALDRRLYLILYgetfgapggkpiwhfpekvyesEESLRKCAECALQSVlgdlshtyfvgnapmghmvmqpaekmpdvpsykqfFFKSQVIasnkftigkcedfVWVTKDELMEYFPESAEFLNKMIIS
mrrsltslvrpltatrgfstnseKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYpdefldksnsrgkgdyqmeyvpapritetdktndrkSLQRALDRRLYLILYGEtfgapggkpIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFpesaeflnkmiis
MRRSLTSLVRPLTATRGFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
****************GFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDE*************************************ALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQ******DVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLN*****
************************IVASVLFERLPVVIPKIDPVVYAFQEFS***********************************RITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
MRRSLTSLVRPLTATRGFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITET*********QRALDRRLYLILYGETFGAPGGKPIWHFPEKV********KCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
******************STNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEFLDKSNSRG****QMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRSLTSLVRPLTATRGFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
Q5RBU2279 39S ribosomal protein L46 yes no 0.580 0.480 0.357 7e-16
Q9H2W6279 39S ribosomal protein L46 yes no 0.580 0.480 0.357 9e-16
Q9EQI8283 39S ribosomal protein L46 yes no 0.580 0.473 0.335 1e-14
Q5RK00277 39S ribosomal protein L46 yes no 0.580 0.483 0.335 1e-14
Q3SZ22277 39S ribosomal protein L46 yes no 0.580 0.483 0.314 3e-13
P36528281 54S ribosomal protein L17 yes no 0.623 0.512 0.317 2e-12
O94398268 54S ribosomal protein L17 yes no 0.558 0.481 0.267 3e-06
>sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 74/140 (52%), Gaps = 6/140 (4%)

Query: 81  MEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESL 140
           +++    RITE D+ NDR SL R LDR L L++  E FG    + +W  P+  ++  E+L
Sbjct: 129 LQFKLGARITEADEKNDRTSLNRKLDRNLVLLVR-EKFG---DQDVWILPQTEWQPGETL 184

Query: 141 RKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSY--KQFFFKSQVIASNKF 198
           R  AE  L ++  +     F+GNAP GH   +  + M    +   K FFFK+ ++  +  
Sbjct: 185 RGTAERTLATLSENNMEAKFLGNAPCGHYTFKFPQAMRTESNLGAKVFFFKALLLTGDFS 244

Query: 199 TIGKCEDFVWVTKDELMEYF 218
             G     VWVTKDEL +Y 
Sbjct: 245 QAGNKGHHVWVTKDELGDYL 264

Pongo abelii (taxid: 9601)
>sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 Back     alignment and function description
>sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=2 SV=1 Back     alignment and function description
>sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 Back     alignment and function description
>sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 Back     alignment and function description
>sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 Back     alignment and function description
>sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
255541722284 DECOY, putative [Ricinus communis] gi|22 0.995 0.809 0.800 1e-109
357519099279 39S ribosomal protein L46 [Medicago trun 0.995 0.824 0.791 1e-107
359489811 977 PREDICTED: uncharacterized protein LOC10 0.995 0.235 0.774 1e-106
147841418253 hypothetical protein VITISV_006167 [Viti 1.0 0.913 0.771 1e-105
297745332232 unnamed protein product [Vitis vinifera] 1.0 0.995 0.771 1e-105
356532249228 PREDICTED: 39S ribosomal protein L46, mi 0.974 0.986 0.808 1e-100
356555696230 PREDICTED: 39S ribosomal protein L46, mi 0.995 1.0 0.792 1e-100
356560707228 PREDICTED: 39S ribosomal protein L46, mi 0.974 0.986 0.804 1e-100
255645398228 unknown [Glycine max] 0.974 0.986 0.804 3e-99
255638452230 unknown [Glycine max] 0.995 1.0 0.787 3e-99
>gi|255541722|ref|XP_002511925.1| DECOY, putative [Ricinus communis] gi|223549105|gb|EEF50594.1| DECOY, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 206/231 (89%), Gaps = 1/231 (0%)

Query: 1   MRRSLTSLVRPLTATRGFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYR 60
           MR SL  L RP+  TRGF T  EKIVASVLFERLPVV+PKIDPVVYAFQEFSFRW+QQYR
Sbjct: 55  MRCSLMRLARPVVTTRGFCTKPEKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWQQQYR 114

Query: 61  RRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGA 120
           RRYPDEFLDK+N+RG+GDYQ++YVPAPRITE DKTND KSLQRALDRRLYL+LYG  +G+
Sbjct: 115 RRYPDEFLDKANARGQGDYQIDYVPAPRITEADKTNDTKSLQRALDRRLYLVLYGNAYGS 174

Query: 121 PGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDV 180
           P  KP+WHFP+K+YE+E++LRKCAE ALQSVLGDLSHTYFVGNAPMGHMV+QP +  PD 
Sbjct: 175 PSKKPVWHFPQKLYEAEDTLRKCAESALQSVLGDLSHTYFVGNAPMGHMVIQPTDTAPDA 234

Query: 181 PSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS 231
             YKQFFFKSQVIA+NKF IGKCEDF WVTKDEL+EYFPE AEFLNKMIIS
Sbjct: 235 -GYKQFFFKSQVIATNKFRIGKCEDFSWVTKDELLEYFPEQAEFLNKMIIS 284

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357519099|ref|XP_003629838.1| 39S ribosomal protein L46 [Medicago truncatula] gi|355523860|gb|AET04314.1| 39S ribosomal protein L46 [Medicago truncatula] Back     alignment and taxonomy information
>gi|359489811|ref|XP_002275559.2| PREDICTED: uncharacterized protein LOC100262014 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147841418|emb|CAN73362.1| hypothetical protein VITISV_006167 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745332|emb|CBI40412.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532249|ref|XP_003534686.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356555696|ref|XP_003546166.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356560707|ref|XP_003548630.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|255645398|gb|ACU23195.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255638452|gb|ACU19535.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
TAIR|locus:2204533233 DECOY "AT1G14620" [Arabidopsis 0.995 0.987 0.709 1.5e-90
DICTYBASE|DDB_G0290311361 DDB_G0290311 "54S ribosomal pr 0.796 0.509 0.325 3.9e-21
SGD|S000005196281 MRPL17 "Mitochondrial ribosoma 0.623 0.512 0.329 8.1e-19
UNIPROTKB|Q9H2W6279 MRPL46 "39S ribosomal protein 0.575 0.476 0.359 2.1e-18
UNIPROTKB|E1C892279 MRPL46 "Uncharacterized protei 0.614 0.508 0.353 4.6e-18
ZFIN|ZDB-GENE-040718-224286 mrpl46 "mitochondrial ribosoma 0.619 0.5 0.350 3.7e-17
CGD|CAL0000338283 orf19.585 [Candida albicans (t 0.753 0.614 0.306 9.3e-17
UNIPROTKB|Q59X93283 MRPL17 "Likely mitochondrial r 0.753 0.614 0.306 9.3e-17
UNIPROTKB|E2R6F9280 MRPL46 "Uncharacterized protei 0.575 0.475 0.352 1.4e-16
UNIPROTKB|F6XH70299 MRPL46 "Uncharacterized protei 0.575 0.444 0.352 1.4e-16
TAIR|locus:2204533 DECOY "AT1G14620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 903 (322.9 bits), Expect = 1.5e-90, P = 1.5e-90
 Identities = 164/231 (70%), Positives = 196/231 (84%)

Query:     2 RRSLTSLVRPLTATR-GFSTNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYR 60
             R SL  L +PL  +R GF T+S+KIVASVLFERL VVIPK DP VYAFQEF F W+QQ+R
Sbjct:     3 RSSLRLLAKPLLESRRGFCTSSDKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFR 62

Query:    61 RRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGA 120
             RRYPDEFLD + +R KG+YQM+YVPAPRITE DK NDRKSL RALD++LYL+++G+ FGA
Sbjct:    63 RRYPDEFLDIAKNRAKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGA 122

Query:   121 PGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDV 180
                KP+WHFPEKVY+SE +LRKCAE AL+SV+GDL+HTYFVGNAPM HM +QP E+MPD+
Sbjct:   123 TSDKPVWHFPEKVYDSEPTLRKCAESALKSVVGDLTHTYFVGNAPMAHMAIQPTEEMPDL 182

Query:   181 PSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYFPESAEFLNKMIIS 231
             PSYK+FFFK  V+A++K+ I  CEDFVWVTKDEL+E+FPE AEF NKMIIS
Sbjct:   183 PSYKRFFFKCSVVAASKYDISNCEDFVWVTKDELLEFFPEQAEFFNKMIIS 233
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
GO:0009909 "regulation of flower development" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
DICTYBASE|DDB_G0290311 DDB_G0290311 "54S ribosomal protein L17, mitochondrial" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000005196 MRPL17 "Mitochondrial ribosomal protein of the large subunit" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2W6 MRPL46 "39S ribosomal protein L46, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C892 MRPL46 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-224 mrpl46 "mitochondrial ribosomal protein L46" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
CGD|CAL0000338 orf19.585 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59X93 MRPL17 "Likely mitochondrial ribosomal protein MRPL17p" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6F9 MRPL46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XH70 MRPL46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
cd04661132 cd04661, MRP_L46, Mitochondrial ribosomal protein 6e-20
pfam11788121 pfam11788, MRP-L46, 39S mitochondrial ribosomal pr 4e-07
>gnl|CDD|240019 cd04661, MRP_L46, Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information 
 Score = 82.0 bits (203), Expect = 6e-20
 Identities = 41/127 (32%), Positives = 62/127 (48%), Gaps = 6/127 (4%)

Query: 96  NDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDL 155
           NDRKSL R LD  L L++  +     G +  W  P+   E  E+LR+ AE  L+ + G+ 
Sbjct: 1   NDRKSLDRKLDDTLVLLVQQKV----GSQNHWILPQGKREEGETLRQTAERTLKELCGNN 56

Query: 156 SHTYFVGNAPMGHMVMQ--PAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDE 213
               F GNAP+G    +   A +   +   K FFFK++ ++          DF W+ K+E
Sbjct: 57  LKAKFYGNAPVGFYKYKYPKAVRNEGIVGAKVFFFKARYMSGQFELSQNQVDFKWLAKEE 116

Query: 214 LMEYFPE 220
           L +Y   
Sbjct: 117 LQKYLNP 123

MRPs are thought to be involved in the maintenance of the mitochondrial DNA. In general, members of the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for activity and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. MRP L46 appears to contain a modified nudix motif. Length = 132
>gnl|CDD|221223 pfam11788, MRP-L46, 39S mitochondrial ribosomal protein L46 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
KOG4548263 consensus Mitochondrial ribosomal protein L17 [Tra 100.0
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 100.0
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.75
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.74
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.72
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.7
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.68
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.68
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.67
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.67
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.67
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.67
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.66
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.66
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.66
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.66
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.66
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.64
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.64
PLN02325144 nudix hydrolase 99.64
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.64
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.64
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.63
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.63
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.63
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.62
PF11788111 MRP-L46: 39S mitochondrial ribosomal protein L46 ; 99.62
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.62
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.61
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.61
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.61
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.61
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.6
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.6
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.6
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.6
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.6
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.59
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.59
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.59
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.59
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.58
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.57
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.57
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.56
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.56
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.55
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.55
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.55
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.53
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.53
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.53
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.53
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.52
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.51
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.48
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.48
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.48
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.47
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.45
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.42
PRK08999 312 hypothetical protein; Provisional 99.41
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.41
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.38
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.35
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.35
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.34
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.31
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.27
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.27
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 99.22
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.21
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.2
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.17
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.16
PRK10707190 putative NUDIX hydrolase; Provisional 99.11
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 99.08
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.05
PLN02709222 nudix hydrolase 98.98
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.9
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 98.85
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.69
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.66
PLN02552247 isopentenyl-diphosphate delta-isomerase 98.61
PLN03143291 nudix hydrolase; Provisional 98.52
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 98.51
PLN02791 770 Nudix hydrolase homolog 98.47
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.46
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 97.89
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 97.85
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 97.49
KOG4195275 consensus Transient receptor potential-related cha 97.3
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 96.95
PLN02839372 nudix hydrolase 96.92
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 96.69
KOG2937 348 consensus Decapping enzyme complex, predicted pyro 95.52
PRK10880350 adenine DNA glycosylase; Provisional 94.55
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 93.75
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 93.56
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 84.49
PRK13910289 DNA glycosylase MutY; Provisional 83.46
>KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=8.5e-45  Score=309.00  Aligned_cols=209  Identities=39%  Similarity=0.617  Sum_probs=167.9

Q ss_pred             cCCCcceEEEEEEeecCccCCCCCHHHHHHHHHHHHHHH-----------------------HHH--ccCCcccccccCc
Q 026891           19 STNSEKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQ-----------------------QYR--RRYPDEFLDKSNS   73 (231)
Q Consensus        19 ~~~~~~i~~av~l~R~Pvv~~~~~~~E~~~~~~~~~~~~-----------------------~~~--~~~~~~~~~~~~~   73 (231)
                      |+.+|+|+|+|+|+|+|||+++||++|+.|+.++.+..+                       +++  ...+|+++.....
T Consensus        22 ss~p~~~~~gvll~R~Pvv~~~~se~EK~~~~ll~e~e~e~sl~~dhel~~~qe~~~~~~q~~~~~e~~~eDe~~~i~~~  101 (263)
T KOG4548|consen   22 SSQPWKIFAGVLLSRLPVVAPPLSELEKRFYSLLMELEQEKSLKPDHELKAFQEEKEKAWQAQLRKEVDEEDEFIGITAN  101 (263)
T ss_pred             CCCchhhhHHhhhhhcccccCCCCHHHHHHHHHHHHHHHHhccCCcHHHHHHHHHHHHHHHHHHHHhhcccchhhHHHHH
Confidence            446699999999999999999999999999999744322                       111  2233444333322


Q ss_pred             CCCCcc---cCCCCCCCCCCcccccCCCcchhhhcCCcEEEEEeccCCCCCCCCCceecCceec-CCCCCHHHHHHHHHH
Q 026891           74 RGKGDY---QMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETFGAPGGKPIWHFPEKVY-ESEESLRKCAECALQ  149 (231)
Q Consensus        74 ~~~~~~---~~~~~p~~r~T~aD~~~d~~Sl~R~L~~~l~LLVkr~~~g~~~~~~~W~FP~G~v-e~gEtl~qaA~Rel~  149 (231)
                      ..++++   ..+|+-..|+||||.+||++||+|+||++|||||+++ .|   ..+.|.||.+.+ +.|+|++.+|+|+|+
T Consensus       102 ~~kd~~~~~~~~~~~~~RiTEaD~kNd~kSl~R~Ldr~LyLLV~~k-~g---~~s~w~fP~~~~s~~~~~lr~~ae~~Lk  177 (263)
T KOG4548|consen  102 DRKDMWKKDLLDFDLPFRITEADPKNDRKSLERELDRKLYLLVKRK-FG---KSSVWIFPNRQFSSSEKTLRGHAERDLK  177 (263)
T ss_pred             HHHHHHHHHhhcccccccccCCCcccchhHHHHHhcceEEEEEeec-cC---ccceeeCCCcccCCccchHHHHHHHHHH
Confidence            223333   3344444499999999999999999999999999965 44   678999999999 999999999999999


Q ss_pred             HHhCCCeeEEEecccceEEEEecCCCCCCC--CCceEEEEEEEEEeCCcccccCcccceeeecHHhhcccC-cchHHHHH
Q 026891          150 SVLGDLSHTYFVGNAPMGHMVMQPAEKMPD--VPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDELMEYF-PESAEFLN  226 (231)
Q Consensus       150 Ee~G~~i~v~~vg~~P~g~~~y~~~~~~~~--~~g~kvfff~a~~~~G~~~~~~e~~d~~Wvt~eEl~~~~-p~~~~~v~  226 (231)
                      ..+|.++.+||+||+|||++.|++|.....  .+|.++|||+|.++.|+..-.....||.|||++||.+++ +.++..++
T Consensus       178 ~~~ge~~~t~fvgnaP~g~~~~q~pr~~~~e~~~~sk~ff~k~~lv~~~~~kn~n~edfvWvTkdel~e~l~~~~~~~vK  257 (263)
T KOG4548|consen  178 VLSGENKSTWFVGNAPFGHTPLQSPREMTTEEPVSSKVFFFKASLVANSNQKNQNKEDFVWVTKDELGEKLPKFAKAQVK  257 (263)
T ss_pred             HHhcchhhhheeccCccccccccCcccccccccccceeEEeeeeeccccchhcccccceEEechHHHhhhcchHHHHhhh
Confidence            999999999999999999999999877643  468999999999999976544467799999999999999 56666666


Q ss_pred             hhhcC
Q 026891          227 KMIIS  231 (231)
Q Consensus       227 ~~l~~  231 (231)
                      .||.|
T Consensus       258 ~ilsD  262 (263)
T KOG4548|consen  258 HILSD  262 (263)
T ss_pred             hhccC
Confidence            66554

>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF11788 MRP-L46: 39S mitochondrial ribosomal protein L46 ; InterPro: IPR021757 This is the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.5 bits (104), Expect = 2e-05
 Identities = 30/244 (12%), Positives = 74/244 (30%), Gaps = 73/244 (29%)

Query: 3   RSLTSLVRPLTATR--------GFST-NSEKIVASVL---FERLPVVIPKIDPVVYA--- 47
           + +T  +   T T           +    + ++   L    + LP  +   +P   +   
Sbjct: 275 KQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIA 334

Query: 48  --FQEFSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRAL 105
              ++    W   ++                      +V   ++T   ++     L+ A 
Sbjct: 335 ESIRDGLATW-DNWK----------------------HVNCDKLTTIIES-SLNVLEPAE 370

Query: 106 DRRLYLILYGETFGAPGGKPIWHFPEKV----------YESEESLRKCAECALQSVLGDL 155
            R+++  L    F  P    I   P  +           +    + K  + +L  V    
Sbjct: 371 YRKMFDRL--SVF--PPSAHI---PTILLSLIWFDVIKSDVMVVVNKLHKYSL--VEKQP 421

Query: 156 -SHTYFVGNAPMGHMVMQPAEKMPDVPSYKQFFFKSQVIASNKFTIGKCEDFVWVTKDEL 214
              T  +   P  ++ ++   K+ +  +  +      ++  + + I K  D   +    L
Sbjct: 422 KESTISI---PSIYLELK--VKLENEYALHR-----SIV--DHYNIPKTFDSDDLIPPYL 469

Query: 215 MEYF 218
            +YF
Sbjct: 470 DQYF 473

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.85
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.75
3grn_A153 MUTT related protein; structural genomics, hydrola 99.75
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.74
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.74
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.74
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.74
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.74
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.71
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.7
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.7
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.7
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.7
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.7
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.7
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.69
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.68
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.68
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.68
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.68
3exq_A161 Nudix family hydrolase; protein structure initiati 99.68
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.68
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.67
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.67
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.67
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.66
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.66
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.65
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.64
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.64
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.63
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.63
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.63
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.61
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.6
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.6
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.59
3f13_A163 Putative nudix hydrolase family member; structural 99.59
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.59
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.58
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.58
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.57
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.56
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.55
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.55
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.55
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.54
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.54
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.52
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.52
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.51
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.5
2fb1_A226 Conserved hypothetical protein; structural genomic 99.5
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.5
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.49
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.48
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.48
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.48
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.46
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.45
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.44
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.43
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.41
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.4
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.37
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.36
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.34
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.33
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.32
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.23
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.23
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.08
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 99.04
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 99.01
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 98.87
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.8
3bho_A208 Cleavage and polyadenylation specificity factor su 98.5
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
Probab=99.85  E-value=2.5e-21  Score=151.84  Aligned_cols=111  Identities=13%  Similarity=0.108  Sum_probs=86.2

Q ss_pred             CcEEEEEeccCCCCCCCCCceecCceecCCCCCHHHHHHHHHHHHhCCCeeEEEecccceEEEEecCCCCCCCCCceEEE
Q 026891          107 RRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQF  186 (231)
Q Consensus       107 ~~l~LLVkr~~~g~~~~~~~W~FP~G~ve~gEtl~qaA~Rel~Ee~G~~i~v~~vg~~P~g~~~y~~~~~~~~~~g~kvf  186 (231)
                      ++.+||++++       .|.|.||||++++|||+.+||.||++||||+++.+.    .+++.+.|.++... ......++
T Consensus        14 ~~~vLL~~r~-------~g~W~~PgG~ve~gEt~~~aa~RE~~EEtGl~~~~~----~~l~~~~~~~~~~~-~~~~~~~~   81 (134)
T 3i7u_A           14 DGEVLLIKTP-------SNVWSFPKGNIEPGEKPEETAVREVWEETGVKGEIL----DYIGEIHYWYTLKG-ERIFKTVK   81 (134)
T ss_dssp             TTEEEEEECT-------TSCEECCEEECCTTCCHHHHHHHHHHHHHSEEEEEE----EEEEEEEEEEEETT-EEEEEEEE
T ss_pred             CCEEEEEEeC-------CCcEECCeeEecCCCCHHHHHHHHHHHhcCceEEEe----eeeeeeeEEecCCC-ceEEEEEE
Confidence            4579999875       478999999999999999999999999999987753    23444444332211 12235678


Q ss_pred             EEEEEEeCCcccccCcccceeeecHHhhcccC--cchHHHHHhhh
Q 026891          187 FFKSQVIASNKFTIGKCEDFVWVTKDELMEYF--PESAEFLNKMI  229 (231)
Q Consensus       187 ff~a~~~~G~~~~~~e~~d~~Wvt~eEl~~~~--p~~~~~v~~~l  229 (231)
                      ||.|...+|++.+++++.+++|++.+|+.+++  |.+...+.+++
T Consensus        82 ~f~~~~~~~~~~~~~E~~~~~W~~~~e~~~~l~~~~~r~il~~a~  126 (134)
T 3i7u_A           82 YYLMKYKEGEPRPSWEVKDAKFFPIKEAKKLLKYKGDKEIFEKAL  126 (134)
T ss_dssp             EEEEEEEEECCCCCTTSSEEEEEEHHHHHHHBCSHHHHHHHHHHH
T ss_pred             EEEEEEcCCcCcCChhheEEEEEEHHHHhhhcCChHHHHHHHHHH
Confidence            99999999988877789999999999999987  66777776654
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.81
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.79
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.74
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.73
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.72
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.72
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.72
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.71
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.69
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.68
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.68
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.67
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.67
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.63
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.58
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.58
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.57
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.56
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.49
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.49
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.47
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.44
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.36
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.35
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.3
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.26
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.23
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.06
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 99.05
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.76
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]

Probab=99.81  E-value=1.4e-19  Score=138.49  Aligned_cols=107  Identities=18%  Similarity=0.204  Sum_probs=82.5

Q ss_pred             CcEEEEEeccCCCCCCCCCceecCceecCCCCCHHHHHHHHHHHHhCCCeeEEEecccceEEEEecCCCCCCCCCceEEE
Q 026891          107 RRLYLILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSVLGDLSHTYFVGNAPMGHMVMQPAEKMPDVPSYKQF  186 (231)
Q Consensus       107 ~~l~LLVkr~~~g~~~~~~~W~FP~G~ve~gEtl~qaA~Rel~Ee~G~~i~v~~vg~~P~g~~~y~~~~~~~~~~g~kvf  186 (231)
                      ++.+||++++       .|.|.||||+++.|||+.+||.||++||||+++...    .+++.+.|.++..    ....++
T Consensus        13 ~~~vLl~~~~-------~g~w~~PgG~ve~gEt~~~aa~RE~~EEtGi~~~~~----~~~~~~~~~~~~~----~~~~~~   77 (126)
T d1vcda1          13 KREVLLLRDR-------MGFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVL----LPLYPTRYVNPKG----VEREVH   77 (126)
T ss_dssp             TSCEEEEECT-------TSCEECCEECCCTTCCHHHHHHHHHHHHHCCEEEEE----EEEEEEEEECTTS----CEEEEE
T ss_pred             CCEEEEEEcC-------CCCEECCccccCCCCCHHHHHHHHHHHHcCCeeEEE----EEEeeeeeccCCC----eEEEEE
Confidence            3468888864       478999999999999999999999999999987753    2355555555443    235678


Q ss_pred             EEEEEEeCCcccccCcccceeeecHHhhcccC--cchHHHHHhhh
Q 026891          187 FFKSQVIASNKFTIGKCEDFVWVTKDELMEYF--PESAEFLNKMI  229 (231)
Q Consensus       187 ff~a~~~~G~~~~~~e~~d~~Wvt~eEl~~~~--p~~~~~v~~~l  229 (231)
                      ||.+... +.+.+.+++.+++|++.+|+.+++  |.+..+++.++
T Consensus        78 ~~~~~~~-~~~~~~~e~~~~~W~~~~e~~~~~~~~~~~~il~~~~  121 (126)
T d1vcda1          78 WFLMRGE-GAPRLEEGMTGAGWFSPEEARALLAFPEDLGLLEVAL  121 (126)
T ss_dssp             EEEEEEE-SCCCCCTTCCEEEEECHHHHHHHBCSHHHHHHHHHHH
T ss_pred             EEEEEEc-CCCCCCccceEEEEEEHHHHhhccCChHHHHHHHHHH
Confidence            8888765 555555689999999999999877  77777776543
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure