Citrus Sinensis ID: 027062

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAVAEAVPISKSLYLDDKKSKNNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
ccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHccEEEEEEcccccHHHHHcccccEEEEccccccccccccHHHHHHHHcccccEEEEcHHHHHHHHHHccEEEEcccccccccccEEEEccccccccccccccccEEEccccccccccccccccEEEEEEccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccc
cHHHHHcHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHcccEEEEccccccHHHHccHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEccEEEcccccEEEEcccccccccccccccEEEEEEEEEEEEcccccHcEEEEEEEccccEEEEEEEcccccEEEcEccccHHccHHHHHHHHHHHHHHHHHHHHHccc
mavaeavpiskslylddkksknnknpiividnydSFTYNLCQYMGelgyhfevyrndeltVEELkrknprgvlispgpgapqdsgislqtvlelgptvplfgvCMGLQcigeafggkivrsplgvmhgksslvyydekgedgllaglsnpftagryHSLViekesfpsdalevtawTEDGLIMAARHKKYkhlqgvqfhpesiittEGKTIVRNFIKMIVRKEAADSQN
mavaeavpiskslylddkksknnknpiivIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKhlqgvqfhpesiittegktIVRNFIKMIVRKEAADSQN
MAVAEAVPIskslylddkkskNNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
************************NPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEE**********************ISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVR********
*************************PIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKM***********
MAVAEAVPISKSLYLDDKKSKNNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
**********************NKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVAEAVPISKSLYLDDKKSKNNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
P48261190 Anthranilate synthase com N/A no 0.820 0.989 0.569 7e-60
P51362189 Anthranilate synthase com N/A no 0.807 0.978 0.515 9e-54
Q08654 589 Anthranilate synthase com yes no 0.812 0.315 0.510 3e-52
Q1XDC5189 Anthranilate synthase com N/A no 0.812 0.984 0.513 5e-52
P00901198 Anthranilate synthase com yes no 0.807 0.934 0.494 2e-50
P20576201 Anthranilate synthase com yes no 0.807 0.920 0.494 6e-49
P28819194 Para-aminobenzoate/anthra yes no 0.834 0.984 0.489 2e-48
P00902194 Anthranilate synthase com yes no 0.812 0.958 0.472 8e-47
P26922196 Anthranilate synthase com yes no 0.842 0.984 0.485 1e-46
P06193187 Para-aminobenzoate syntha yes no 0.807 0.989 0.450 7e-46
>sp|P48261|TRPG_CYAPA Anthranilate synthase component II OS=Cyanophora paradoxa GN=trpG PE=3 SV=1 Back     alignment and function desciption
 Score =  230 bits (586), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 110/193 (56%), Positives = 144/193 (74%), Gaps = 5/193 (2%)

Query: 27  IIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGI 86
           I++IDNYDSFTYNL QY+ EL     V RND++T++E+K  N +G++ISP PG P+DSGI
Sbjct: 2   ILLIDNYDSFTYNLAQYLSELNIKVLVKRNDKITLDEIKNLNIQGIIISPCPGGPEDSGI 61

Query: 87  SLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAG 146
           S   +  LG  +P+ GVC+G Q IG  FGGKI+++P  ++HGK S++++D K   G+   
Sbjct: 62  SQGIIKYLGNQIPILGVCLGHQTIGHVFGGKIIKAP-KLIHGKPSIIFHDGK---GVFQN 117

Query: 147 LSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESIITT 206
           L NP TA RYHSL+IEKES P D LE+TAWTEDGLIM  +HKKYK LQG+QFHPESI+T 
Sbjct: 118 LKNPITATRYHSLIIEKESCP-DELEITAWTEDGLIMGIQHKKYKQLQGIQFHPESILTE 176

Query: 207 EGKTIVRNFIKMI 219
            GK I++NFI  +
Sbjct: 177 SGKQILQNFINCL 189

Cyanophora paradoxa (taxid: 2762)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 2EC: 7
>sp|P51362|TRPG_PORPU Anthranilate synthase component II OS=Porphyra purpurea GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|Q08654|TRPG_THEMA Anthranilate synthase component II OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 Back     alignment and function description
>sp|Q1XDC5|TRPG_PORYE Anthranilate synthase component II OS=Porphyra yezoensis GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|P00901|TRPG_PSEPU Anthranilate synthase component II OS=Pseudomonas putida GN=trpG PE=1 SV=2 Back     alignment and function description
>sp|P20576|TRPG_PSEAE Anthranilate synthase component II OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=4 SV=2 Back     alignment and function description
>sp|P28819|PABA_BACSU Para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II OS=Bacillus subtilis (strain 168) GN=pabA PE=4 SV=1 Back     alignment and function description
>sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter sp. (strain ADP1) GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|P26922|TRPG_AZOBR Anthranilate synthase component 2 OS=Azospirillum brasilense GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|P06193|PABA_SALTY Para-aminobenzoate synthase glutamine amidotransferase component II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabA PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
356558731278 PREDICTED: anthranilate synthase compone 0.903 0.744 0.903 1e-109
356558733272 PREDICTED: anthranilate synthase compone 0.903 0.761 0.903 1e-109
356521181276 PREDICTED: anthranilate synthase compone 0.903 0.75 0.903 1e-108
224108213276 anthranilate synthase, beta subunit, ASB 0.895 0.742 0.898 1e-106
255573238281 Anthranilate synthase component II, puta 0.978 0.797 0.825 1e-106
297845630277 hypothetical protein ARALYDRAFT_472860 [ 0.960 0.794 0.821 1e-106
224101933240 anthranilate synthase, beta subunit, ASB 0.890 0.85 0.901 1e-105
217072976270 unknown [Medicago truncatula] gi|3884985 0.912 0.774 0.861 1e-105
225424454285 PREDICTED: anthranilate synthase compone 0.951 0.764 0.816 1e-105
15222532276 anthranilate synthase beta subunit 1 [Ar 0.895 0.742 0.863 1e-104
>gi|356558731|ref|XP_003547656.1| PREDICTED: anthranilate synthase component II-like isoform 1 [Glycine max] Back     alignment and taxonomy information
 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 196/207 (94%)

Query: 21  KNNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGA 80
           K+N NPI+VIDNYDSFTYNLCQYMGELG+HFEVYRNDELTVEEL+RKNPRGVLISPGPG 
Sbjct: 72  KSNNNPIVVIDNYDSFTYNLCQYMGELGFHFEVYRNDELTVEELRRKNPRGVLISPGPGE 131

Query: 81  PQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGE 140
           PQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSP GVMHGKSS+VYYDEKGE
Sbjct: 132 PQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPHGVMHGKSSMVYYDEKGE 191

Query: 141 DGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHP 200
           DGLLAGLSNPF AGRYHSLVIEKESFP D LE TAWTEDGLIMAARHKKYKHLQGVQFHP
Sbjct: 192 DGLLAGLSNPFLAGRYHSLVIEKESFPHDELEATAWTEDGLIMAARHKKYKHLQGVQFHP 251

Query: 201 ESIITTEGKTIVRNFIKMIVRKEAADS 227
           ESIIT EGKTIVRNF+K+I ++EA  S
Sbjct: 252 ESIITPEGKTIVRNFVKLIEKREAGGS 278

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356558733|ref|XP_003547657.1| PREDICTED: anthranilate synthase component II-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356521181|ref|XP_003529236.1| PREDICTED: anthranilate synthase component II-like [Glycine max] Back     alignment and taxonomy information
>gi|224108213|ref|XP_002314761.1| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573238|ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297845630|ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224101933|ref|XP_002312481.1| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa] gi|222852301|gb|EEE89848.1| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|217072976|gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225424454|ref|XP_002281633.1| PREDICTED: anthranilate synthase component II-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15222532|ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|11067285|gb|AAG28813.1|AC079374_16 anthranilate synthase beta subunit [Arabidopsis thaliana] gi|403434|gb|AAA32742.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|20466736|gb|AAM20685.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|30023756|gb|AAP13411.1| At1g25220 [Arabidopsis thaliana] gi|110741096|dbj|BAE98642.1| hypothetical protein [Arabidopsis thaliana] gi|332192468|gb|AEE30589.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2174378273 AT5G57890 [Arabidopsis thalian 0.886 0.743 0.871 8.4e-97
TAIR|locus:2826092222 AT1G24909 [Arabidopsis thalian 0.868 0.896 0.879 2e-95
TAIR|locus:2826077222 AT1G25083 [Arabidopsis thalian 0.868 0.896 0.879 2e-95
TAIR|locus:2825965222 AT1G25155 [Arabidopsis thalian 0.868 0.896 0.879 2e-95
TAIR|locus:2826037235 AT1G24807 [Arabidopsis thalian 0.868 0.846 0.825 6.3e-92
TIGR_CMR|CHY_1586189 CHY_1586 "para-aminobenzoate/a 0.807 0.978 0.507 5.2e-49
TIGR_CMR|BA_0069195 BA_0069 "para-aminobenzoate sy 0.807 0.948 0.492 1.4e-48
UNIPROTKB|Q5LRH9193 trpG "Anthranilate synthase co 0.816 0.968 0.520 4.7e-48
TIGR_CMR|SPO_2149193 SPO_2149 "anthranilate synthas 0.816 0.968 0.520 4.7e-48
UNIPROTKB|Q74AH3190 trpG "Anthranilate synthase, g 0.812 0.978 0.494 7.7e-48
TAIR|locus:2174378 AT5G57890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 962 (343.7 bits), Expect = 8.4e-97, P = 8.4e-97
 Identities = 177/203 (87%), Positives = 191/203 (94%)

Query:    22 NNKNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAP 81
             N+  PIIVIDNYDSFTYNLCQYMGELG HFEVYRNDELTVEELKRK PRG+LISPGPG P
Sbjct:    67 NSSGPIIVIDNYDSFTYNLCQYMGELGCHFEVYRNDELTVEELKRKKPRGLLISPGPGTP 126

Query:    82 QDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGED 141
             QDSGISLQTVLELGP VPLFGVCMGLQCIGEAFGGKIVRSP GVMHGKSS+V+YDEKGE+
Sbjct:   127 QDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSMVHYDEKGEE 186

Query:   142 GLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPE 201
             GL +GLSNPF  GRYHSLVIEK+SFPSD LEVTAWTEDGL+MAARH+KYKH+QGVQFHPE
Sbjct:   187 GLFSGLSNPFLVGRYHSLVIEKDSFPSDELEVTAWTEDGLVMAARHRKYKHIQGVQFHPE 246

Query:   202 SIITTEGKTIVRNFIKMIVRKEA 224
             SIITTEGKTIVRNFIK++ +KE+
Sbjct:   247 SIITTEGKTIVRNFIKLVEKKES 269
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0000162 "tryptophan biosynthetic process" evidence=TAS
GO:0004049 "anthranilate synthase activity" evidence=IGI
GO:0009617 "response to bacterium" evidence=IEP
TAIR|locus:2826092 AT1G24909 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826077 AT1G25083 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825965 AT1G25155 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826037 AT1G24807 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1586 CHY_1586 "para-aminobenzoate/anthranilate synthase glutamine amidotransferase, component II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0069 BA_0069 "para-aminobenzoate synthase glutamine amidotransferase, component II" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LRH9 trpG "Anthranilate synthase component II" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2149 SPO_2149 "anthranilate synthase component II" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AH3 trpG "Anthranilate synthase, glutamine amidotransferase subunit" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00902TRPG_ACIAD4, ., 1, ., 3, ., 2, 70.47200.81220.9587yesno
P00901TRPG_PSEPU4, ., 1, ., 3, ., 2, 70.49480.80780.9343yesno
P28819PABA_BACSU4, ., 1, ., 3, ., 2, 70.48980.83400.9845yesno
Q02003TRPG_LACLA4, ., 1, ., 3, ., 2, 70.40200.81220.9393yesno
P26922TRPG_AZOBR4, ., 1, ., 3, ., 2, 70.4850.84270.9846yesno
P06193PABA_SALTY2, ., 6, ., 1, ., 8, 50.45020.80780.9893yesno
P51362TRPG_PORPU4, ., 1, ., 3, ., 2, 70.51570.80780.9788N/Ano
P48261TRPG_CYAPA4, ., 1, ., 3, ., 2, 70.56990.82090.9894N/Ano
O27693TRPG_METTH4, ., 1, ., 3, ., 2, 70.43780.80340.9387yesno
P71381TRPG_HAEIN4, ., 1, ., 3, ., 2, 70.36680.81650.9689yesno
Q5V632TRPG2_HALMA4, ., 1, ., 3, ., 2, 70.43650.81220.9789yesno
P20576TRPG_PSEAE4, ., 1, ., 3, ., 2, 70.49480.80780.9203yesno
Q1XDC5TRPG_PORYE4, ., 1, ., 3, ., 2, 70.51300.81220.9841N/Ano
Q06129TRPG_SULSO4, ., 1, ., 3, ., 2, 70.43580.82090.9641yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.3.270.914
3rd Layer4.1.30.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN02335222 PLN02335, PLN02335, anthranilate synthase 1e-157
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 1e-103
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 2e-95
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 1e-92
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 2e-91
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilat 1e-78
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 3e-78
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase co 5e-74
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 1e-67
PRK08007187 PRK08007, PRK08007, para-aminobenzoate synthase co 1e-66
TIGR00566188 TIGR00566, trpG_papA, glutamine amidotransferase o 2e-66
PRK06774191 PRK06774, PRK06774, para-aminobenzoate synthase co 2e-65
PRK08857193 PRK08857, PRK08857, para-aminobenzoate synthase co 1e-62
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisi 3e-49
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alp 8e-37
PRK09522 531 PRK09522, PRK09522, bifunctional glutamine amidotr 7e-36
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase 4e-33
PRK05637208 PRK05637, PRK05637, anthranilate synthase componen 3e-30
PLN02889 918 PLN02889, PLN02889, oxo-acid-lyase/anthranilate sy 9e-27
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 3e-26
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 3e-24
TIGR01823 742 TIGR01823, PabB-fungal, aminodeoxychorismate synth 3e-23
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 8e-22
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Valida 6e-20
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 3e-17
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 5e-16
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt 3e-14
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase s 3e-14
cd01741188 cd01741, GATase1_1, Subgroup of proteins having th 2e-13
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase s 5e-12
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small s 2e-11
PLN02771415 PLN02771, PLN02771, carbamoyl-phosphate synthase ( 3e-11
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase argin 4e-11
cd01745189 cd01745, GATase1_2, Subgroup of proteins having th 1e-10
COG2071243 COG2071, COG2071, Predicted glutamine amidotransfe 7e-10
PLN02347 536 PLN02347, PLN02347, GMP synthetase 4e-09
PRK09065237 PRK09065, PRK09065, glutamine amidotransferase; Pr 5e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 1e-07
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 2e-07
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 2e-07
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phos 7e-06
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino a 4e-04
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synth 0.002
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information 
 Score =  433 bits (1116), Expect = e-157
 Identities = 180/201 (89%), Positives = 190/201 (94%)

Query: 24  KNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQD 83
             PIIVIDNYDSFTYNLCQYMGELG HFEVYRNDELTVEELKRKNPRGVLISPGPG PQD
Sbjct: 18  NGPIIVIDNYDSFTYNLCQYMGELGCHFEVYRNDELTVEELKRKNPRGVLISPGPGTPQD 77

Query: 84  SGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGL 143
           SGISLQTVLELGP VPLFGVCMGLQCIGEAFGGKIVRSP GVMHGKSS V+YDEKGE+GL
Sbjct: 78  SGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSPVHYDEKGEEGL 137

Query: 144 LAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESI 203
            +GL NPFTAGRYHSLVIEK++FPSD LEVTAWTEDGLIMAARH+KYKH+QGVQFHPESI
Sbjct: 138 FSGLPNPFTAGRYHSLVIEKDTFPSDELEVTAWTEDGLIMAARHRKYKHIQGVQFHPESI 197

Query: 204 ITTEGKTIVRNFIKMIVRKEA 224
           ITTEGKTIVRNFIK+I +KE+
Sbjct: 198 ITTEGKTIVRNFIKIIEKKES 218

Length = 222
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|214365 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|233027 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>gnl|CDD|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|237429 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|180178 PRK05637, PRK05637, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|215481 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|233588 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223579 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|224982 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|215197 PLN02347, PLN02347, GMP synthetase Back     alignment and domain information
>gnl|CDD|181635 PRK09065, PRK09065, glutamine amidotransferase; Provisional Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|219535 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|233601 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|223196 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237288 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 100.0
PLN02335222 anthranilate synthase 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisio 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 100.0
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 100.0
PRK05670189 anthranilate synthase component II; Provisional 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisio 100.0
PRK06895190 putative anthranilate synthase component II; Provi 100.0
PRK08857193 para-aminobenzoate synthase component II; Provisio 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 100.0
PRK07765214 para-aminobenzoate synthase component II; Provisio 100.0
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 100.0
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 100.0
PLN02347 536 GMP synthetase 100.0
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 100.0
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 100.0
PRK00074 511 guaA GMP synthase; Reviewed 100.0
PLN02889 918 oxo-acid-lyase/anthranilate synthase 100.0
PRK13566720 anthranilate synthase; Provisional 100.0
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 100.0
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 100.0
PRK12564360 carbamoyl phosphate synthase small subunit; Review 100.0
PRK12838354 carbamoyl phosphate synthase small subunit; Review 100.0
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 100.0
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 100.0
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 100.0
PRK09065237 glutamine amidotransferase; Provisional 100.0
PRK06490239 glutamine amidotransferase; Provisional 100.0
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 100.0
PRK07567242 glutamine amidotransferase; Provisional 100.0
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 100.0
PRK05665240 amidotransferase; Provisional 100.0
PRK07053234 glutamine amidotransferase; Provisional 100.0
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 100.0
PRK08250235 glutamine amidotransferase; Provisional 100.0
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 100.0
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.98
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.98
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.97
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.97
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.97
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.97
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.97
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.97
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.97
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.97
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.97
COG2071243 Predicted glutamine amidotransferases [General fun 99.97
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.97
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.96
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.96
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.96
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 99.96
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.96
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.95
PRK06186229 hypothetical protein; Validated 99.95
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.95
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 99.94
PRK05380533 pyrG CTP synthetase; Validated 99.94
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.94
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.93
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.93
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.92
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.92
PLN02327557 CTP synthase 99.92
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.92
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.92
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.91
PRK05368302 homoserine O-succinyltransferase; Provisional 99.9
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.89
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.84
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.82
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.8
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.79
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.78
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.76
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.72
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.67
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 99.65
COG0311194 PDX2 Predicted glutamine amidotransferase involved 99.6
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 99.53
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 99.53
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 99.4
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 99.39
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 99.37
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 99.32
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 99.19
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 99.14
PHA033661304 FGAM-synthase; Provisional 99.13
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 99.06
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.95
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 98.92
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 98.85
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.82
PRK00784488 cobyric acid synthase; Provisional 98.57
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 98.5
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 98.46
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.36
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 98.35
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 98.22
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 98.19
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 98.17
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 98.16
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 98.04
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 97.98
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 97.96
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 97.9
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 97.89
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 97.81
TIGR00313475 cobQ cobyric acid synthase CobQ. 97.78
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 97.72
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.66
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 97.62
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 97.46
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 97.44
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.41
PRK11574196 oxidative-stress-resistance chaperone; Provisional 97.38
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 97.37
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 97.31
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 97.31
COG3442250 Predicted glutamine amidotransferase [General func 97.22
PRK04155287 chaperone protein HchA; Provisional 97.2
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 97.2
PRK11249752 katE hydroperoxidase II; Provisional 97.18
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 97.14
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 97.03
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 97.0
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 96.85
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 96.83
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 96.77
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 96.65
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 96.1
KOG2764247 consensus Putative transcriptional regulator DJ-1 96.07
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 96.0
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 95.76
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.51
PRK03708277 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.37
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.27
PRK02155291 ppnK NAD(+)/NADH kinase family protein; Provisiona 95.13
PRK03372306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.07
PRK01911292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 95.05
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 95.0
PRK09393322 ftrA transcriptional activator FtrA; Provisional 94.11
COG3340224 PepE Peptidase E [Amino acid transport and metabol 93.61
PF00072112 Response_reg: Response regulator receiver domain; 93.47
PLN02929301 NADH kinase 93.38
TIGR02069250 cyanophycinase cyanophycinase. This model describe 93.34
PRK01231295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 93.27
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 93.2
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 93.17
PRK14077287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 93.08
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 92.78
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.39
COG4090154 Uncharacterized protein conserved in archaea [Func 92.29
PRK14075256 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 92.2
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 91.83
PF09897147 DUF2124: Uncharacterized protein conserved in arch 91.38
KOG1467556 consensus Translation initiation factor 2B, delta 91.09
smart00852135 MoCF_biosynth Probable molybdopterin binding domai 90.66
PRK01185271 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.27
PRK02645305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.73
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 89.63
PLN02727986 NAD kinase 89.4
PRK14076569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 89.3
PRK02231272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 89.25
PRK00561259 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 88.57
PLN02935508 Bifunctional NADH kinase/NAD(+) kinase 87.7
PRK14690419 molybdopterin biosynthesis protein MoeA; Provision 86.72
PF01513285 NAD_kinase: ATP-NAD kinase; InterPro: IPR002504 Me 86.26
PRK09468239 ompR osmolarity response regulator; Provisional 86.07
TIGR00177144 molyb_syn molybdenum cofactor synthesis domain. Th 85.25
COG2204 464 AtoC Response regulator containing CheY-like recei 84.8
PRK03501264 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 84.7
cd00758133 MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) bindin 84.59
CHL00148240 orf27 Ycf27; Reviewed 84.5
PRK15029 755 arginine decarboxylase; Provisional 84.19
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 84.14
PF0369880 UPF0180: Uncharacterised protein family (UPF0180); 83.9
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 83.84
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 83.32
COG0303404 MoeA Molybdopterin biosynthesis enzyme [Coenzyme m 83.12
cd00886152 MogA_MoaB MogA_MoaB family. Members of this family 81.82
cd00885170 cinA Competence-damaged protein. CinA is the first 81.75
PLN03029222 type-a response regulator protein; Provisional 81.57
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 81.46
COG4977328 Transcriptional regulator containing an amidase do 81.08
PRK13435145 response regulator; Provisional 80.63
PRK11083228 DNA-binding response regulator CreB; Provisional 80.28
smart0044855 REC cheY-homologous receiver domain. CheY regulate 80.21
COG4285253 Uncharacterized conserved protein [Function unknow 80.13
PRK06703151 flavodoxin; Provisional 80.03
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=5.8e-47  Score=292.01  Aligned_cols=189  Identities=53%  Similarity=0.943  Sum_probs=171.3

Q ss_pred             CceEEEEECCCchhHHHHHHHHHcCCEEEEEeCCccCHHHHhccCCCEEEECCCCCCCCCcchHHHHHHHhCCCCcEEEE
Q 027062           24 KNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGV  103 (229)
Q Consensus        24 ~~~ilvid~~~~~~~~~~~~l~~~g~~~~v~~~~~~~~~~l~~~~~dgiii~GG~~~~~~~~~~~~~i~~~~~~~PvlGI  103 (229)
                      +++||+|||||||+.++++.++++|.++.+++++..+.++++..++|+|||++||++|.+.+...+.++++..++|+|||
T Consensus         1 ~~~IL~IDNyDSFtyNLv~yl~~lg~~v~V~rnd~~~~~~~~~~~pd~iviSPGPG~P~d~G~~~~~i~~~~~~~PiLGV   80 (191)
T COG0512           1 MMMILLIDNYDSFTYNLVQYLRELGAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKDAGISLELIRRFAGRIPILGV   80 (191)
T ss_pred             CceEEEEECccchHHHHHHHHHHcCCceEEEECCccCHHHHhhcCCCEEEEcCCCCChHHcchHHHHHHHhcCCCCEEEE
Confidence            36899999999999999999999999999999886777778877899999999999999999888999888778999999


Q ss_pred             ehhHHHHHHHhCCeeeecCCccccCccceeEeccCCCCcccccCCCceeeeeeeceeeeccCCCCCCeEEEEEcCCC-ce
Q 027062          104 CMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDG-LI  182 (229)
Q Consensus       104 C~G~Qlla~alGg~v~~~~~~~~~g~~~~~~~~~~~~~~l~~~l~~~~~~~~~H~~~v~~~~l~~~~~~~la~~~~~-~i  182 (229)
                      |+|||.|++++||+|.+.+ ...||+...+...   .+.+|+++|++|.+..||+..+.++.+ |+.++++|+++++ .|
T Consensus        81 CLGHQai~~~fGg~V~~a~-~~~HGK~s~i~h~---g~~iF~glp~~f~v~RYHSLvv~~~~l-P~~l~vtA~~~d~~~I  155 (191)
T COG0512          81 CLGHQAIAEAFGGKVVRAK-EPMHGKTSIITHD---GSGLFAGLPNPFTVTRYHSLVVDPETL-PEELEVTAESEDGGVI  155 (191)
T ss_pred             CccHHHHHHHhCCEEEecC-CCcCCeeeeeecC---CcccccCCCCCCEEEeeEEEEecCCCC-CCceEEEEEeCCCCEE
Confidence            9999999999999999998 5679988744332   478999999999999999999987666 4899999998664 99


Q ss_pred             EEEEeCCCCcEEEEeccCCCCCCCchHHHHHHHHHH
Q 027062          183 MAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKM  218 (229)
Q Consensus       183 ~a~~~~~~~~i~g~QfHPE~~~~~~~~~i~~~f~~~  218 (229)
                      +|++|+++| ++|+|||||+..++.|.+|++||++.
T Consensus       156 Mai~h~~~p-i~gvQFHPESilT~~G~~il~Nfl~~  190 (191)
T COG0512         156 MAVRHKKLP-IYGVQFHPESILTEYGHRILENFLRL  190 (191)
T ss_pred             EEEeeCCCC-EEEEecCCccccccchHHHHHHHHhh
Confidence            999999998 99999999999999999999999975

>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PLN02929 NADH kinase Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG4090 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09897 DUF2124: Uncharacterized protein conserved in archaea (DUF2124); InterPro: IPR009183 There are currently no experimental data for members of this group of archaeal proteins, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00852 MoCF_biosynth Probable molybdopterin binding domain Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02935 Bifunctional NADH kinase/NAD(+) kinase Back     alignment and domain information
>PRK14690 molybdopterin biosynthesis protein MoeA; Provisional Back     alignment and domain information
>PF01513 NAD_kinase: ATP-NAD kinase; InterPro: IPR002504 Members of this family are ATP-NAD kinases 2 Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>TIGR00177 molyb_syn molybdenum cofactor synthesis domain Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd00758 MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) binding domain (BD) Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd00886 MogA_MoaB MogA_MoaB family Back     alignment and domain information
>cd00885 cinA Competence-damaged protein Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1qdl_B195 The Crystal Structure Of Anthranilate Synthase From 8e-38
1i7q_B193 Anthranilate Synthase From S. Marcescens Length = 1 1e-29
1i1q_B192 Structure Of The Cooperative Allosteric Anthranilat 4e-27
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 7e-14
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 9e-14
1gpm_A 525 Escherichia Coli Gmp Synthetase Complexed With Amp 1e-12
2ywb_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 2e-09
2ywc_A 503 Crystal Structure Of Gmp Synthetase From Thermus Th 3e-09
1m6v_B382 Crystal Structure Of The G359f (Small Subunit) Poin 1e-07
1t36_B382 Crystal Structure Of E. Coli Carbamoyl Phosphate Sy 1e-07
2vpi_A218 Human Gmp Synthetase - Glutaminase Domain Length = 2e-07
1jdb_C382 Carbamoyl Phosphate Synthetase From Escherichia Col 3e-07
2vxo_A 697 Human Gmp Synthetase In Complex With Xmp Length = 6 5e-07
3tqi_A 527 Structure Of The Gmp Synthase (Guaa) From Coxiella 3e-06
1c30_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 5e-06
1cs0_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 7e-06
3r74_A645 Crystal Structure Of 2-Amino-2-Desoxyisochorismate 1e-05
2a9v_A212 Crystal Structure Of A Putative Gmp Synthase Subuni 1e-05
1a9x_B379 Carbamoyl Phosphate Synthetase: Caught In The Act O 4e-05
3uow_A 556 Crystal Structure Of Pf10_0123, A Gmp Synthetase Fr 9e-05
3r75_A645 Crystal Structure Of 2-Amino-2-Desoxyisochorismate 2e-04
>pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195 Back     alignment and structure 
Iteration: 1

 Score =  153 bits (386), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 120/195 (61%), Gaps = 7/195 (3%)
Query: 28  IVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAP---QDS 84
           ++IDNYDSF YN+ Q +GELG +  V RNDE++++ ++R +P  ++ISPGPG P   +D 
Sbjct: 5   LIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDI 64
Query: 85  GISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLL 144
           G+SL  +  LG   P+ GVC+G Q IG AFG KI R    V HGK S +         L 
Sbjct: 65  GVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKI-RRARKVFHGKISNIILVNNSPLSLY 123
Query: 145 AGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESII 204
            G++  F A RYHSLV+++   P     ++A  ED  IMA  H++Y  + GVQFHPES+ 
Sbjct: 124 YGIAKEFKATRYHSLVVDEVHRPLIVDAISA--EDNEIMAIHHEEYP-IYGVQFHPESVG 180
Query: 205 TTEGKTIVRNFIKMI 219
           T+ G  I+ NF+  +
Sbjct: 181 TSLGYKILYNFLNRV 195
>pdb|1I7Q|B Chain B, Anthranilate Synthase From S. Marcescens Length = 193 Back     alignment and structure
>pdb|1I1Q|B Chain B, Structure Of The Cooperative Allosteric Anthranilate Synthase From Salmonella Typhimurium Length = 192 Back     alignment and structure
>pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure
>pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure
>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525 Back     alignment and structure
>pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
>pdb|1M6V|B Chain B, Crystal Structure Of The G359f (Small Subunit) Point Mutant Of Carbamoyl Phosphate Synthetase Length = 382 Back     alignment and structure
>pdb|1T36|B Chain B, Crystal Structure Of E. Coli Carbamoyl Phosphate Synthetase Small Subunit Mutant C248d Complexed With Uridine 5'-Monophosphate Length = 382 Back     alignment and structure
>pdb|2VPI|A Chain A, Human Gmp Synthetase - Glutaminase Domain Length = 218 Back     alignment and structure
>pdb|1JDB|C Chain C, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 382 Back     alignment and structure
>pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
>pdb|3TQI|A Chain A, Structure Of The Gmp Synthase (Guaa) From Coxiella Burnetii Length = 527 Back     alignment and structure
>pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small Subunit Mutation C269s Length = 382 Back     alignment and structure
>pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase Complexed At Cys269 In The Small Subunit With The Tetrahedral Mimic L-glutamate Gamma-semialdehyde Length = 382 Back     alignment and structure
>pdb|3R74|A Chain A, Crystal Structure Of 2-Amino-2-Desoxyisochorismate Synthase (Adic) Synthase Phze From Burkholderia Lata 383 Length = 645 Back     alignment and structure
>pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45 A Resolution Length = 212 Back     alignment and structure
>pdb|1A9X|B Chain B, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 379 Back     alignment and structure
>pdb|3UOW|A Chain A, Crystal Structure Of Pf10_0123, A Gmp Synthetase From Plasmodium Falciparum Length = 556 Back     alignment and structure
>pdb|3R75|A Chain A, Crystal Structure Of 2-Amino-2-Desoxyisochorismate Synthase (Adic) Synthase Phze From Burkholderia Lata 383 In Complex With Benzoate, Pyruvate, Glutamine And Contaminating Zn2+ Length = 645 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 1e-108
1i1q_B192 Anthranilate synthase component II; tryptophan bio 1e-104
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 4e-44
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 2e-30
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 3e-21
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 4e-21
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 5e-21
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 8e-21
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 9e-21
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 2e-19
2a9v_A212 GMP synthase; structural genomics, joint center fo 2e-17
3uow_A 556 GMP synthetase; structural genomics consortium, SG 2e-17
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 2e-14
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 5e-11
3l7n_A236 Putative uncharacterized protein; glutamine amidot 1e-10
3m3p_A250 Glutamine amido transferase; structural genomics, 2e-10
1q7r_A219 Predicted amidotransferase; structural genomics, Y 3e-10
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 1e-09
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 2e-09
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 2e-08
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 4e-08
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 5e-06
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
 Score =  308 bits (792), Expect = e-108
 Identities = 84/196 (42%), Positives = 121/196 (61%), Gaps = 7/196 (3%)

Query: 27  IIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAP---QD 83
            ++IDNYDSF YN+ Q +GELG +  V RNDE++++ ++R +P  ++ISPGPG P   +D
Sbjct: 4   TLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKRED 63

Query: 84  SGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGL 143
            G+SL  +  LG   P+ GVC+G Q IG AFG KI R+   V HGK S +         L
Sbjct: 64  IGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARK-VFHGKISNIILVNNSPLSL 122

Query: 144 LAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESI 203
             G++  F A RYHSLV+++   P   ++  +  ED  IMA  H++Y  + GVQFHPES+
Sbjct: 123 YYGIAKEFKATRYHSLVVDEVHRP-LIVDAISA-EDNEIMAIHHEEYP-IYGVQFHPESV 179

Query: 204 ITTEGKTIVRNFIKMI 219
            T+ G  I+ NF+  +
Sbjct: 180 GTSLGYKILYNFLNRV 195
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Length = 191 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Length = 219 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Length = 196 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Length = 379 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Length = 186 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Length = 208 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Length = 227 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 100.0
1i1q_B192 Anthranilate synthase component II; tryptophan bio 100.0
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 100.0
2a9v_A212 GMP synthase; structural genomics, joint center fo 100.0
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 100.0
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 100.0
3uow_A 556 GMP synthetase; structural genomics consortium, SG 100.0
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 100.0
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 100.0
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 100.0
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 100.0
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 100.0
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 100.0
3m3p_A250 Glutamine amido transferase; structural genomics, 100.0
3l7n_A236 Putative uncharacterized protein; glutamine amidot 100.0
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 100.0
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 100.0
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.97
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.97
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.97
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.97
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.97
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.97
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.96
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.96
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.96
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.95
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.95
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.95
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.94
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.94
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.92
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.92
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.91
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.91
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.59
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 98.79
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 98.69
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 98.49
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 98.47
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 98.23
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 98.22
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 98.05
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 98.01
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 97.96
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 97.96
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 97.95
3cne_A175 Putative protease I; structural genomics, PSI-2, M 97.78
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 97.76
2fex_A188 Conserved hypothetical protein; structural genomic 97.75
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 97.75
1u9c_A224 APC35852; structural genomics, protein structure i 97.74
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 97.72
3gra_A202 Transcriptional regulator, ARAC family; transcript 97.71
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 97.66
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 97.63
3n7t_A247 Macrophage binding protein; seattle structural gen 97.6
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 97.58
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 97.56
3er6_A209 Putative transcriptional regulator protein; struct 97.52
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 97.39
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 97.37
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 97.35
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 97.31
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 97.27
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 97.25
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 97.22
3mgk_A211 Intracellular protease/amidase related enzyme (THI 96.95
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 96.88
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 96.82
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 96.75
2qxy_A142 Response regulator; regulation of transcription, N 95.76
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; A 95.49
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 95.46
2rdm_A132 Response regulator receiver protein; structural ge 95.41
3grc_A140 Sensor protein, kinase; protein structure initiati 95.34
1t0b_A252 THUA-like protein; trehalose metabolism, NCS symme 94.9
2pln_A137 HP1043, response regulator; signaling protein; 1.8 94.68
3h5i_A140 Response regulator/sensory box protein/ggdef domai 94.65
3snk_A135 Response regulator CHEY-like protein; P-loop conta 94.64
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 94.63
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 94.55
3gt7_A154 Sensor protein; structural genomics, signal receiv 94.5
3cg4_A142 Response regulator receiver domain protein (CHEY-; 94.42
3cnb_A143 DNA-binding response regulator, MERR family; signa 94.24
3lte_A132 Response regulator; structural genomics, PSI, prot 94.07
2qr3_A140 Two-component system response regulator; structura 94.07
2rjn_A154 Response regulator receiver:metal-dependent phosph 94.04
2zay_A147 Response regulator receiver protein; structural ge 94.01
3cg0_A140 Response regulator receiver modulated diguanylate 93.99
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 93.84
3i42_A127 Response regulator receiver domain protein (CHEY- 93.74
3jte_A143 Response regulator receiver protein; structural ge 93.73
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 93.67
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 93.52
3hdg_A137 Uncharacterized protein; two-component sensor acti 93.44
2gkg_A127 Response regulator homolog; social motility, recei 93.4
3lua_A140 Response regulator receiver protein; two-component 93.38
3cz5_A153 Two-component response regulator, LUXR family; str 93.2
3f6c_A134 Positive transcription regulator EVGA; structural 93.19
2an1_A292 Putative kinase; structural genomics, PSI, protein 93.18
3kto_A136 Response regulator receiver protein; PSI-II,struct 93.15
4e5v_A281 Putative THUA-like protein; THUA-like proteins, tr 93.11
3nhm_A133 Response regulator; protein structure initiative I 92.79
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 92.67
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 92.61
2ayx_A254 Sensor kinase protein RCSC; two independent struct 92.37
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 92.35
2lpm_A123 Two-component response regulator; transcription re 92.27
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 92.06
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 91.92
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 91.85
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 91.8
3cfy_A137 Putative LUXO repressor protein; structural genomi 91.74
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 91.52
4dad_A146 Putative pilus assembly-related protein; response 91.45
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 91.16
3crn_A132 Response regulator receiver domain protein, CHEY-; 91.05
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 91.05
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 91.0
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 90.57
3a10_A116 Response regulator; phosphoacceptor, signaling pro 90.57
1srr_A124 SPO0F, sporulation response regulatory protein; as 90.51
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 90.41
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 90.38
2qsj_A154 DNA-binding response regulator, LUXR family; struc 90.37
3r0j_A250 Possible two component system response transcript 90.33
3hdv_A136 Response regulator; PSI-II, structural genomics, P 90.23
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 89.98
1ys7_A233 Transcriptional regulatory protein PRRA; response 89.8
3kbq_A172 Protein TA0487; structural genomics, CINA, protein 89.59
2gwr_A238 DNA-binding response regulator MTRA; two-component 89.32
1yio_A208 Response regulatory protein; transcription regulat 89.18
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 89.09
1mvo_A136 PHOP response regulator; phosphate regulon, transc 88.88
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 88.83
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 88.26
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 88.14
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 88.07
1xhf_A123 DYE resistance, aerobic respiration control protei 87.82
2hqr_A223 Putative transcriptional regulator; phosporylation 87.75
2r47_A157 Uncharacterized protein MTH_862; unknown function, 87.41
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 87.35
3rqi_A184 Response regulator protein; structural genomics, s 87.08
2qv0_A143 Protein MRKE; structural genomics, transcription, 86.95
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 86.59
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 86.11
3c3m_A138 Response regulator receiver protein; structural ge 86.08
3rfq_A185 Pterin-4-alpha-carbinolamine dehydratase MOAB2; st 85.97
3pzy_A164 MOG; ssgcid, seattle structural genomics center fo 85.85
3iwt_A178 178AA long hypothetical molybdenum cofactor biosy 85.74
3heb_A152 Response regulator receiver domain protein (CHEY); 85.68
3eq2_A 394 Probable two-component response regulator; adaptor 85.61
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 85.5
3n53_A140 Response regulator receiver modulated diguanylate; 85.48
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 84.46
3eul_A152 Possible nitrate/nitrite response transcriptional 84.4
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 84.24
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 83.69
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 83.63
3pfn_A 365 NAD kinase; structural genomics consortium, SNP, S 83.5
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 83.45
1mb3_A124 Cell division response regulator DIVK; signal tran 83.02
3q9s_A249 DNA-binding response regulator; DNA binding protei 82.92
3eqz_A135 Response regulator; structural genomics, unknown f 82.64
1mkz_A172 Molybdenum cofactor biosynthesis protein B; MAD, W 82.64
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 82.6
1zgz_A122 Torcad operon transcriptional regulatory protein; 82.39
1rtt_A193 Conserved hypothetical protein; protein structure 82.13
1y5e_A169 Molybdenum cofactor biosynthesis protein B; struct 82.1
2zki_A199 199AA long hypothetical Trp repressor binding prot 81.98
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 81.7
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 81.63
2bon_A332 Lipid kinase; DAG kinase, transferase; 1.90A {Esch 81.44
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 81.38
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 80.7
3c97_A140 Signal transduction histidine kinase; structural g 80.44
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 80.43
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
Probab=100.00  E-value=1e-41  Score=270.82  Aligned_cols=184  Identities=45%  Similarity=0.761  Sum_probs=157.3

Q ss_pred             EEEEECCCchhHHHHHHHHHcCCEEEEEeCCccCHHHHhccCCCEEEECCCCCCCCCcc--hH-HHHHHHhCCCCcEEEE
Q 027062           27 IIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSG--IS-LQTVLELGPTVPLFGV  103 (229)
Q Consensus        27 ilvid~~~~~~~~~~~~l~~~g~~~~v~~~~~~~~~~l~~~~~dgiii~GG~~~~~~~~--~~-~~~i~~~~~~~PvlGI  103 (229)
                      |+|||+++++..++.++|+++|+++.+++.++.+.++++..++|||||+||++++.+..  .+ .+.+++.+.++|+|||
T Consensus         4 i~iid~~~s~~~~~~~~l~~~G~~~~v~~~~~~~~~~~~~~~~dglil~gG~~~~~~~~~~~~~~~~i~~~~~~~PvLGI   83 (195)
T 1qdl_B            4 TLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGV   83 (195)
T ss_dssp             EEEEECSCSSHHHHHHHHHHTTCEEEEEETTTSCHHHHHHHCCSEEEECCCSSCTTSHHHHTTHHHHHHHHTTTSCEEEE
T ss_pred             EEEEECCCchHHHHHHHHHhCCCEEEEEeCCCCCHHHHhhCCCCEEEECCCCCChhhhhhhhHHHHHHHHhcCCCcEEEE
Confidence            99999999999999999999999999999865556677655789999999999987642  23 3555556778999999


Q ss_pred             ehhHHHHHHHhCCeeeecCCccccCccceeEeccCCCC--cccccCCCceeeeeeeceeeeccCCCCCCeEEEEEc-CCC
Q 027062          104 CMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGED--GLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWT-EDG  180 (229)
Q Consensus       104 C~G~Qlla~alGg~v~~~~~~~~~g~~~~~~~~~~~~~--~l~~~l~~~~~~~~~H~~~v~~~~l~~~~~~~la~~-~~~  180 (229)
                      |+|||+|+.++||++.+.+. ..+|.+..+....  .+  ++|+++++.+.++++|++.|..   ++++++++|++ +++
T Consensus        84 C~G~QlL~~~~gg~v~~~~~-~~~g~~~~v~~~~--~~~~~l~~~~~~~~~v~~~H~~~v~~---l~~~~~vla~s~~~g  157 (195)
T 1qdl_B           84 CLGHQAIGYAFGAKIRRARK-VFHGKISNIILVN--NSPLSLYYGIAKEFKATRYHSLVVDE---VHRPLIVDAISAEDN  157 (195)
T ss_dssp             THHHHHHHHHTTCEEEEEEE-EEEEEEEEEEECC--SSCCSTTTTCCSEEEEEEEEEEEEEC---CCTTEEEEEEESSSC
T ss_pred             ehHHHHHHHHhCCEEeccCC-CcCCCceEEEECC--CCHhHHHhcCCCceEEeccccchhhh---CCCCcEEEEEECCCC
Confidence            99999999999999998863 4577776665542  44  8999999889999999999975   57899999999 899


Q ss_pred             ceEEEEeCCCCcEEEEeccCCCCCCCchHHHHHHHHH
Q 027062          181 LIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIK  217 (229)
Q Consensus       181 ~i~a~~~~~~~~i~g~QfHPE~~~~~~~~~i~~~f~~  217 (229)
                      .++|+++++++ ++|+|||||++.++.|.+||+||++
T Consensus       158 ~i~a~~~~~~~-~~gvQfHPE~~~~~~g~~l~~~f~~  193 (195)
T 1qdl_B          158 EIMAIHHEEYP-IYGVQFHPESVGTSLGYKILYNFLN  193 (195)
T ss_dssp             CEEEEEESSSS-EEEESSBTTSTTCTTHHHHHHHHHH
T ss_pred             cEEEEEeCCCC-EEEEecCCCCCCCccHHHHHHHHHh
Confidence            99999999876 9999999999977889999999997
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2r47_A Uncharacterized protein MTH_862; unknown function, structural genomics, APC5901, PSI-2; 1.88A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3rfq_A Pterin-4-alpha-carbinolamine dehydratase MOAB2; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: B3P; 2.25A {Mycobacterium marinum} PDB: 3tcr_A Back     alignment and structure
>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A Back     alignment and structure
>3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, transferase; 1.90A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 3e-47
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 3e-42
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 4e-33
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 6e-33
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 7e-32
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 7e-30
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 2e-18
d1o1ya_230 c.23.16.1 (A:) Hypothetical protein TM1158 {Thermo 5e-11
d2nv0a1195 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac 8e-10
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 1e-08
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 6e-06
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 1e-05
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 2e-04
d2abwa1218 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protei 3e-04
d2ghra1281 c.23.16.8 (A:17-297) Homoserine O-succinyltransfer 3e-04
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Anthranilate synthase GAT subunit, TrpG
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

 Score =  152 bits (385), Expect = 3e-47
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 7/196 (3%)

Query: 27  IIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPG---APQD 83
            ++IDNYDSF YN+ Q +GELG +  V RNDE++++ ++R +P  ++ISPGPG     +D
Sbjct: 4   TLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKRED 63

Query: 84  SGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGL 143
            G+SL  +  LG   P+ GVC+G Q IG AFG KI R+        S+++  +      L
Sbjct: 64  IGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSP-LSL 122

Query: 144 LAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGLIMAARHKKYKHLQGVQFHPESI 203
             G++  F A RYHSLV+++   P          ED  IMA  H++Y  + GVQFHPES+
Sbjct: 123 YYGIAKEFKATRYHSLVVDEVHRPLI--VDAISAEDNEIMAIHHEEYP-IYGVQFHPESV 179

Query: 204 ITTEGKTIVRNFIKMI 219
            T+ G  I+ NF+  +
Sbjct: 180 GTSLGYKILYNFLNRV 195
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Length = 230 Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 218 Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 100.0
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 100.0
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 100.0
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 100.0
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 100.0
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 100.0
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 100.0
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.96
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.96
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.95
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.95
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.94
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.94
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.94
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.94
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.91
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.9
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.71
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 98.36
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 98.14
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 98.07
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 98.01
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 97.95
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 97.89
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 97.56
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 97.39
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa 96.66
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 96.59
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 96.55
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 95.95
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 95.91
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 95.8
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 95.75
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 95.16
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 95.14
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 95.07
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 94.99
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 94.73
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 94.67
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 94.59
d1t0ba_240 GK2113 homologue {Bacillus stearothermophilus [Tax 94.45
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 94.32
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 94.1
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 93.99
d1yioa2128 Response regulatory protein StyR, N-terminal domai 93.82
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 93.81
d1mb3a_123 Cell division response regulator DivK {Caulobacter 93.23
d1qkka_140 Transcriptional regulatory protein DctD, receiver 93.04
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 92.88
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 92.56
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 92.04
d1u0ta_302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob 91.88
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 91.5
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.45
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 91.26
d2nqra3149 MoeA, central domain {Escherichia coli [TaxId: 562 91.15
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 90.66
d2gk3a1246 Putative cytoplasmic protein STM3548 {Salmonella t 90.38
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 88.87
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 88.73
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 88.35
d2bona1295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 86.09
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 84.35
d1s8na_190 Probable two-component system transcriptional regu 83.48
d1wu2a3144 MoeA, central domain {Pyrococcus horikoshii, PH164 82.78
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 82.16
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 81.74
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 81.45
d1vi6a_193 Ribosomal protein S2 {Archaeon Archaeoglobus fulgi 81.01
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 80.76
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 80.36
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: GMP synthase subunit A, GuaAA
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]

Probab=100.00  E-value=6.5e-44  Score=281.84  Aligned_cols=191  Identities=26%  Similarity=0.357  Sum_probs=161.4

Q ss_pred             CceEEEEECCCchhHHHHHHHHHcCCEEEEEeCCccCHHHHhccCCCEEEECCCCCCCCCcchHHHHHHH--hCCCCcEE
Q 027062           24 KNPIIVIDNYDSFTYNLCQYMGELGYHFEVYRNDELTVEELKRKNPRGVLISPGPGAPQDSGISLQTVLE--LGPTVPLF  101 (229)
Q Consensus        24 ~~~ilvid~~~~~~~~~~~~l~~~g~~~~v~~~~~~~~~~l~~~~~dgiii~GG~~~~~~~~~~~~~i~~--~~~~~Pvl  101 (229)
                      ++||+|||++++|+.++.++|+++|+++++++++ .+.++++  ++|||||+||++++.+...++..+.+  .+.++|+|
T Consensus         1 m~ki~iiD~g~~~~~~i~r~l~~lg~~~~i~~~d-~~~~~~~--~~dgiIl~Gg~~~~~~~~~~~~~l~~~~~~~~~Pil   77 (196)
T d2a9va1           1 MLKIYVVDNGGQWTHREWRVLRELGVDTKIVPND-IDSSELD--GLDGLVLSGGAPNIDEELDKLGSVGKYIDDHNYPIL   77 (196)
T ss_dssp             CCBEEEEEESCCTTCHHHHHHHHTTCBCCEEETT-SCGGGGT--TCSEEEEEEECSCGGGTGGGHHHHHHHHHHCCSCEE
T ss_pred             CCEEEEEECCCcHHHHHHHHHHHCCCeEEEEeCC-CCHHHHh--cCCcEEEeccccccccccchhhhHHHHHhhcCceEE
Confidence            4799999999999999999999999999999976 4556665  67999999999988877666555443  24679999


Q ss_pred             EEehhHHHHHHHhCCeeeecCCccccCccceeEeccCCCCcccccCCCceeeeeeeceeeeccCCCCCCeEEEEEcCCCc
Q 027062          102 GVCMGLQCIGEAFGGKIVRSPLGVMHGKSSLVYYDEKGEDGLLAGLSNPFTAGRYHSLVIEKESFPSDALEVTAWTEDGL  181 (229)
Q Consensus       102 GIC~G~Qlla~alGg~v~~~~~~~~~g~~~~~~~~~~~~~~l~~~l~~~~~~~~~H~~~v~~~~l~~~~~~~la~~~~~~  181 (229)
                      |||+|||+|+.++||++.+.... ..+. ..+...  ..+++|++++..+.++++|++.+..   ++++++++|+++++.
T Consensus        78 GIC~G~Qll~~~~gg~~~~~~~~-~~~~-~~~~~~--~~~~l~~~~~~~~~~~~~H~~~v~~---~~~~~~v~a~~~~~~  150 (196)
T d2a9va1          78 GICVGAQFIALHFGASVVKAKHP-EFGK-TKVSVM--HSENIFGGLPSEITVWENHNDEIIN---LPDDFTLAASSATCQ  150 (196)
T ss_dssp             EETHHHHHHHHHTTCEEEEEEEE-EEEE-EEEEES--CCCGGGTTCCSEEEEEEEEEEEEES---CCTTEEEEEECSSCS
T ss_pred             Eeehhhhhhhhcccccccccccc-cccc-ceEEEe--cCCccccCCCCceEEEecceeEEEe---CCCccceeecccccc
Confidence            99999999999999999988643 2332 223332  3688999999999999999999976   678999999999999


Q ss_pred             eEEEEeCCCCcEEEEeccCCCCCCCchHHHHHHHHHHHHHHhhh
Q 027062          182 IMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAA  225 (229)
Q Consensus       182 i~a~~~~~~~~i~g~QfHPE~~~~~~~~~i~~~f~~~~~~~~~~  225 (229)
                      ++|+++++++ +||+|||||+..+++|..||+||++.|...+..
T Consensus       151 v~ai~~~~~~-i~gvQfHPE~~~s~~G~~il~~F~~~~~~~~~~  193 (196)
T d2a9va1         151 VQGFYHKTRP-IYATQFHPEVEHTQYGRDIFRNFIGICASYREI  193 (196)
T ss_dssp             CSEEEESSSS-EEEESSCTTSTTSTTHHHHHHHHHHHHHHHHHH
T ss_pred             hheEEECCCC-EEEEEeCcccCCCccHHHHHHHHHHHHHHHHHh
Confidence            9999999977 999999999988889999999999999876544
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nqra3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gk3a1 c.23.16.9 (A:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure