Citrus Sinensis ID: 026892

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-

MLMTSSISSSSLRTSPSSLLPCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNRTAVDVASPLPTTSNVDGDDGGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL

cccccccccccccccccccccccccccccccccccccccccccHHHHHccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHcccccEEEccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEEEEEccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcHHHHccc

cccEEcccccccccccccccccccEEEEEEccccccccccccccccccccccccEEEEcccccccEEEEccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHccccEEEccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEEEccccccccccEEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcHHHHHHc

mlmtssisssslrtspssllpclnqttfsysnstisshfistpttrkrlaplsklrisssennrtavdvasplpttsnvdgddgggAVVVRRFYAGINGRDLASVEELIAddcvyedlifprpflgrkaTLDFFKKFSDSISSDLQFVIDdisaedssavgvtwhlewkgkpfpfskgcsfyklevvngkrqitygrdivepafkpgeTALAAIGAVTWLLQQFPQLADRL

mlmtssisssslrtspssllPCLNQTTFSYSNSTisshfistpttrkrLAPLSKlrisssennrtavdvasplpttsnvdgddgggAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL

mlmtssisssslrtspssllpCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNRTAVDVASPLPTTSNvdgddgggavvvRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLdffkkfsdsissdLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL

*********************CL**TTF********************************************************GGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFP******

************************QTTF************************************************************VVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQL**R*

*****************SLLPCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNRTAVDVASPLPTTSNVDGDDGGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL

******I*SSSLRTSPSSLLPCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNRTAVDVASP***********GGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		231
225460141		226	PREDICTED: uncharacterized protein LOC10	0.939	0.960	0.6	8e-69
255574237		218	protein transporter, putative [Ricinus c	0.792	0.839	0.638	4e-64
224146286		164	predicted protein [Populus trichocarpa]	0.709	1.0	0.698	4e-63
449450034		218	PREDICTED: uncharacterized protein LOC10	0.831	0.880	0.666	9e-63
356495768		221	PREDICTED: uncharacterized protein LOC10	0.766	0.800	0.646	3e-62
449483825		218	PREDICTED: uncharacterized LOC101216887	0.831	0.880	0.661	3e-62
356539020		227	PREDICTED: uncharacterized protein LOC10	0.632	0.643	0.739	2e-61
15217513		216	nuclear transport factor 2-like protein	0.619	0.662	0.755	5e-60
294461593		233	unknown [Picea sitchensis]	0.619	0.613	0.706	4e-57
224135761		150	predicted protein [Populus trichocarpa]	0.619	0.953	0.671	2e-53

>gi\|225460141\|ref\|XP_002275923.1\| PREDICTED: uncharacterized protein LOC100243104 isoform 1 [Vitis vinifera] gi\|359495234\|ref\|XP_003634940.1\| PREDICTED: uncharacterized protein LOC100243104 isoform 2 [Vitis vinifera] gi\|297741015\|emb\|CBI31327.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  265 bits (678), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 170/235 (72%), Gaps = 18/235 (7%)

Query: 5   SSISSSSLRTSPSSLLPCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNR 64
           S +++S+    PS L P L         ++I++HF     T++R    + LR+SSS  N 
Sbjct: 2   SLLTNSTTLLRPSKLSPPL----LHPHTASIATHF-----TQRRSRRCNLLRVSSSPQNP 52

Query: 65  TAVDVASPLPTTSNVDGD-DGG-------GAVVVRRFYAGINGRDLASVEELIADDCVYE 116
           TA  +A P+ TT + + + DGG       G+ VVR FYAGIN  DL SVEELIA +CVYE
Sbjct: 53  TAT-IAEPVTTTQSDEANGDGGDESILLSGSSVVRAFYAGINSHDLDSVEELIAHNCVYE 111

Query: 117 DLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLEWKGKPFPFS 176
           DLIFP+PF+GRKA +DFF KF D+IS +LQFVIDDIS  DSSAVGVTWHLEWKG+PFPFS
Sbjct: 112 DLIFPQPFVGRKAIMDFFNKFIDTISMELQFVIDDISEADSSAVGVTWHLEWKGRPFPFS 171

Query: 177 KGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALAAIGAVTWLLQQFPQLADRL 231
           KGCSFY+LEV+NGKRQI YGRD VEP FKPGETAL AI  V WLLQ+FP+LAD L
Sbjct: 172 KGCSFYRLEVLNGKRQIIYGRDSVEPFFKPGETALVAIRGVAWLLQRFPKLADWL 226

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255574237\|ref\|XP_002528033.1\| protein transporter, putative [Ricinus communis] gi\|223532563\|gb\|EEF34351.1\| protein transporter, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224146286\|ref\|XP_002325950.1\| predicted protein [Populus trichocarpa] gi\|222862825\|gb\|EEF00332.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449450034\|ref\|XP_004142769.1\| PREDICTED: uncharacterized protein LOC101216887 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356495768\|ref\|XP_003516745.1\| PREDICTED: uncharacterized protein LOC100802494 [Glycine max]	Back alignment and taxonomy information

>gi\|449483825\|ref\|XP_004156703.1\| PREDICTED: uncharacterized LOC101216887 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356539020\|ref\|XP_003537998.1\| PREDICTED: uncharacterized protein LOC100813246 [Glycine max]	Back alignment and taxonomy information

>gi|15217513|ref|NP_177304.1| nuclear transport factor 2-like protein [Arabidopsis thaliana] gi|12323719|gb|AAG51815.1|AC016163_4 unknown protein; 43994-42987 [Arabidopsis thaliana] gi|37202096|gb|AAQ89663.1| At1g71480 [Arabidopsis thaliana] gi|51969762|dbj|BAD43573.1| unknown protein [Arabidopsis thaliana] gi|51969880|dbj|BAD43632.1| unknown protein [Arabidopsis thaliana] gi|51971487|dbj|BAD44408.1| unknown protein [Arabidopsis thaliana] gi|51971841|dbj|BAD44585.1| unknown protein [Arabidopsis thaliana] gi|51971939|dbj|BAD44634.1| unknown protein [Arabidopsis thaliana] gi|222423003|dbj|BAH19485.1| AT1G71480 [Arabidopsis thaliana] gi|332197085|gb|AEE35206.1| nuclear transport factor 2-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|294461593\|gb\|ADE76357.1\| unknown [Picea sitchensis]	Back alignment and taxonomy information

>gi\|224135761\|ref\|XP_002327297.1\| predicted protein [Populus trichocarpa] gi\|222835667\|gb\|EEE74102.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		231
TAIR\|locus:2825304		216	AT1G71480 [Arabidopsis thalian	0.597	0.638	0.710	4.6e-50
TAIR\|locus:2177906		277	AT5G41470 "AT5G41470" [Arabido	0.597	0.498	0.311	3.9e-21

TAIR\|locus:2825304 AT1G71480 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 521 (188.5 bits), Expect = 4.6e-50, P = 4.6e-50
 Identities = 98/138 (71%), Positives = 109/138 (78%)

Query:    93 FYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLXXXXXXXXXXXXXLQFVIDDI 152
             FYA +N  DL+SV +LIA DCVYEDL+F  PF+GRKA L             LQFVIDDI
Sbjct:    78 FYAAVNVHDLSSVTDLIAQDCVYEDLVFSSPFVGRKAILDFFGKFIESTSTDLQFVIDDI 137

Query:   153 SAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPAFKPGETALA 212
             S EDSSAVGV+WHLEWKGK FPFSKGCSFY+LEV++GKRQI YGRD VEPA KPGET LA
Sbjct:   138 STEDSSAVGVSWHLEWKGKNFPFSKGCSFYRLEVIDGKRQIVYGRDCVEPAIKPGETVLA 197

Query:   213 AIGAVTWLLQQFPQLADR 230
             AI  VTWLLQ+FPQLAD+
Sbjct:   198 AIKGVTWLLQKFPQLADQ 215

GO:0005622 "intracellular" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISS

GO:0006606 "protein import into nucleus" evidence=ISS

GO:0006810 "transport" evidence=IEA

GO:0008565 "protein transporter activity" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0015996 "chlorophyll catabolic process" evidence=RCA

TAIR\|locus:2177906 AT5G41470 "AT5G41470" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	5.3.3.1	LOW CONFIDENCE prediction!
3rd Layer	5.3.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		231
pfam12680		101	pfam12680, SnoaL_2, SnoaL-like domain	3e-15
pfam07366		126	pfam07366, SnoaL, SnoaL-like polyketide cyclase	6e-09
pfam02136		116	pfam02136, NTF2, Nuclear transport factor 2 (NTF2)	3e-08
TIGR02096		129	TIGR02096, TIGR02096, conserved hypothetical prote	9e-08
cd00781		122	cd00781, ketosteroid_isomerase, ketosteroid isomer	7e-05
cd00531		124	cd00531, NTF2_like, Nuclear transport factor 2 (NT	0.004

>gnl\|CDD\|221707 pfam12680, SnoaL_2, SnoaL-like domain	Back alignment and domain information

 Score = 68.8 bits (169), Expect = 3e-15
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 90  VRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVI 149
           VRRFY  +N  DL ++ EL+A D V+ D     P  GR+A   F      +   DL+F I
Sbjct: 1   VRRFYEALNAGDLDALAELLAPDVVFHDP--GGPLRGREALRAFLAALFAAF-PDLRFEI 57

Query: 150 DDISAEDSSAVGVTWHLEWK----GKPFPFSKGCSFYKLEVVNGK 190
           + + A+      V W L       G+      G   ++ E  +GK
Sbjct: 58  ERVIADGDRVA-VRWTLTGTIPPTGRGVRVR-GVDIFRFE--DGK 98

This family contains a large number of proteins that share the SnoaL fold. Length = 101

>gnl\|CDD\|219387 pfam07366, SnoaL, SnoaL-like polyketide cyclase	Back alignment and domain information

>gnl\|CDD\|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain	Back alignment and domain information

>gnl\|CDD\|233725 TIGR02096, TIGR02096, conserved hypothetical protein, steroid delta-isomerase-related	Back alignment and domain information

>gnl\|CDD\|238404 cd00781, ketosteroid_isomerase, ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>gnl\|CDD\|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		231
TIGR02096		129	conserved hypothetical protein, steroid delta-isom	99.76
cd00781		122	ketosteroid_isomerase ketosteroid isomerase: Many	99.73
PF12680		102	SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8	99.71
PF07366		126	SnoaL: SnoaL-like polyketide cyclase; InterPro: IP	99.68
PRK08241		339	RNA polymerase factor sigma-70; Validated	99.62
PF07858		125	LEH: Limonene-1,2-epoxide hydrolase catalytic doma	99.53
TIGR02960		324	SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa	99.5
COG3631		133	Ketosteroid isomerase-related protein [General fun	99.47
TIGR02246		128	conserved hypothetical protein. This family consis	99.2
PF13474		121	SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE	99.07
COG4922		129	Uncharacterized protein conserved in bacteria [Fun	99.04
COG4319		137	Ketosteroid isomerase homolog [Function unknown]	98.97
PRK09636		293	RNA polymerase sigma factor SigJ; Provisional	98.95
PF14534		107	DUF4440: Domain of unknown function (DUF4440); PDB	98.86
COG4308		130	LimA Limonene-1,2-epoxide hydrolase [Secondary met	98.84
cd00531		124	NTF2_like Nuclear transport factor 2 (NTF2-like) s	98.74
COG5485		131	Predicted ester cyclase [General function predicti	98.61
TIGR02957		281	SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa	98.56
PF08332		128	CaMKII_AD: Calcium/calmodulin dependent protein ki	98.39
PF10184		113	DUF2358: Uncharacterized conserved protein (DUF235	98.39
PF13577		127	SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF	98.37
COG4538		112	Uncharacterized conserved protein [Function unknow	98.26
PRK09635		290	sigI RNA polymerase sigma factor SigI; Provisional	98.23
PF03284		162	PHZA_PHZB: Phenazine biosynthesis protein A/B; Int	98.07
PF12893		116	Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL	98.04
PF02136		118	NTF2: Nuclear transport factor 2 (NTF2) domain; In	97.78
PF07080		143	DUF1348: Protein of unknown function (DUF1348); In	97.77
COG4875		156	Uncharacterized protein conserved in bacteria with	97.74
PF05223		118	MecA_N: NTF2-like N-terminal transpeptidase domain	97.04
cd00667		160	ring_hydroxylating_dioxygenases_beta Ring hydroxyl	96.79
PRK10069		183	3-phenylpropionate dioxygenase subunit beta; Provi	96.53
PF12870		111	Lumazine_bd: Lumazine-binding domain; InterPro: IP	96.48
cd00780		119	NTF2 Nuclear transport factor 2 (NTF2) domain play	96.31
PF11533		125	DUF3225: Protein of unknown function (DUF3225); In	95.75
KOG4457		202	consensus Uncharacterized conserved protein [Funct	89.06
COG3558		154	Uncharacterized protein conserved in bacteria [Fun	88.22
TIGR03231		155	anthran_1_2_B anthranilate 1,2-dioxygenase, small	81.05
PLN02382		413	probable sucrose-phosphatase	80.58
PF07107		109	WI12: Wound-induced protein WI12; InterPro: IPR009	80.21

>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related	Back alignment and domain information

Probab=99.76  E-value=2.8e-17  Score=128.35  Aligned_cols=110  Identities=21%  Similarity=0.380  Sum_probs=95.2

Q ss_pred             HHHHHHHHHHhCCCHHHHHhhhcCCeEEEcCCCCCcccCHHHHHHHHHHhHhhcCCCeEEEEEEEEeCCCCEEEEEEEEE
Q 026892           88 VVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTWHLE  167 (231)
Q Consensus        88 ~lVr~fydAfN~gDleal~~L~A~DvV~~dp~~~g~~~GrdaI~a~f~~~~~~~~~d~~~~i~dvv~~g~~~Vav~w~~~  167 (231)
                      +++++||++|+++|++.+.++|+||++|++|..+.+..|+++++++++.++. ..+++++++.++...++..++++|+++
T Consensus         2 ~iv~~~~~a~~~~d~~~~~~~~~~d~~~~~~~~~~~~~G~~~~~~~~~~~~~-~~~~~~~~i~~~~~~~~~~v~~~~~~~   80 (129)
T TIGR02096         2 ELAQHWIEAFNRGDMDAVLALLAEDVLYDDNQGGRVLGGKAQLARFLAPYRT-AFPDLLVDVVVCRNDEGVRVAAEWTVH   80 (129)
T ss_pred             HHHHHHHHHHHCCCHHHHHHhcCCCeEEEcCCCCcEeccHHHHHHHHHHHHH-hCchhhceeEEEEecCCcEEEEEEEEe
Confidence            6899999999999999999999999999998776677889999999998876 468999999888765544777777753


Q ss_pred             -----------ECCeeEeeeceEEEEEEEeeCCeEEEEEEEEeeCCC
Q 026892          168 -----------WKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPA  203 (231)
Q Consensus       168 -----------~~Gk~i~~~rG~~vfr~d~~dGK~~Iv~~rdy~d~~  203 (231)
                                 .+|+++.+ +++++|++  +|||  |+++++|+|..
T Consensus        81 g~~~g~~~g~~~~g~~~~~-~~~~~~~~--~~gk--I~~~~~y~D~~  122 (129)
T TIGR02096        81 GTYRTAFLGLPASGKTYSI-RGVTFFVF--DDGK--IKRETTYYNLA  122 (129)
T ss_pred             eeeccccCCCCCCCCEEEe-eeeEEEEE--eCCE--EEEEEEEecHH
Confidence                       25889999 89999999  7999  99999999854

This family of proteins about 135 amino acids in length largely restricted to the Proteobacteria. This family and a delta5-3-ketosteroid isomerase from Pseudomonas testosteroni appear homologous, especially toward their respective N-termini. Members, therefore, probably are enzymes.

>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A	Back alignment and domain information

>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis	Back alignment and domain information

>PRK08241 RNA polymerase factor sigma-70; Validated	Back alignment and domain information

>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism	Back alignment and domain information

>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family	Back alignment and domain information

>COG3631 Ketosteroid isomerase-related protein [General function prediction only]	Back alignment and domain information

>TIGR02246 conserved hypothetical protein	Back alignment and domain information

>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B	Back alignment and domain information

>COG4922 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG4319 Ketosteroid isomerase homolog [Function unknown]	Back alignment and domain information

>PRK09636 RNA polymerase sigma factor SigJ; Provisional	Back alignment and domain information

>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A	Back alignment and domain information

>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

>COG5485 Predicted ester cyclase [General function prediction only]	Back alignment and domain information

>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family	Back alignment and domain information

>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins	Back alignment and domain information

>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B	Back alignment and domain information

>COG4538 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional	Back alignment and domain information

>PF03284 PHZA_PHZB: Phenazine biosynthesis protein A/B; InterPro: IPR004964 The phenazine biosynthesis proteins A and B are involved in the biosynthesis of this antibiotic	Back alignment and domain information

>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C	Back alignment and domain information

>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein	Back alignment and domain information

>PF07080 DUF1348: Protein of unknown function (DUF1348); InterPro: IPR009783 This family consists of several highly conserved hypothetical proteins of around 150 residues in length	Back alignment and domain information

>COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown]	Back alignment and domain information

>PF05223 MecA_N: NTF2-like N-terminal transpeptidase domain; InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide	Back alignment and domain information

>cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit	Back alignment and domain information

>PRK10069 3-phenylpropionate dioxygenase subunit beta; Provisional	Back alignment and domain information

>PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria	Back alignment and domain information

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus	Back alignment and domain information

>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function	Back alignment and domain information

>KOG4457 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3558 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit	Back alignment and domain information

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

>PF07107 WI12: Wound-induced protein WI12; InterPro: IPR009798 This entry consists of several plant wound-induced protein sequences related to WI12 from Mesembryanthemum crystallinum (Common ice plant) (Q9XES3 from SWISSPROT)	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		231
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	2e-20
3k0z_A		159	Putative polyketide cyclase; structural genomics,	2e-13
1oh0_A		131	Steroid delta-isomerase; ketosteroid isomerase, KS	3e-13
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	1e-12
2gey_A		158	ACLR protein; alpha+beta barrel, oxidoreductase; H	3e-12
1z1s_A		163	Hypothetical protein PA3332; beta barrel, conserve	5e-12
3i0y_A		140	Putative polyketide cyclase; cystatin-like fold, s	2e-11
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	2e-11
3fgy_A		135	Uncharacterized NTF2-like protein; structural geno	2e-11
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	2e-11
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	4e-11
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	6e-05
3g8z_A		148	Protein of unknown function with cystatin-like FO;	7e-11
3g16_A		156	Uncharacterized protein with cystatin-like fold; Y	8e-11
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	8e-11
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	9e-11
2gex_A		152	SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St	1e-10
2f99_A		153	Aklanonic acid methyl ester cyclase, AKNH; anthrac	2e-10
3f9s_A		146	Putative polyketide cyclase; structural genomics,	2e-10
3ebt_A		132	Uncharacterized NTF2-like protein; structural geno	2e-09
1sjw_A		144	Nogalonic acid methyl ester cyclase; anthracycline	3e-09
3ec9_A		140	Uncharacterized NTF2-like protein; structural geno	1e-08
3f8h_A		150	Putative polyketide cyclase; structural genomics,	2e-08
3ehc_A		128	Snoal-like polyketide cyclase; structural genomics	3e-08
3mso_A		143	Steroid delta-isomerase; structural genomics, join	3e-08
3dm8_A		143	Uncharacterized protein RPA4348; siras, putative i	7e-08
3f7x_A		151	Putative polyketide cyclase; structural genomics,	9e-08
3grd_A		134	Uncharacterized NTF2-superfamily protein; NP_97724	2e-07
3mg1_A		323	OCP, orange carotenoid protein; carotenoid binding	2e-06
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	3e-06
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	5e-06
2a15_A		139	Hypothetical protein RV0760C; beta-alpha-barrel, s	9e-06
3rob_A		139	Uncharacterized conserved protein; structural geno	4e-05
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
3g0k_A		148	Putative membrane protein; snoal-like polyketide c	2e-04
3flj_A		155	Uncharacterized protein conserved in bacteria WIT	3e-04
3f8x_A		148	Putative delta-5-3-ketosteroid isomerase; structur	4e-04

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Length = 129	Back alignment and structure

 Score = 82.8 bits (204), Expect = 2e-20
 Identities = 23/116 (19%), Positives = 46/116 (39%), Gaps = 12/116 (10%)

Query: 89  VVRRFYAGINGRDLASVEELIADDCVYEDLI---FPRPFLGRKATLDFFKKFSDSISSDL 145
           ++RRF       D A++ ELIA++CV E+ +         GR+A +  +   +       
Sbjct: 22  IMRRFNDVFQLHDPAALPELIAEECVIENTVPAPDGARHAGRQACVQLWSAIAT--QPGT 79

Query: 146 QFVIDDISAEDSSAVGVTWHLEWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVE 201
           +F +++       A  + W   +        +G +     V +G+  I      V+
Sbjct: 80  RFDLEETFVAGDRAT-IRWR--YWMADGNSVRGVNLM--RVQDGR--IVEAMGYVK 128

PyMOL of 3fh1

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Length = 159	Back alignment and structure

>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Length = 131	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Length = 150	Back alignment and structure

>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Length = 158	Back alignment and structure

>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Length = 163	Back alignment and structure

>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Length = 140	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Length = 149	Back alignment and structure

>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} Length = 135	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Length = 149	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Length = 283	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Length = 283	Back alignment and structure

>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Length = 148	Back alignment and structure

>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Length = 156	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Length = 156	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Length = 125	Back alignment and structure

>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Length = 152	Back alignment and structure

>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Length = 153	Back alignment and structure

>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Length = 146	Back alignment and structure

>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Length = 132	Back alignment and structure

>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Length = 144	Back alignment and structure

>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Length = 140	Back alignment and structure

>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Length = 150	Back alignment and structure

>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Length = 128	Back alignment and structure

>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Length = 143	Back alignment and structure

>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Length = 143	Back alignment and structure

>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Length = 151	Back alignment and structure

>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} Length = 134	Back alignment and structure

>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Length = 323	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Length = 129	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Length = 142	Back alignment and structure

>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Length = 139	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Length = 139	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Length = 135	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Length = 148	Back alignment and structure

>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Length = 155	Back alignment and structure

>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Length = 148	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		231
4h3u_A		158	Hypothetical protein; structural genomics, PSI-bio	99.86
3dm8_A		143	Uncharacterized protein RPA4348; siras, putative i	99.83
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	99.82
3ebt_A		132	Uncharacterized NTF2-like protein; structural geno	99.82
3f9s_A		146	Putative polyketide cyclase; structural genomics,	99.81
3g16_A		156	Uncharacterized protein with cystatin-like fold; Y	99.81
3ec9_A		140	Uncharacterized NTF2-like protein; structural geno	99.81
3g8z_A		148	Protein of unknown function with cystatin-like FO;	99.8
3k0z_A		159	Putative polyketide cyclase; structural genomics,	99.8
3ff2_A		117	Uncharacterized cystatin fold protein (YP_497570.	99.8
3fgy_A		135	Uncharacterized NTF2-like protein; structural geno	99.79
2gex_A		152	SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St	99.79
3kkg_A		146	Putative snoal-like polyketide cyclase; structural	99.79
2k54_A		123	Protein ATU0742; protein of unknown function, stru	99.79
3grd_A		134	Uncharacterized NTF2-superfamily protein; NP_97724	99.78
2f99_A		153	Aklanonic acid methyl ester cyclase, AKNH; anthrac	99.78
3f14_A		112	Uncharacterized NTF2-like protein; YP_680363.1, NT	99.77
2a15_A		139	Hypothetical protein RV0760C; beta-alpha-barrel, s	99.77
1sjw_A		144	Nogalonic acid methyl ester cyclase; anthracycline	99.77
1oh0_A		131	Steroid delta-isomerase; ketosteroid isomerase, KS	99.77
3ehc_A		128	Snoal-like polyketide cyclase; structural genomics	99.77
2gey_A		158	ACLR protein; alpha+beta barrel, oxidoreductase; H	99.76
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	99.75
3dmc_A		134	NTF2-like protein; structural genomics, joint cent	99.75
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	99.75
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	99.74
3i0y_A		140	Putative polyketide cyclase; cystatin-like fold, s	99.74
3f8h_A		150	Putative polyketide cyclase; structural genomics,	99.74
1z1s_A		163	Hypothetical protein PA3332; beta barrel, conserve	99.73
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	99.73
3f7x_A		151	Putative polyketide cyclase; structural genomics,	99.73
3en8_A		128	Uncharacterized NTF-2 like protein; YP_553245.1, N	99.72
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	99.71
3mso_A		143	Steroid delta-isomerase; structural genomics, join	99.69
3g0k_A		148	Putative membrane protein; snoal-like polyketide c	99.69
3h3h_A		122	Uncharacterized snoal-like protein; structural gen	99.69
3hk4_A		136	MLR7391 protein; NTF2-like protein, structural gen	99.68
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	99.68
3dxo_A		121	Uncharacterized snoal-like protein; putative isome	99.66
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	99.66
3f40_A		114	Uncharacterized NTF2-like protein; YP_677363.1, NT	99.65
3er7_A		131	Uncharacterized NTF2-like protein; YP_001812677.1,	99.63
3jum_A		185	Phenazine biosynthesis protein A/B; chirality, dru	99.63
3f8x_A		148	Putative delta-5-3-ketosteroid isomerase; structur	99.6
3ff0_A		163	Phenazine biosynthesis protein PHZB 2; cystatin-li	99.59
3flj_A		155	Uncharacterized protein conserved in bacteria WIT	99.57
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	99.51
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	99.46
3lyg_A		120	NTF2-like protein of unknown function; structural	99.44
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	99.38
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	99.35
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	99.29
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	99.23
3cu3_A		172	Domain of unknown function with A cystatin-like F;	99.2
3rob_A		139	Uncharacterized conserved protein; structural geno	99.18
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	99.16
4i4k_A		143	Uncharacterized protein SGCJ; structural genomics,	99.07
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	99.02
3mg1_A		323	OCP, orange carotenoid protein; carotenoid binding	99.0
3ke7_A		134	Putative ketosteroid isomerase; structural genomic	98.98
3bb9_A		148	Putative orphan protein; structural genomics, join	98.97
3b7c_A		122	Uncharacterized protein; NTF-2 like protein, struc	98.9
2chc_A		170	Protein RV3472; hypothetical protein; 1.69A {Mycob	98.78
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	98.71
3gzb_A		154	Putative snoal-like polyketide cyclase; YP_0011826	98.71
2rcd_A		129	Uncharacterized protein; structural genomics, join	98.69
2rgq_A		144	Domain of unknown function with A cystatin-like F;	98.67
3b8l_A		163	Uncharacterized protein; putative aromatic ring hy	98.62
3a76_A		176	Gamma-hexachlorocyclohexane dehydrochlorinase; bar	98.54
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	98.5
2rfr_A		155	Uncharacterized protein; structural genomics, join	98.49
2f86_B		143	Hypothetical protein K11E8.1D; UNC-43, oligomeriza	98.48
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	98.45
2owp_A		129	Hypothetical protein BXE_B1374; cystatin-like fold	98.44
3ef8_A		150	Putative scyalone dehydratase; YP_496742.1, struct	98.37
3fsd_A		134	NTF2-like protein of unknown function in nutrient;	98.34
3blz_A		128	NTF2-like protein of unknown function; structural	98.28
3ecf_A		130	NTF2-like protein; structural genomics, joint cent	98.27
3ejv_A		179	Uncharacterized protein with cystatin-like fold; s	98.15
3duk_A		125	NTF2-like protein of unknown function; structural	98.09
3ksp_A		129	Calcium/calmodulin-dependent kinase II associatio;	98.0
3soy_A		145	NTF2-like superfamily protein; structural genomics	97.95
3fka_A		120	Uncharacterized NTF-2 like protein; structural gen	97.88
2imj_A		166	Hypothetical protein DUF1348; alpha beta protein,	97.87
4gb5_A		159	Uncharacterized protein; structural genomics, PSI-	97.84
2b1x_B		172	Naphthalene dioxygenase small subunit; rieske non-	97.12
2gbw_B		174	Biphenyl 2,3-dioxygenase beta subunit; rieske oxyg	97.01
3eby_A		163	Beta subunit of A putative aromatic-ring-hydroxyl	96.52
1idp_A		172	Scytalone dehydratase; lyase, melanine biosynthesi	96.46
3e99_A		164	Benzoate 1,2-dioxygenase beta subunit; structural	96.38
3nv0_B		154	NTF2-related export protein; NTF2-like domain, bet	96.16
1uli_B		187	Biphenyl dioxygenase small subunit; alpha3 BETA3 h	96.1
1zo2_A		129	NTF2, nuclear transport factor 2; structural genom	96.08
1gy6_A		127	Nuclear transport factor 2; 1.6A {Rattus norvegicu	96.02
3ujm_A		120	Rasputin; NTF2-like fold, RAS signaling, signaling	95.91
1gy7_A		125	Nuclear transport factor 2; protein transport; 1.6	95.72
3gzx_B		186	Biphenyl dioxygenase subunit beta; rieskie, non-he	95.65
1wql_B		186	Ethylbenzene dioxygenase small subunit; biphenyl d	95.25
2bmo_B		194	Oxygenase-beta NBDO; nitrobenzene dioxygenase, nit	95.05
3q90_A		140	RAS GTPase-activating protein-binding protein 1; s	94.68
1jkg_A		140	P15; NTF2-like domain, transport protein; 1.90A {H	94.56
2qiy_A		154	UBP3-associated protein BRE5; deubiquitylation, ub	94.54
3soa_A		444	Calcium/calmodulin-dependent protein kinase type a	92.82
1jkg_B		250	TAP; NTF2-like domain, transport protein; 1.90A {H	90.94
3hzp_A		131	NTF2-like protein of unknown function; YP_291699.1	89.19
1vqq_A		646	Saupbp2A, penicillin-binding protein MECA, low-aff	88.16
1of5_A		221	MRNA export factor MEX67; nuclear protein, repeat,	87.48
3k7c_A		114	Putative NTF2-like transpeptidase; structural geno	83.39

>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila}	Back alignment and structure

Probab=99.86  E-value=1.8e-21  Score=156.78  Aligned_cols=111  Identities=15%  Similarity=0.189  Sum_probs=98.2

Q ss_pred             cHHHHHHHHHHHHhCCCHHHHHhhhcCCeEEEcCCCCCcccCHHHHHHHHHHhHhhcCCCeEEEEEEEEeCCCCEEEEEE
Q 026892           85 GGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTW  164 (231)
Q Consensus        85 ~~~~lVr~fydAfN~gDleal~~L~A~DvV~~dp~~~g~~~GrdaI~a~f~~~~~~~~~d~~~~i~dvv~~g~~~Vav~w  164 (231)
                      ...++|++|++|||++|++++.+||+||++|+||+.+++++|+++|++||+.+.. .++++++++.+++.+|+ .|+++|
T Consensus        26 t~~eiv~~y~~A~n~~D~d~~~~l~a~D~v~~d~~~g~~~~Greai~~~~~~~~~-~~~d~~~~v~~~~~~gd-~v~~~~  103 (158)
T 4h3u_A           26 TTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGREQISGWKARTDA-MIENVHVTITKAYRAGD-HVTIEA  103 (158)
T ss_dssp             CCCHHHHHHHHHHHSSCHHHHHTTEEEEEEEEETTTTEEEESHHHHHHHHHHHHH-HEEEEEEEEEEEEEETT-EEEEEE
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHhcccceEeccCCCceEecchhhhhhhhhhhc-cCCccceeEeEEeecCc-eEEEEE
Confidence            3558999999999999999999999999999999888889999999999998665 57999999999887664 777777


Q ss_pred             EEEE----CCeeEeeeceEEEEEEEeeCCeEEEEEEEEeeCC
Q 026892          165 HLEW----KGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEP  202 (231)
Q Consensus       165 ~~~~----~Gk~i~~~rG~~vfr~d~~dGK~~Iv~~rdy~d~  202 (231)
                      .++.    .|+++.+ +|+++|++  +|||  |++.++|+|.
T Consensus       104 ~~~gt~~~tG~~~~~-~~~~v~~~--~dGk--I~~~~~y~D~  140 (158)
T 4h3u_A          104 VYGGHIKGAPTPFAV-PMATLLRT--RGEE--ITSDQDYYSL  140 (158)
T ss_dssp             EEEEEETTSSSCEEE-EEEEEEEE--ETTE--EEEEEEEECH
T ss_pred             EEEEEecCccCccee-eeEEEEEE--ECCE--EEEEEEEECH
Confidence            7643    4899999 89999999  8999  9999999974

PyMOL of 4h3u

>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20	Back alignment and structure

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9	Back alignment and structure

>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23}	Back alignment and structure

>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1}	Back alignment and structure

>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10	Back alignment and structure

>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV}	Back alignment and structure

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus}	Back alignment and structure

>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0	Back alignment and structure

>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP}	Back alignment and structure

>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29	Back alignment and structure

>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0	Back alignment and structure

>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A*	Back alignment and structure

>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A	Back alignment and structure

>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ...	Back alignment and structure

>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str}	Back alignment and structure

>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A	Back alignment and structure

>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A*	Back alignment and structure

>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV}	Back alignment and structure

>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP}	Back alignment and structure

>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10	Back alignment and structure

>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440}	Back alignment and structure

>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11	Back alignment and structure

>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa}	Back alignment and structure

>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans}	Back alignment and structure

>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264}	Back alignment and structure

>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti}	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24	Back alignment and structure

>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A*	Back alignment and structure

>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti}	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27	Back alignment and structure

>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea}	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV}	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440}	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22	Back alignment and structure

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259}	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus}	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A*	Back alignment and structure

>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus}	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides}	Back alignment and structure

>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A*	Back alignment and structure

>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16	Back alignment and structure

>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16	Back alignment and structure

>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25	Back alignment and structure

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17	Back alignment and structure

>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A*	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18	Back alignment and structure

>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25	Back alignment and structure

>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis}	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12	Back alignment and structure

>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15	Back alignment and structure

>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18	Back alignment and structure

>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28	Back alignment and structure

>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0	Back alignment and structure

>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14	Back alignment and structure

>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21	Back alignment and structure

>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28	Back alignment and structure

>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0	Back alignment and structure

>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp}	Back alignment and structure

>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>2imj_A Hypothetical protein DUF1348; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} SCOP: d.17.4.23	Back alignment and structure

>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida}	Back alignment and structure

>2b1x_B Naphthalene dioxygenase small subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 2b24_B	Back alignment and structure

>2gbw_B Biphenyl 2,3-dioxygenase beta subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_B* 2ckf_B	Back alignment and structure

>3eby_A Beta subunit of A putative aromatic-ring-hydroxyl dioxygenase; YP_001165631.1; 1.75A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.4	Back alignment and structure

>1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A*	Back alignment and structure

>3e99_A Benzoate 1,2-dioxygenase beta subunit; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Burkholderia mallei atcc 23344} SCOP: d.17.4.4	Back alignment and structure

>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans}	Back alignment and structure

>1uli_B Biphenyl dioxygenase small subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 1ulj_B* 3en1_B* 3eqq_B	Back alignment and structure

>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2	Back alignment and structure

>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A	Back alignment and structure

>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster}	Back alignment and structure

>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A	Back alignment and structure

>3gzx_B Biphenyl dioxygenase subunit beta; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} SCOP: d.17.4.4 PDB: 3gzy_B* 2yfi_B 2xr8_B* 2xrx_B* 2xsh_B 2xso_B 2yfj_B* 2yfl_B*	Back alignment and structure

>1wql_B Ethylbenzene dioxygenase small subunit; biphenyl dioxygenase, cumene dioxygenase; 2.20A {Pseudomonas fluorescens} SCOP: d.17.4.4	Back alignment and structure

>2bmo_B Oxygenase-beta NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: d.17.4.4 PDB: 2bmq_B 2bmr_B* 1o7n_B 1ndo_B 1o7g_B* 1o7h_B 1o7m_B 1eg9_B 1o7p_B* 1o7w_B 1uuv_B 1uuw_B 2hmj_B 2hmk_B* 2hml_B* 2hmm_B* 2hmn_B* 2hmo_B*	Back alignment and structure

>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0	Back alignment and structure

>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A	Back alignment and structure

>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A	Back alignment and structure

>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens}	Back alignment and structure

>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A	Back alignment and structure

>3hzp_A NTF2-like protein of unknown function; YP_291699.1, structural genomics, joint center structural genomics, JCSG; HET: MSE 1PE; 1.40A {Prochlorococcus marinus}	Back alignment and structure

>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwu_A* 1mwr_A 1mws_A* 1mwt_A*	Back alignment and structure

>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2	Back alignment and structure

>3k7c_A Putative NTF2-like transpeptidase; structural genomics, JOIN for structural genomics, JCSG, protein structure initiative unknown function; HET: PGE; 2.00A {Campylobacter jejuni}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		231
d1m98a2		142	d.17.4.6 (A:176-317) Orange carotenoid protein, C-	2e-14
d1oh0a_		125	d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, ste	2e-11
d1ohpa1		125	d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase	3e-10
d1s5aa_		139	d.17.4.10 (A:) Hypothetical protein YesE {Bacillus	4e-10
d1z1sa1		129	d.17.4.10 (A:1-129) Uncharacterized protein PA3332	3e-09
d1tuha_		131	d.17.4.11 (A:) Hypothetical protein egc068 from a	7e-09
d2k54a1		123	d.17.4.29 (A:1-123) Uncharacterized protein Atu074	7e-09
d3ec9a1		130	d.17.4.10 (A:10-139) Uncharacterized protein BTHI0	6e-08
d2f99a1		140	d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyc	7e-08
d2bnga1		132	d.17.4.8 (A:13-144) Uncharacterized protein Mb2760	8e-08
d3ebta1		131	d.17.4.9 (A:1-131) Uncharacterized protein BPSS013	3e-07
d2a15a1		132	d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {M	4e-07
d1nwwa_		145	d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhod	8e-07
d3en8a1		127	d.17.4.20 (A:1-127) Uncharacterized protein BxeB20	2e-06
d3dm8a1		135	d.17.4.20 (A:1-135) Uncharacterized protein Rpa434	2e-06
d1sjwa_		142	d.17.4.9 (A:) Nogalonic acid methyl ester cyclase	4e-06
d3dmca1		133	d.17.4.10 (A:1-133) Uncharacterized protein Ava226	4e-06
d3dxoa1		117	d.17.4.19 (A:1-117) Uncharacterized protein Atu074	4e-05
d2gexa1		138	d.17.4.9 (A:2-139) Nogalamycin biosynthesis protei	2e-04
d2geya1		144	d.17.4.9 (A:2-145) Putative hydroxylase AclR {Stre	2e-04

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Length = 142	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Orange carotenoid protein, C-terminal domain
domain: Orange carotenoid protein, C-terminal domain
species: Cyanobacteria (Arthrospira maxima) [TaxId: 129910]

 Score = 66.0 bits (161), Expect = 2e-14
 Identities = 22/130 (16%), Positives = 53/130 (40%), Gaps = 8/130 (6%)

Query: 69  VASPLPTTSNVD-GDDGGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGR 127
           V  P   +       +G     V ++   +N  D  ++  L A+D   +   F +P +G+
Sbjct: 3   VVPPQEMSQRTKVQIEGVTNSTVLQYMDNLNANDFDNLISLFAEDGALQP-PFQKPIVGK 61

Query: 128 KATLDFFKKFSDSISSDLQFVIDDISAEDSSAVGVTW--HLEWKGKPFPFSKGCSFYKLE 185
           + TL FF++   ++    +  + + + +  + + VT      W G       G +     
Sbjct: 62  ENTLRFFREECQNLKLIPERGVSEPTEDGYTQIKVTGKVQTPWFGGNV----GMNIAWRF 117

Query: 186 VVNGKRQITY 195
           ++N + ++ +
Sbjct: 118 LLNPENKVFF 127

PyMOL of d1m98a2

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Length = 125	Back information, alignment and structure

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Length = 125	Back information, alignment and structure

>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Length = 139	Back information, alignment and structure

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Length = 129	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Length = 131	Back information, alignment and structure

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Length = 123	Back information, alignment and structure

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Length = 130	Back information, alignment and structure

>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Length = 140	Back information, alignment and structure

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Length = 131	Back information, alignment and structure

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132	Back information, alignment and structure

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 145	Back information, alignment and structure

>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Length = 127	Back information, alignment and structure

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 135	Back information, alignment and structure

>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Length = 142	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Length = 133	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Length = 117	Back information, alignment and structure

>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Length = 138	Back information, alignment and structure

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Length = 144	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		231
d1oh0a_		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	99.82
d1nwwa_		145	Limonene-1,2-epoxide hydrolase {Rhodococcus erythr	99.82
d2bnga1		132	Uncharacterized protein Mb2760 {Mycobacterium tube	99.81
d1ohpa1		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	99.8
d1tuha_		131	Hypothetical protein egc068 from a soil-derived mo	99.8
d3ebta1		131	Uncharacterized protein BPSS0132 {Burkholderia pse	99.79
d2k54a1		123	Uncharacterized protein Atu0742 {Agrobacterium tum	99.79
d3dmca1		133	Uncharacterized protein Ava2261 {Anabaena variabil	99.78
d1z1sa1		129	Uncharacterized protein PA3332 {Pseudomonas aerugi	99.78
d3dm8a1		135	Uncharacterized protein Rpa4348 {Rhodopseudomonas	99.78
d2a15a1		132	Hypothetical protein Rv0760c {Mycobacterium tuberc	99.77
d2geya1		144	Putative hydroxylase AclR {Streptomyces galilaeus	99.76
d2f99a1		140	Aklanonic acid methyl ester cyclase, AknH {Strepto	99.75
d2gexa1		138	Nogalamycin biosynthesis protein SnoL {Streptomyce	99.75
d3en8a1		127	Uncharacterized protein BxeB2092 {Burkholderia xen	99.75
d3dxoa1		117	Uncharacterized protein Atu0744 {Agrobacterium tum	99.73
d3ec9a1		130	Uncharacterized protein BTHI0051 {Burkholderia tha	99.73
d1sjwa_		142	Nogalonic acid methyl ester cyclase SnoaL {Strepto	99.72
d1s5aa_		139	Hypothetical protein YesE {Bacillus subtilis [TaxI	99.72
d1m98a2		142	Orange carotenoid protein, C-terminal domain {Cyan	99.59
d3d9ra1		132	Uncharacterized protein ECA1476 {Pectobacterium at	99.27
d2gxfa1		128	Hypothetical protein YybH {Bacillus subtilis [TaxI	99.14
d3b7ca1		121	Uncharacterized protein SO0125 {Shewanella oneiden	99.13
d3cu3a1		162	Uncharacterized protein NpunR1993 {Nostoc punctifo	99.02
d2rcda1		127	Uncharacterized protein ECA3500 {Pectobacterium at	99.0
d2rgqa1		133	Uncharacterized protein NpunR3134 {Nostoc punctifo	98.91
d3bb9a1		121	Uncharacterized protein Sfri1973 {Shewanella frigi	98.9
d3cnxa1		153	Uncharacterized protein SAV4671 {Streptomyces aver	98.9
d2owpa1		128	Hypothetical protein BxeB1374 {Burkholderia xenovo	98.87
d2ux0a1		135	Association domain of calcium/calmodulin-dependent	98.85
d2r4ia1		122	Uncharacterized protein CHU142 {Cytophaga hutchins	98.64
d2f86b1		129	Association domain of calcium/calmodulin-dependent	98.59
d3ejva1		159	Uncharacterized protein Saro2766 {Novosphingobium	98.54
d3b8la1		144	Uncharacterized protein Saro3538 {Novosphingobium	98.48
d3ef8a1		149	Uncharacterized protein Saro1465 {Novosphingobium	98.41
d2chca1		167	Uncharacterized protein Rv3472 {Mycobacterium tube	98.41
d3er7a1		118	Uncharacterized protein Exig0174 {Exiguobacterium	98.18
d3blza1		124	Uncharacterized protein Sbal0622 {Shewanella balti	98.16
d2rfra1		153	Uncharacterized protein Saro3722 {Novosphingobium	97.99
d2imja1		155	Hypothetical protein PFL3262 {Pseudomonas fluoresc	97.79
d3ecfa1		128	Uncharacterized protein Ava4193 {Anabaena variabil	97.78
d3ebya1		157	Putative hydroxylase subunit Saro3860 {Novosphingo	97.75
d1idpa_		147	Scytalone dehydratase {Fungus (Magnaporthe grisea)	97.31
d3e99a1		163	Benzoate 1,2-dioxygenase beta subunit BenB {Burkho	97.28
d1wqlb1		182	Small subunit of cumene dioxygenase CumA2 {Pseudom	96.85
d1gy7a_		121	Nuclear transport factor-2 (NTF2) {Baker's yeast (	96.76
d2b1xb1		167	Naphthalene 1,2-dioxygenase beta subunit {Rhodococ	96.55
d1gy6a_		125	Nuclear transport factor-2 (NTF2) {Rat (Rattus nor	96.51
d1ulib_		177	Biphenyl dioxygenase small subunit BphA2 {Rhodococ	96.44
d1zo2a1		117	Nuclear transport factor-2 (NTF2) {Cryptosporidium	96.41
d2qiya1		139	UBP3-associated protein BRE5 {Baker's yeast (Sacch	95.5
d1vqqa1		112	Penicillin binding protein 2a (PBP2A), N-terminal	94.77
d1jkga_		139	NTF2-related export protein 1 (p15) {Human (Homo s	94.64
d1tp6a_		126	Hypothetical protein PA1314 {Pseudomonas aeruginos	94.42
d1jkgb_		186	NTF2-like domain of Tip associating protein, TAP {	81.51

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Ketosteroid isomerase-like
domain: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI
species: Pseudomonas putida [TaxId: 303]

Probab=99.82  E-value=2.5e-20  Score=141.87  Aligned_cols=117  Identities=15%  Similarity=0.267  Sum_probs=97.2

Q ss_pred             CCCcHHHHHHHHHHHHhCCCHHHHHhhhcCCeEEEcCCCCCcccCHHHHHHHHHHhHhhcCCCeEEEEEEEEeCCCCEEE
Q 026892           82 DDGGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSAVG  161 (231)
Q Consensus        82 ~~~~~~~lVr~fydAfN~gDleal~~L~A~DvV~~dp~~~g~~~GrdaI~a~f~~~~~~~~~d~~~~i~dvv~~g~~~Va  161 (231)
                      ...+.++++++|++++|++|++++.+||+||+++++|..+++++|++++++||..++. .++...+.+..+...++..+.
T Consensus         3 t~e~~~~~v~~y~~a~~~~D~d~~~~l~~~d~~~~~p~~~~~~~G~~~i~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~   81 (125)
T d1oh0a_           3 TAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLG-GGKVRACLTGPVRASHNGCGA   81 (125)
T ss_dssp             CHHHHHHHHHHHHHHHHHTCHHHHHHHEEEEEEEESSTTSCCEEHHHHHHHHHHHHHS-SSCCEEEESSCCEECSSSEEE
T ss_pred             CHHHHHHHHHHHHHHHHcCCHHHHHHHhCCCEEEECCCCCcccccHHHHHHHHHHHHH-hcccceEEEEEEEEcCCCEEE
Confidence            3456889999999999999999999999999999999776789999999999998775 446666666556655545555


Q ss_pred             EEEEE--EECCeeEeeeceEEEEEEEeeCCeEEEEEEEEeeCCC
Q 026892          162 VTWHL--EWKGKPFPFSKGCSFYKLEVVNGKRQITYGRDIVEPA  203 (231)
Q Consensus       162 v~w~~--~~~Gk~i~~~rG~~vfr~d~~dGK~~Iv~~rdy~d~~  203 (231)
                      +.|+.  ...|+++.+ +++++|++| +|||  |+++++|||+.
T Consensus        82 ~~~~~~~~~~g~~~~~-~~~~~~~~d-~dGk--I~~~~~y~d~~  121 (125)
T d1oh0a_          82 MPFRVEMVWNGQPCAL-DVIDVMRFD-EHGR--IQTMQAYWSEV  121 (125)
T ss_dssp             EEEEEEEESSSSEEEE-EEEEEEEEC-TTSC--EEEEEEECCGG
T ss_pred             EEEEEEeccccceEEE-EEEEEEEEC-CCCe--EEEEEEEECHH
Confidence            55554  557999999 899999997 4899  99999999985

PyMOL of d1oh0a_

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}	Back information, alignment and structure

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}	Back information, alignment and structure

>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]}	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}	Back information, alignment and structure

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}	Back information, alignment and structure

>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}	Back information, alignment and structure

>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]}	Back information, alignment and structure

>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]}	Back information, alignment and structure

>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}	Back information, alignment and structure

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vqqa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure