Citrus Sinensis ID: 026976

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MSQLRVILQESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTINLSDSEGEEQQQRHLNQERSTSSAQNQPDNETVPVCMSRIPLISSGMNLAAALAAERHLRSADGTNPAGPTVINNDHNVGPTGTKRGTPLRVSLMRLLAETEGCDGEEKAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
ccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccHHHHHHHHHHcccccccccccHHHHHHcc
cccHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEccEccccccccccEEEcccccccccccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHcHcccccccccccccccHHHHHHHHcccccccccccccccEEEEEEEcccccEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHc
MSQLRVILQESLDRERETITILALLREKmdgvdsirrgrgrnlkerlglksmgccgatcgfrpntinlsdsegEEQQQRHLnqerstssaqnqpdnetvpvcmsriplisSGMNLAAALAAERHlrsadgtnpagptvinndhnvgptgtkrgtpLRVSLMRLLAEtegcdgeekagndsmccvcmgrkkgaafipcghtfcRVCSremwlnrgscplcnrsILEILDIF
MSQLRVILqesldrereTITILAllrekmdgvdsirrgrgrnlkerlglksmgccgaTCGFRPNTINLSDSEGEEQQQRHLNqerstssaqnqpdnetvPVCMSRIPLISSGMNLAAALAAERHLRSADgtnpagptvinndhnvgptgtkrgtplRVSLMRLLAETegcdgeekagndSMCCVCMGRKKGAAFIPCGHTFCRVCSREMwlnrgscplcnrsileildif
MSQLRVILQESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTINLSDSEGEEQQQRHLNQERSTSSAQNQPDNETVPVCMSRIPLISSGMNlaaalaaERHLRSADGTNPAGPTVINNDHNVGPTGTKRGTPLRVSLMRLLAETEGCDGEEKAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
****************ETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTI**********************************VCMSRIPLISSGMNLAAAL**************************************VSLMRLLAET**********NDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDI*
***LR*I***********************************LKERLGLKSMGCCGA****************************************************************************************************************************CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
MSQLRVILQESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTINLSD**************************ETVPVCMSRIPLISSGMNLAAALAAERHLRSADGTNPAGPTVINNDHNVGPTGTKRGTPLRVSLMRLLAETEGCDGEEKAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
******I*QESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTINLSDSE****QQR**N***************TVPVC*S************************************************************************GNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLRVILQESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCGFRPNTINLSDSEGEEQQQRHLNQERSTSSAQNQPDNETVPVCMSRIPLISSGMNLAAALAAERHLRSADGTNPAGPTVINNDHNVGPTGTKRGTPLRVSLMRLLAETEGCDGEEKAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q8LA32359 Probable E3 ubiquitin-pro no no 0.321 0.206 0.324 3e-05
Q6CTZ8 427 Postreplication repair E3 yes no 0.165 0.088 0.394 0.0004
Q6R7C4465 Putative apoptosis inhibi N/A no 0.213 0.105 0.396 0.0004
Q96EH8262 E3 ubiquitin-protein liga no no 0.304 0.267 0.303 0.0007
Q6FPI4 411 Postreplication repair E3 yes no 0.165 0.092 0.447 0.0008
>sp|Q8LA32|LUL4_ARATH Probable E3 ubiquitin-protein ligase LUL4 OS=Arabidopsis thaliana GN=LUL4 PE=2 SV=1 Back     alignment and function desciption
 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 156 LRVSLMRLLAETE--GCDGEEKAGNDSMCCVCMGRKKGAAFIPCGHT-FCRVCSREMWLN 212
           +R  L  L   T      G +++G+ + C +CM   K  A +PC H   C  C++E+ L 
Sbjct: 274 VRYELRELYGSTTQGAASGLDESGSGTECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQ 333

Query: 213 RGSCPLCNRSILEILDI 229
              CP+C + I E+L+I
Sbjct: 334 SNKCPICRQPIEELLEI 350
Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6CTZ8|RAD18_KLULA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD18 PE=3 SV=1 Back     alignment and function description
>sp|Q6R7C4|IAP4_OSHVF Putative apoptosis inhibitor ORF106 OS=Ostreid herpesvirus 1 (isolate France) GN=ORF106 PE=4 SV=1 Back     alignment and function description
>sp|Q96EH8|NEUL3_HUMAN E3 ubiquitin-protein ligase NEURL3 OS=Homo sapiens GN=NEURL3 PE=2 SV=2 Back     alignment and function description
>sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
356522029207 PREDICTED: uncharacterized protein LOC10 0.886 0.985 0.587 6e-54
356562763198 PREDICTED: uncharacterized protein LOC10 0.856 0.994 0.567 9e-52
357480403217 hypothetical protein MTR_4g132760 [Medic 0.917 0.972 0.525 3e-51
87240796304 Zinc finger, RING-type [Medicago truncat 0.886 0.671 0.564 5e-51
356557951209 PREDICTED: uncharacterized protein LOC10 0.856 0.942 0.533 2e-50
449434396243 PREDICTED: uncharacterized protein LOC10 0.982 0.930 0.522 3e-50
147787228207 hypothetical protein VITISV_012047 [Viti 0.821 0.913 0.531 2e-47
357447765278 hypothetical protein MTR_2g025080 [Medic 0.843 0.697 0.541 1e-44
356532309196 PREDICTED: uncharacterized protein LOC10 0.826 0.969 0.529 2e-44
255554753211 ubiquitin-protein ligase, putative [Rici 0.878 0.957 0.5 9e-44
>gi|356522029|ref|XP_003529652.1| PREDICTED: uncharacterized protein LOC100783929 [Glycine max] Back     alignment and taxonomy information
 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/233 (58%), Positives = 152/233 (65%), Gaps = 29/233 (12%)

Query: 1   MSQLRVILQESLDRERETITILALLREKMDGVDSIRRGRGRNLKERLGLKSMGCCGATCG 60
           MSQL +ILQESL  ERET TIL LL E+MDGVD  +R R R LKERL    +GCCGAT  
Sbjct: 1   MSQLGLILQESLRTERETRTILGLLTEQMDGVDRAQRRR-RTLKERLRFTGIGCCGATWV 59

Query: 61  FRPNTINLSDSEGEEQQQRHLNQERSTSSAQNQPDNETVPVCMSRIPLISSGMNLAAALA 120
           FRP            QQQ        T++AQ+   N+  P  +S  P  +S MNLAAALA
Sbjct: 60  FRPIVREEGGGAQAHQQQ--------TNAAQDPNPND--PKYVSPSPSGTS-MNLAAALA 108

Query: 121 AERHLRSADGTNPAGPTVINNDHNVGPTGTKRGTPLRVSLMRLLAETEGCDGEEK---AG 177
           AER LR  +G              V P     GTPLRVSLMRLL ETEG D E+     G
Sbjct: 109 AERQLRDGEG---------EGRRVVAP-----GTPLRVSLMRLLEETEGGDAEKGGGGVG 154

Query: 178 NDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF 230
           ND +CCVCMGRKKGAAFIPCGHTFCRVCSRE+WLNRG+CPLCNRSILEILDIF
Sbjct: 155 NDWVCCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGTCPLCNRSILEILDIF 207

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356562763|ref|XP_003549638.1| PREDICTED: uncharacterized protein LOC100792613 [Glycine max] Back     alignment and taxonomy information
>gi|357480403|ref|XP_003610487.1| hypothetical protein MTR_4g132760 [Medicago truncatula] gi|355511542|gb|AES92684.1| hypothetical protein MTR_4g132760 [Medicago truncatula] Back     alignment and taxonomy information
>gi|87240796|gb|ABD32654.1| Zinc finger, RING-type [Medicago truncatula] Back     alignment and taxonomy information
>gi|356557951|ref|XP_003547273.1| PREDICTED: uncharacterized protein LOC100804959 [Glycine max] Back     alignment and taxonomy information
>gi|449434396|ref|XP_004134982.1| PREDICTED: uncharacterized protein LOC101211804 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147787228|emb|CAN69131.1| hypothetical protein VITISV_012047 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447765|ref|XP_003594158.1| hypothetical protein MTR_2g025080 [Medicago truncatula] gi|355483206|gb|AES64409.1| hypothetical protein MTR_2g025080 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356532309|ref|XP_003534716.1| PREDICTED: uncharacterized protein LOC100804292 [Glycine max] Back     alignment and taxonomy information
>gi|255554753|ref|XP_002518414.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542259|gb|EEF43801.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:504955313209 AT4G03965 [Arabidopsis thalian 0.334 0.368 0.677 1.5e-41
TAIR|locus:2132016214 AT4G22250 [Arabidopsis thalian 0.334 0.359 0.714 2.5e-39
TAIR|locus:2027094204 AT1G62370 [Arabidopsis thalian 0.321 0.362 0.706 1e-36
TAIR|locus:2086949250 AT3G25030 [Arabidopsis thalian 0.330 0.304 0.579 7.8e-23
TAIR|locus:2123216265 AT4G13100 [Arabidopsis thalian 0.273 0.237 0.647 2.4e-21
TAIR|locus:2098515360 AT3G07120 [Arabidopsis thalian 0.260 0.166 0.483 1.7e-14
TAIR|locus:2082440359 LUL4 "LOG2-LIKE UBIQUITIN LIGA 0.321 0.206 0.337 3.1e-06
TAIR|locus:4515102961399 APD4 "ABERRANT POLLEN DEVELOPM 0.295 0.170 0.309 8.7e-06
TAIR|locus:2042922404 APD3 "ABERRANT POLLEN DEVELOPM 0.295 0.168 0.295 2e-05
UNIPROTKB|A2AAZ474 TRIM39 "E3 ubiquitin-protein l 0.191 0.594 0.361 0.00014
TAIR|locus:504955313 AT4G03965 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 305 (112.4 bits), Expect = 1.5e-41, Sum P(2) = 1.5e-41
 Identities = 63/93 (67%), Positives = 68/93 (73%)

Query:   154 TPLRVSLMRLLAET-EGCDGEEK---------------AGNDSMCCVCMGRKKGAAFIPC 197
             TPL+VSLMRLL ET E    EE                  NDS+CCVCMGRKKGAAFIPC
Sbjct:   117 TPLKVSLMRLLEETAERVVVEENETERVTASASSTVRGVNNDSVCCVCMGRKKGAAFIPC 176

Query:   198 GHTFCRVCSREMWLNRGSCPLCNRSILEILDIF 230
             GHTFCRVCSRE+WLNRGSCPLCNR I+EILDI+
Sbjct:   177 GHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY 209
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2132016 AT4G22250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027094 AT1G62370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086949 AT3G25030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123216 AT4G13100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098515 AT3G07120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082440 LUL4 "LOG2-LIKE UBIQUITIN LIGASE4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102961 APD4 "ABERRANT POLLEN DEVELOPMENT 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042922 APD3 "ABERRANT POLLEN DEVELOPMENT 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A2AAZ4 TRIM39 "E3 ubiquitin-protein ligase TRIM39" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00012825001
SubName- Full=Chromosome undetermined scaffold_404, whole genome shotgun sequence; (239 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 5e-06
smart0018440 smart00184, RING, Ring finger 1e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-05
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.001
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 0.002
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.002
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 48.1 bits (115), Expect = 4e-08
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 178 NDSMCCVCMGRKKGAAFIPCGHT-FCRVCSREMWLNRGSCPLCNRSILEI 226
            D +C +C+ R +   F+PCGH   C  C++ +   +  CP+C + I  +
Sbjct: 1   EDDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSKK-KCPICRQPIESV 49

Length = 49
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.16
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.15
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.08
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.03
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.0
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.0
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.95
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.93
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.93
PHA02929238 N1R/p28-like protein; Provisional 98.93
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.81
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.77
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.73
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.64
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.63
PHA02926242 zinc finger-like protein; Provisional 98.56
PF1463444 zf-RING_5: zinc-RING finger domain 98.56
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.52
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.51
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.51
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.5
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.48
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.45
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.43
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.39
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.39
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.38
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.33
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.21
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.17
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.03
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.02
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.01
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
KOG2660 331 consensus Locus-specific chromosome binding protei 97.81
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.65
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.49
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.39
COG5152259 Uncharacterized conserved protein, contains RING a 97.34
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.24
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.22
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.22
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.09
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.04
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.0
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.96
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.91
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.87
COG5222427 Uncharacterized conserved protein, contains RING Z 96.81
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.77
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.7
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.63
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.46
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.41
COG52191525 Uncharacterized conserved protein, contains RING Z 96.36
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.22
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.04
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.94
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 95.57
PF04641260 Rtf2: Rtf2 RING-finger 95.42
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.42
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.41
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 95.39
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.38
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.1
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.98
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.97
KOG3002 299 consensus Zn finger protein [General function pred 94.74
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.57
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 93.53
KOG1941518 consensus Acetylcholine receptor-associated protei 93.27
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.53
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 92.31
KOG4445 368 consensus Uncharacterized conserved protein, conta 91.38
COG5175 480 MOT2 Transcriptional repressor [Transcription] 90.47
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 90.25
PHA03096284 p28-like protein; Provisional 90.05
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 89.9
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.86
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 89.71
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 88.87
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.62
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 88.59
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 88.47
PHA02862156 5L protein; Provisional 88.16
PHA02825162 LAP/PHD finger-like protein; Provisional 87.74
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 87.26
KOG1940276 consensus Zn-finger protein [General function pred 85.66
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 85.42
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 84.87
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 83.78
COG5109396 Uncharacterized conserved protein, contains RING Z 82.89
KOG3039 303 consensus Uncharacterized conserved protein [Funct 82.03
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 81.05
PF10272358 Tmpp129: Putative transmembrane protein precursor; 80.63
KOG0298 1394 consensus DEAD box-containing helicase-like transc 80.29
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information 
Probab=99.16  E-value=2e-11  Score=82.43  Aligned_cols=48  Identities=29%  Similarity=0.951  Sum_probs=42.7

Q ss_pred             CCcccccCCCccccEEeccCCc-ccHhhHHHHHhCCCCCcccccccccc
Q 026976          179 DSMCCVCMGRKKGAAFIPCGHT-FCRVCSREMWLNRGSCPLCNRSILEI  226 (230)
Q Consensus       179 ~~~C~ICl~~~~~pv~lpCGH~-FC~~Cl~~~l~~~~~CP~CR~~i~~i  226 (230)
                      +..|.||++...+.+++||||. ||..|+.+|+.....||+||++|.++
T Consensus         2 ~~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~~V   50 (50)
T PF13920_consen    2 DEECPICFENPRDVVLLPCGHLCFCEECAERLLKRKKKCPICRQPIESV   50 (50)
T ss_dssp             HSB-TTTSSSBSSEEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-SEE
T ss_pred             cCCCccCCccCCceEEeCCCChHHHHHHhHHhcccCCCCCcCChhhcCC
Confidence            4679999999999999999999 99999999999888999999998764

...
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-10
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-10
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-09
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-08
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 5e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 7e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-07
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 5e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 6e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-06
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 5e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 6e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 8e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 9e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 5e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 4e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 7e-04
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
 Score = 54.5 bits (131), Expect = 2e-10
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 3/61 (4%)

Query: 173 EEKAGNDSMCCVCMGRKKGAAFI--PCGHTF-CRVCSREMWLNRGSCPLCNRSILEILDI 229
           E+       C +C  R +    I    GH   C  C+R +     SCP+C + I  ++ +
Sbjct: 1   EDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKV 60

Query: 230 F 230
           F
Sbjct: 61  F 61
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.35
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.34
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.34
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.33
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.33
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.31
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.31
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.31
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.31
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.3
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.29
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.28
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.28
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.27
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.27
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.26
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.24
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.24
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.24
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.24
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.23
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.22
2ect_A78 Ring finger protein 126; metal binding protein, st 99.22
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.22
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.21
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.21
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.2
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.2
2ea5_A68 Cell growth regulator with ring finger domain prot 99.19
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.18
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.18
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.18
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.17
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.16
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.13
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.12
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.11
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.11
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.1
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.1
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.02
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.0
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.97
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.96
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.95
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.92
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.91
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.82
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.65
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.55
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.51
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.49
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.43
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.2
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.96
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.82
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.58
3nw0_A238 Non-structural maintenance of chromosomes element 96.42
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.91
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.64
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.55
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 90.01
1wil_A89 KIAA1045 protein; ring finger domain, structural g 82.21
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.35  E-value=5.1e-13  Score=96.74  Aligned_cols=52  Identities=21%  Similarity=0.524  Sum_probs=46.8

Q ss_pred             ccCCCCcccccCCCccccEEeccCCcccHhhHHHHHhCCCCCcccccccccc
Q 026976          175 KAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEI  226 (230)
Q Consensus       175 ~~~~~~~C~ICl~~~~~pv~lpCGH~FC~~Cl~~~l~~~~~CP~CR~~i~~i  226 (230)
                      .....+.|+||++.+.+|+.++|||+||..|+..|+.....||+||..+...
T Consensus        11 ~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~   62 (81)
T 2csy_A           11 EEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGI   62 (81)
T ss_dssp             CCCCCSBCSSSCSBCCSEEECTTSCEEEHHHHHHHHHHCSBCSSSCCBCCSC
T ss_pred             cCCCCCCCcCCCchhcCeeEccCCCHhHHHHHHHHHHCCCcCCCcCcccccc
Confidence            3456889999999999999999999999999999999888999999987643
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 5e-07
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 9e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 0.002
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.004
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.6 bits (118), Expect = 4e-09
 Identities = 16/59 (27%), Positives = 19/59 (32%), Gaps = 1/59 (1%)

Query: 173 EEKAGNDSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGS-CPLCNRSILEILDIF 230
            E      +C +C    K     PCGH  C  C      + G  CP C   I     I 
Sbjct: 17  CEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.3
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.28
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.23
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.23
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.21
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.18
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.17
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.16
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.09
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.06
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.03
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.99
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.9
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.82
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.46
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.95
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.76
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.12
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.34  E-value=3.4e-13  Score=96.84  Aligned_cols=51  Identities=27%  Similarity=0.655  Sum_probs=45.2

Q ss_pred             CCcccccCCCccccEEeccCCcccHhhHHHHHhCC-CCCccccccccccccc
Q 026976          179 DSMCCVCMGRKKGAAFIPCGHTFCRVCSREMWLNR-GSCPLCNRSILEILDI  229 (230)
Q Consensus       179 ~~~C~ICl~~~~~pv~lpCGH~FC~~Cl~~~l~~~-~~CP~CR~~i~~il~I  229 (230)
                      ...|+||++.+.++++++|||.||..|+..|+..+ ..||+||..|.....|
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i   74 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPI   74 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCEECHHHHHHHHHTTCCSCTTTCCCCCCCCCS
T ss_pred             CCCCccCCCcCCCeEEeCCCCeeeHHHHHHHHHHCcCcCCCCCcCccCCcee
Confidence            45699999999999999999999999999999854 5899999999876654
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure