Citrus Sinensis ID: 027065

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MGFVCAIVEALLVVVVIILFGLISAIIFEAYRRRDNHAHIEAPAIFEDPSSLKQVPCPSVTDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYFT

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHccccccccccEEEccccccccccEEEEEEEcccccccEEEEcccc

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHcccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccHHHHcHHHHHcccccc

MGFVCAIVEALLVVVVIILFGLISAIIFEAYrrrdnhahieapaifedpsslkqvpcpsvtdpaEKYISLIIpafneehrlpgalDETLNYLQQRAAKDKSFTYEVLIIddgssdgtkrVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLdadgatkvtdlEKLESQIHAVgrkeynhgdsvtvdstfrisdipiaafgsrAHLEEKALATLKYFT

MGFVCAIVEALLVVVVIILFGLISAIIFEAYRRRDNHAHIEapaifedpsslkQVPCPSVTDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIiddgssdgtkrVAFDfvrkytvdnvriillgrnhgkgeaiRKGMLHSRGELLLMLDADGATKVTDLEKLESQIhavgrkeynhgdsvtvdstfRISDIPIAAFGSRAHLEEKALATLKYFT

MGFvcaiveallvvvviilfgliSAIIFEAYRRRDNHAHIEAPAIFEDPSSLKQVPCPSVTDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYFT

**FVCAIVEALLVVVVIILFGLISAIIFEAYRRRDNHAHIEAPAIFE*******VPCPSVTDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATL****

MGFVCAIVEALLVVVVIILFGLISAIIFEAYRRRDNHAHI*************************KYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYFT

oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		229	2.2.26 [Sep-21-2011]
Q9Y673		324	Dolichyl-phosphate beta-g	yes	no	0.676	0.478	0.461	9e-38
Q9DB25		324	Dolichyl-phosphate beta-g	yes	no	0.676	0.478	0.461	3e-37
Q54J42		327	Dolichyl-phosphate beta-g	yes	no	0.746	0.522	0.341	4e-28
P40350		334	Dolichyl-phosphate beta-g	yes	no	0.615	0.422	0.352	8e-20
O60061		322	Dolichyl-phosphate beta-g	yes	no	0.716	0.509	0.320	4e-17
B5XTK8		327	Undecaprenyl-phosphate 4-	yes	no	0.567	0.397	0.335	5e-11
A6TF99		327	Undecaprenyl-phosphate 4-	yes	no	0.567	0.397	0.328	9e-11
B4ETL6		326	Undecaprenyl-phosphate 4-	yes	no	0.528	0.371	0.312	2e-10
B7N5L9		322	Undecaprenyl-phosphate 4-	yes	no	0.528	0.375	0.340	2e-10
Q57M56		327	Undecaprenyl-phosphate 4-	yes	no	0.598	0.418	0.306	3e-10

>sp\|Q9Y673\|ALG5_HUMAN Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens GN=ALG5 PE=1 SV=1	Back alignment and function desciption

 Score =  156 bits (395), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 111/171 (64%), Gaps = 16/171 (9%)

Query: 58  PSVTDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGT 117
           PS+ D   K +S+++P++NEE RLP  +DE L+YL++R  +D +FTYEV+++DDGS D T
Sbjct: 57  PSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQT 116

Query: 118 KRVAFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKL 177
            +VAF + +KY  D VR+I L +N GKG AIR G+  SRGE +LM DADGATK  D+EKL
Sbjct: 117 SKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKL 176

Query: 178 ESQIHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYF 228
           E  ++               D     + + IA  GSRAHLE++++A   YF
Sbjct: 177 EKGLN---------------DLQPWPNQMAIAC-GSRAHLEKESIAQRSYF 211

Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 1EC: 7

>sp\|Q9DB25\|ALG5_MOUSE Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus GN=Alg5 PE=2 SV=1	Back alignment and function description

>sp\|Q54J42\|ALG5_DICDI Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum GN=alg5 PE=2 SV=1	Back alignment and function description

>sp\|P40350\|ALG5_YEAST Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG5 PE=1 SV=1	Back alignment and function description

>sp\|O60061\|ALG5_SCHPO Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg5 PE=3 SV=1	Back alignment and function description

>sp\|B5XTK8\|ARNC_KLEP3 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Klebsiella pneumoniae (strain 342) GN=arnC PE=3 SV=1	Back alignment and function description

>sp\|A6TF99\|ARNC_KLEP7 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnC PE=3 SV=1	Back alignment and function description

>sp\|B4ETL6\|ARNC_PROMH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Proteus mirabilis (strain HI4320) GN=arnC PE=3 SV=1	Back alignment and function description

>sp\|B7N5L9\|ARNC_ECOLU Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=arnC PE=3 SV=1	Back alignment and function description

>sp\|Q57M56\|ARNC_SALCH Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella choleraesuis (strain SC-B67) GN=arnC PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		229
224100983		335	predicted protein [Populus trichocarpa]	0.995	0.680	0.776	1e-102
224109522		335	predicted protein [Populus trichocarpa]	0.995	0.680	0.767	1e-101
225449525		336	PREDICTED: dolichyl-phosphate beta-gluco	0.995	0.678	0.755	6e-99
356499640		333	PREDICTED: dolichyl-phosphate beta-gluco	0.978	0.672	0.75	4e-98
255580047		335	Dolichyl-phosphate beta-glucosyltransfer	0.995	0.680	0.741	1e-97
356569014		333	PREDICTED: dolichyl-phosphate beta-gluco	0.978	0.672	0.741	4e-97
449450171		329	PREDICTED: dolichyl-phosphate beta-gluco	0.882	0.613	0.754	3e-89
357503471		330	Dolichyl-phosphate beta-glucosyltransfer	0.965	0.669	0.714	1e-88
357503469		328	Dolichyl-phosphate beta-glucosyltransfer	0.938	0.655	0.720	2e-86
15225508		336	dolichyl-phosphate beta-glucosyltransfer	0.995	0.678	0.631	5e-86

>gi\|224100983\|ref\|XP_002312095.1\| predicted protein [Populus trichocarpa] gi\|222851915\|gb\|EEE89462.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/228 (77%), Positives = 205/228 (89%)

Query: 1   MGFVCAIVEALLVVVVIILFGLISAIIFEAYRRRDNHAHIEAPAIFEDPSSLKQVPCPSV 60
           MGF+  I E L+ +V II   L++A++ EAYRRR N+ H++A A FEDP+SLKQVPCP +
Sbjct: 1   MGFLWTIAELLVALVFIIASFLLTAVVSEAYRRRHNNTHVDASAFFEDPNSLKQVPCPHI 60

Query: 61  TDPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRV 120
            DPAEKYISL+IPAFNEEHRLPGALDET+NYLQ+RAAKDKSFTYEV+I+DDGS+D TKRV
Sbjct: 61  HDPAEKYISLVIPAFNEEHRLPGALDETINYLQERAAKDKSFTYEVVIVDDGSADATKRV 120

Query: 121 AFDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQ 180
           AFDFV+KYTVDNVR+ILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLE+Q
Sbjct: 121 AFDFVKKYTVDNVRVILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLENQ 180

Query: 181 IHAVGRKEYNHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYF 228
           IHAV RKE+  G+S + DS+FRISDIP+AAFGSRAHLEEKALAT K++
Sbjct: 181 IHAVARKEFRLGESTSSDSSFRISDIPLAAFGSRAHLEEKALATRKWY 228

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224109522\|ref\|XP_002315224.1\| predicted protein [Populus trichocarpa] gi\|222864264\|gb\|EEF01395.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225449525\|ref\|XP_002283615.1\| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi\|296086237\|emb\|CBI31678.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356499640\|ref\|XP_003518645.1\| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Glycine max]	Back alignment and taxonomy information

>gi\|255580047\|ref\|XP_002530857.1\| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi\|223529581\|gb\|EEF31531.1\| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356569014\|ref\|XP_003552702.1\| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Glycine max]	Back alignment and taxonomy information

>gi\|449450171\|ref\|XP_004142837.1\| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cucumis sativus] gi\|449483934\|ref\|XP_004156737.1\| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357503471\|ref\|XP_003622024.1\| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] gi\|355497039\|gb\|AES78242.1\| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357503469\|ref\|XP_003622023.1\| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula] gi\|355497038\|gb\|AES78241.1\| Dolichyl-phosphate beta-glucosyltransferase [Medicago truncatula]	Back alignment and taxonomy information

>gi|15225508|ref|NP_181493.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		229
TAIR\|locus:2039707		336	AT2G39630 [Arabidopsis thalian	0.895	0.610	0.663	1.9e-74
UNIPROTKB\|F1RS38		194	ALG5 "Uncharacterized protein"	0.633	0.747	0.496	8.3e-35
UNIPROTKB\|Q9Y673		324	ALG5 "Dolichyl-phosphate beta-	0.759	0.537	0.437	1.7e-34
UNIPROTKB\|E1BUU9		287	ALG5 "Uncharacterized protein"	0.716	0.571	0.436	4.6e-34
RGD\|1308900		324	Alg5 "ALG5, dolichyl-phosphate	0.759	0.537	0.432	7.4e-34
UNIPROTKB\|F1N540		324	ALG5 "Uncharacterized protein"	0.759	0.537	0.427	9.5e-34
UNIPROTKB\|E2R422		324	ALG5 "Uncharacterized protein"	0.759	0.537	0.432	1.2e-33
UNIPROTKB\|J9P6U5		291	ALG5 "Uncharacterized protein"	0.759	0.597	0.432	1.2e-33
UNIPROTKB\|B4DR67		230	ALG5 "Dolichyl-phosphate beta-	0.751	0.747	0.436	1.5e-33
MGI\|MGI:1913498		324	Alg5 "asparagine-linked glycos	0.676	0.478	0.461	3.2e-33

TAIR\|locus:2039707 AT2G39630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 751 (269.4 bits), Expect = 1.9e-74, P = 1.9e-74
 Identities = 136/205 (66%), Positives = 176/205 (85%)

Query:    24 SAIIFEAYRRRDNHAHIEAPAIFEDPSSLKQVPCPSVTDPAEKYISLIIPAFNEEHRLPG 83
             S ++FEA+RRR ++  +E     +DP S+K +PCP +TDPAEKY+SLI+PA+NEE RLP 
Sbjct:    24 SVVVFEAWRRRHSNVSVETVTTLDDPKSIKPIPCPHITDPAEKYLSLIVPAYNEELRLPA 83

Query:    84 ALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHG 143
             AL+ET++YLQ RA++DKSF++EV+I+DDGS DGTKRVAFDF+RKYT+DN+R+I LG+N G
Sbjct:    84 ALEETMDYLQDRASRDKSFSFEVVIVDDGSVDGTKRVAFDFIRKYTIDNIRVIPLGKNQG 143

Query:   144 KGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDSVTVDSTFRI 203
             KGEAIRKGMLHSRG+LLLMLDADGATKVTDLEKLE+QI+AV R+EY+  +  + D  F+I
Sbjct:   144 KGEAIRKGMLHSRGQLLLMLDADGATKVTDLEKLENQINAVAREEYSIRNPASKDMDFKI 203

Query:   204 SDIPIAAFGSRAHLEEKALATLKYF 228
              D+ ++AFGSRAHLEEKALAT K++
Sbjct:   204 GDVQVSAFGSRAHLEEKALATRKWY 228

GO:0005576 "extracellular region" evidence=ISM

GO:0006486 "protein glycosylation" evidence=ISS

GO:0009058 "biosynthetic process" evidence=ISS

GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS

GO:0005783 "endoplasmic reticulum" evidence=IDA

GO:0016126 "sterol biosynthetic process" evidence=RCA

GO:0046520 "sphingoid biosynthetic process" evidence=RCA

UNIPROTKB\|F1RS38 ALG5 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9Y673 ALG5 "Dolichyl-phosphate beta-glucosyltransferase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BUU9 ALG5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1308900 Alg5 "ALG5, dolichyl-phosphate beta-glucosyltransferase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N540 ALG5 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R422 ALG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P6U5 ALG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DR67 ALG5 "Dolichyl-phosphate beta-glucosyltransferase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1913498 Alg5 "asparagine-linked glycosylation 5 (dolichyl-phosphate beta-glucosyltransferase)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.4.1.80	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		229
cd04188		211	cd04188, DPG_synthase, DPG_synthase is involved in	2e-47
PTZ00260		333	PTZ00260, PTZ00260, dolichyl-phosphate beta-glucos	2e-42
cd04179		185	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l	5e-28
pfam00535		168	pfam00535, Glycos_transf_2, Glycosyl transferase f	3e-20
cd04187		181	cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme	2e-17
cd00761		156	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase	7e-16
PRK11204		420	PRK11204, PRK11204, N-glycosyltransferase; Provisi	3e-15
cd06423		180	cd06423, CESA_like, CESA_like is the cellulose syn	7e-15
COG0463		291	COG0463, WcaA, Glycosyltransferases involved in ce	7e-15
TIGR03937		407	TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glu	1e-14
cd06439		251	cd06439, CESA_like_1, CESA_like_1 is a member of t	2e-14
COG1215		439	COG1215, COG1215, Glycosyltransferases, probably i	3e-14
cd06442		224	cd06442, DPM1_like, DPM1_like represents putative	8e-13
PRK10714		325	PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy	3e-12
cd02525		249	cd02525, Succinoglycan_BP_ExoA, ExoA is involved i	8e-12
PLN02726		243	PLN02726, PLN02726, dolichyl-phosphate beta-D-mann	5e-11
cd04192		229	cd04192, GT_2_like_e, Subfamily of Glycosyltransfe	6e-10
TIGR04283		220	TIGR04283, glyco_like_mftF, transferase 2, rSAM/se	9e-09
cd02522		221	cd02522, GT_2_like_a, GT_2_like_a represents a gly	1e-08
PRK14583		444	PRK14583, hmsR, N-glycosyltransferase; Provisional	2e-08
PRK13915		306	PRK13915, PRK13915, putative glucosyl-3-phosphogly	4e-08
cd02511		229	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS	3e-06
TIGR04242		395	TIGR04242, nodulat_NodC, chitooligosaccharide synt	8e-06
cd04186		166	cd04186, GT_2_like_c, Subfamily of Glycosyltransfe	1e-05
pfam13641		229	pfam13641, Glyco_tranf_2_3, Glycosyltransferase li	2e-05
PRK10073		328	PRK10073, PRK10073, putative glycosyl transferase;	4e-04
cd06433		202	cd06433, GT_2_WfgS_like, WfgS and WfeV are involve	5e-04
TIGR03111		439	TIGR03111, glyc2_xrt_Gpos1, putative glycosyltrans	5e-04
cd04196		214	cd04196, GT_2_like_d, Subfamily of Glycosyltransfe	7e-04
cd06436		191	cd06436, GlcNAc-1-P_transferase, N-acetyl-glucosam	0.001
PRK10063		248	PRK10063, PRK10063, putative glycosyl transferase;	0.001
cd06913		219	cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucos	0.001
cd04195		201	cd04195, GT2_AmsE_like, GT2_AmsE_like is involved	0.002
TIGR04182		293	TIGR04182, glyco_TIGR04182, glycosyltransferase, T	0.002

>gnl\|CDD\|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation	Back alignment and domain information

 Score =  155 bits (393), Expect = 2e-47
 Identities = 64/159 (40%), Positives = 88/159 (55%), Gaps = 26/159 (16%)

Query: 70  LIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYT 129
           ++IPA+NEE RLP  L+E + YL++R     SF+YE++++DDGS DGT  VA    RK  
Sbjct: 1   VVIPAYNEEKRLPPTLEEAVEYLEER----PSFSYEIIVVDDGSKDGTAEVARKLARKNP 56

Query: 130 VDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEY 189
              +R++ L +N GKG A+R GML +RG+ +L  DAD AT   +LEKLE  +   G    
Sbjct: 57  -ALIRVLTLPKNRGKGGAVRAGMLAARGDYILFADADLATPFEELEKLEEALKTSG---- 111

Query: 190 NHGDSVTVDSTFRISDIPIAAFGSRAHLEEKALATLKYF 228
                          DI   A GSRAHL   A+    + 
Sbjct: 112 --------------YDI---AIGSRAHLASAAVVKRSWL 133

UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. Length = 211

>gnl\|CDD\|240336 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucosyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily	Back alignment and domain information

>gnl\|CDD\|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2	Back alignment and domain information

>gnl\|CDD\|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1	Back alignment and domain information

>gnl\|CDD\|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold	Back alignment and domain information

>gnl\|CDD\|236882 PRK11204, PRK11204, N-glycosyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily	Back alignment and domain information

>gnl\|CDD\|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|188452 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glucosamine synthase	Back alignment and domain information

>gnl\|CDD\|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily	Back alignment and domain information

>gnl\|CDD\|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1	Back alignment and domain information

>gnl\|CDD\|182669 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan	Back alignment and domain information

>gnl\|CDD\|215385 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosyltransferase	Back alignment and domain information

>gnl\|CDD\|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>gnl\|CDD\|234532 TIGR04283, glyco_like_mftF, transferase 2, rSAM/selenodomain-associated	Back alignment and domain information

>gnl\|CDD\|133013 cd02522, GT_2_like_a, GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function	Back alignment and domain information

>gnl\|CDD\|184755 PRK14583, hmsR, N-glycosyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237556 PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|133005 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide	Back alignment and domain information

>gnl\|CDD\|211965 TIGR04242, nodulat_NodC, chitooligosaccharide synthase NodC	Back alignment and domain information

>gnl\|CDD\|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>gnl\|CDD\|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2	Back alignment and domain information

>gnl\|CDD\|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133055 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis	Back alignment and domain information

>gnl\|CDD\|132155 TIGR03111, glyc2_xrt_Gpos1, putative glycosyltransferase, exosortase G-associated	Back alignment and domain information

>gnl\|CDD\|133039 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>gnl\|CDD\|133058 cd06436, GlcNAc-1-P_transferase, N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine	Back alignment and domain information

>gnl\|CDD\|182218 PRK10063, PRK10063, putative glycosyl transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133063 cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine	Back alignment and domain information

>gnl\|CDD\|133038 cd04195, GT2_AmsE_like, GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis	Back alignment and domain information

>gnl\|CDD\|200433 TIGR04182, glyco_TIGR04182, glycosyltransferase, TIGR04182 family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		229
PTZ00260		333	dolichyl-phosphate beta-glucosyltransferase; Provi	99.94
PRK11204		420	N-glycosyltransferase; Provisional	99.94
PRK14583		444	hmsR N-glycosyltransferase; Provisional	99.93
KOG2977		323	consensus Glycosyltransferase [General function pr	99.93
TIGR03111		439	glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0	99.92
PRK10073		328	putative glycosyl transferase; Provisional	99.92
TIGR03472		373	HpnI hopanoid biosynthesis associated glycosyl tra	99.91
cd02520		196	Glucosylceramide_synthase Glucosylceramide synthas	99.91
TIGR03469		384	HonB hopene-associated glycosyltransferase HpnB. T	99.91
PRK10018		279	putative glycosyl transferase; Provisional	99.9
PLN02726		243	dolichyl-phosphate beta-D-mannosyltransferase	99.9
cd06427		241	CESA_like_2 CESA_like_2 is a member of the cellulo	99.89
cd04196		214	GT_2_like_d Subfamily of Glycosyltransferase Famil	99.89
cd04195		201	GT2_AmsE_like GT2_AmsE_like is involved in exopoly	99.89
cd04184		202	GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot	99.89
PF00535		169	Glycos_transf_2: Glycosyl transferase family 2; In	99.89
cd04188		211	DPG_synthase DPG_synthase is involved in protein N	99.88
PRK10063		248	putative glycosyl transferase; Provisional	99.88
PRK10714		325	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi	99.88
cd06439		251	CESA_like_1 CESA_like_1 is a member of the cellulo	99.88
cd06437		232	CESA_CaSu_A2 Cellulose synthase catalytic subunit	99.87
cd06421		234	CESA_CelA_like CESA_CelA_like are involved in the	99.87
cd02510		299	pp-GalNAc-T pp-GalNAc-T initiates the formation of	99.87
cd06913		219	beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran	99.86
cd06442		224	DPM1_like DPM1_like represents putative enzymes si	99.86
cd04187		181	DPM1_like_bac Bacterial DPM1_like enzymes are rela	99.86
TIGR03030		713	CelA cellulose synthase catalytic subunit (UDP-for	99.86
PRK11498		852	bcsA cellulose synthase catalytic subunit; Provisi	99.85
cd06433		202	GT_2_WfgS_like WfgS and WfeV are involved in O-ant	99.85
COG1215		439	Glycosyltransferases, probably involved in cell wa	99.85
cd06435		236	CESA_NdvC_like NdvC_like proteins in this family a	99.84
PRK13915		306	putative glucosyl-3-phosphoglycerate synthase; Pro	99.84
cd04192		229	GT_2_like_e Subfamily of Glycosyltransferase Famil	99.84
cd06438		183	EpsO_like EpsO protein participates in the methano	99.83
cd06423		180	CESA_like CESA_like is the cellulose synthase supe	99.83
cd04179		185	DPM_DPG-synthase_like DPM_DPG-synthase_like is a m	99.83
cd06420		182	GT2_Chondriotin_Pol_N N-terminal domain of Chondro	99.83
cd06434		235	GT2_HAS Hyaluronan synthases catalyze polymerizati	99.83
cd06436		191	GlcNAc-1-P_transferase N-acetyl-glucosamine transf	99.83
cd04185		202	GT_2_like_b Subfamily of Glycosyltransferase Famil	99.82
cd02525		249	Succinoglycan_BP_ExoA ExoA is involved in the bios	99.82
cd02511		229	Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4	99.82
KOG2978		238	consensus Dolichol-phosphate mannosyltransferase [	99.81
PF13641		228	Glyco_tranf_2_3: Glycosyltransferase like family 2	99.81
COG0463		291	WcaA Glycosyltransferases involved in cell wall bi	99.8
PRK14716		504	bacteriophage N4 adsorption protein B; Provisional	99.79
cd04186		166	GT_2_like_c Subfamily of Glycosyltransferase Famil	99.79
PRK05454		691	glucosyltransferase MdoH; Provisional	99.77
cd02522		221	GT_2_like_a GT_2_like_a represents a glycosyltrans	99.77
PRK11234		727	nfrB bacteriophage N4 adsorption protein B; Provis	99.76
cd04191		254	Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon	99.74
cd04190		244	Chitin_synth_C C-terminal domain of Chitin Synthas	99.73
cd02526		237	GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr	99.73
PRK15489		703	nfrB bacteriophage N4 adsorption protein B; Provis	99.67
PF10111		281	Glyco_tranf_2_2: Glycosyltransferase like family 2	99.67
COG1216		305	Predicted glycosyltransferases [General function p	99.64
TIGR01556		281	rhamnosyltran L-rhamnosyltransferase. Rhamnolipids	99.62
cd00761		156	Glyco_tranf_GTA_type Glycosyltransferase family A	99.61
KOG2547		431	consensus Ceramide glucosyltransferase [Lipid tran	99.45
KOG3738		559	consensus Predicted polypeptide N-acetylgalactosam	99.38
cd02514		334	GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es	99.28
KOG3737		603	consensus Predicted polypeptide N-acetylgalactosam	99.28
KOG3736		578	consensus Polypeptide N-acetylgalactosaminyltransf	99.27
COG2943		736	MdoH Membrane glycosyltransferase [Cell envelope b	98.98
PF13704		97	Glyco_tranf_2_4: Glycosyl transferase family 2	98.36
PF13712		217	Glyco_tranf_2_5: Glycosyltransferase like family;	98.11
PF03142		527	Chitin_synth_2: Chitin synthase; InterPro: IPR0048	98.08
PF13506		175	Glyco_transf_21: Glycosyl transferase family 21	98.06
PF03071		434	GNT-I: GNT-I family; InterPro: IPR004139 The biosy	97.88
PF09488		381	Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas	97.68
PF06306		347	CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (	97.68
PF11316		234	Rhamno_transf: Putative rhamnosyl transferase ; In	97.57
TIGR02460		381	osmo_MPGsynth mannosyl-3-phosphoglycerate synthase	97.56
PRK14503		393	mannosyl-3-phosphoglycerate synthase; Provisional	97.55
PF05679		499	CHGN: Chondroitin N-acetylgalactosaminyltransferas	97.5
COG4092		346	Predicted glycosyltransferase involved in capsule	97.45
PF03452		269	Anp1: Anp1; InterPro: IPR005109 The members of thi	97.36
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	97.09
PLN02458		346	transferase, transferring glycosyl groups	96.89
PLN02893		734	Cellulose synthase-like protein	96.83
KOG1476		330	consensus Beta-1,3-glucuronyltransferase B3GAT1/SQ	96.66
PF11735		241	CAP59_mtransfer: Cryptococcal mannosyltransferase	96.57
PF03214		348	RGP: Reversibly glycosylated polypeptide; InterPro	96.52
cd00218		223	GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I)	96.46
PF13733		136	Glyco_transf_7N: N-terminal region of glycosyl tra	96.38
cd02540		229	GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	96.35
PF12804		160	NTP_transf_3: MobA-like NTP transferase domain; PD	96.19
cd00899		219	b4GalT Beta-4-Galactosyltransferase is involved in	96.11
KOG2571		862	consensus Chitin synthase/hyaluronan synthase (gly	96.02
cd04182		186	GT_2_like_f GT_2_like_f is a subfamily of the glyc	95.92
TIGR03202		190	pucB xanthine dehydrogenase accessory protein pucB	95.84
PF04666		297	Glyco_transf_54: N-Acetylglucosaminyltransferase-I	95.81
PLN02189		1040	cellulose synthase	95.69
TIGR03310		188	matur_ygfJ molybdenum hydroxylase accessory protei	95.66
PF01697		285	Glyco_transf_92: Glycosyltransferase family 92; In	95.64
KOG3916		372	consensus UDP-Gal:glucosylceramide beta-1,4-galact	95.3
PRK00317		193	mobA molybdopterin-guanine dinucleotide biosynthes	95.27
KOG3588		494	consensus Chondroitin synthase 1 [Carbohydrate tra	95.25
KOG1413		411	consensus N-acetylglucosaminyltransferase I [Carbo	95.11
cd04181		217	NTP_transferase NTP_transferases catalyze the tran	95.01
PF09258		247	Glyco_transf_64: Glycosyl transferase family 64 do	94.88
PLN02917		293	CMP-KDO synthetase	94.5
cd02518		233	GT2_SpsF SpsF is a glycosyltrnasferase implicated	94.3
PLN02638		1079	cellulose synthase A (UDP-forming), catalytic subu	94.29
cd02503		181	MobA MobA catalyzes the formation of molybdopterin	94.1
PF13632		193	Glyco_trans_2_3: Glycosyl transferase family group	94.01
COG1213		239	Predicted sugar nucleotidyltransferases [Cell enve	93.84
PLN02190		756	cellulose synthase-like protein	93.7
cd06915		223	NTP_transferase_WcbM_like WcbM_like is a subfamily	93.67
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	93.65
PLN03180		346	reversibly glycosylated polypeptide; Provisional	93.55
cd06422		221	NTP_transferase_like_1 NTP_transferase_like_1 is a	93.55
COG2068		199	Uncharacterized MobA-related protein [General func	93.39
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	93.33
PF00483		248	NTP_transferase: Nucleotidyl transferase This Pros	93.15
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	93.12
PRK02726		200	molybdopterin-guanine dinucleotide biosynthesis pr	93.11
cd04189		236	G1P_TT_long G1P_TT_long represents the long form o	93.11
PLN02195		977	cellulose synthase A	93.0
cd02523		229	PC_cytidylyltransferase Phosphocholine cytidylyltr	92.74
TIGR03552		195	F420_cofC 2-phospho-L-lactate guanylyltransferase	92.63
PF11397		343	GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP	92.57
PRK15480		292	glucose-1-phosphate thymidylyltransferase RfbA; Pr	92.24
cd06425		233	M1P_guanylylT_B_like_N N-terminal domain of the M1	92.15
PRK13385		230	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	92.13
cd02517		239	CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th	92.12
PF03360		207	Glyco_transf_43: Glycosyltransferase family 43; In	92.07
cd06428		257	M1P_guanylylT_A_like_N N-terminal domain of M1P_gu	92.02
PRK00155		227	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	91.88
cd02509		274	GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf	91.73
TIGR01207		286	rmlA glucose-1-phosphate thymidylyltransferase, sh	91.66
cd02516		218	CDP-ME_synthetase CDP-ME synthetase is involved in	91.57
TIGR02665		186	molyb_mobA molybdopterin-guanine dinucleotide bios	91.52
TIGR00453		217	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	91.13
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	91.11
PRK13368		238	3-deoxy-manno-octulosonate cytidylyltransferase; P	91.08
COG1209		286	RfbA dTDP-glucose pyrophosphorylase [Cell envelope	91.06
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	90.86
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	90.53
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	90.08
TIGR03584		222	PseF pseudaminic acid CMP-transferase. The sequenc	89.93
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	89.68
PRK05450		245	3-deoxy-manno-octulosonate cytidylyltransferase; P	89.67
cd02538		240	G1P_TT_short G1P_TT_short is the short form of glu	89.61
cd02508		200	ADP_Glucose_PP ADP-glucose pyrophosphorylase is in	89.61
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	89.24
cd02513		223	CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-	89.01
cd02541		267	UGPase_prokaryotic Prokaryotic UGPase catalyses th	88.93
TIGR01099		260	galU UTP-glucose-1-phosphate uridylyltransferase.	88.77
cd04183		231	GT2_BcE_like GT2_BcbE_like is likely involved in t	88.73
PF01762		195	Galactosyl_T: Galactosyltransferase; InterPro: IPR	88.36
cd06426		220	NTP_transferase_like_2 NTP_trnasferase_like_2 is a	87.53
TIGR00454		183	conserved hypothetical protein TIGR00454. At this	87.49
COG0746		192	MobA Molybdopterin-guanine dinucleotide biosynthes	87.35
PLN02893		734	Cellulose synthase-like protein	87.33
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	87.15
cd02524		253	G1P_cytidylyltransferase G1P_cytidylyltransferase	87.1
cd06431		280	GT8_LARGE_C LARGE catalytic domain has closest hom	86.99
PLN02436		1094	cellulose synthase A	86.48
PRK09382		378	ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp	86.41
PLN02248		1135	cellulose synthase-like protein	86.15
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	85.99
PLN02915		1044	cellulose synthase A [UDP-forming], catalytic subu	85.86
PLN02400		1085	cellulose synthase	85.84
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	85.49
PLN02195		977	cellulose synthase A	85.3
TIGR00466		238	kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe	85.12
PLN02248		1135	cellulose synthase-like protein	85.06
PLN02638		1079	cellulose synthase A (UDP-forming), catalytic subu	84.98
PLN02189		1040	cellulose synthase	84.92
TIGR01105		297	galF UTP-glucose-1-phosphate uridylyltransferase,	84.53
cd04198		214	eIF-2B_gamma_N The N-terminal domain of gamma subu	84.29
PLN02728		252	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	83.95
TIGR02623		254	G1P_cyt_trans glucose-1-phosphate cytidylyltransfe	83.55
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	83.49
COG2266		177	GTP:adenosylcobinamide-phosphate guanylyltransfera	82.83
PF01644		163	Chitin_synth_1: Chitin synthase; InterPro: IPR0048	82.8
PF07507		311	WavE: WavE lipopolysaccharide synthesis; InterPro:	82.71
PF13896		317	Glyco_transf_49: Glycosyl-transferase for dystrogl	82.68
PLN02436		1094	cellulose synthase A	82.61
PLN02190		756	cellulose synthase-like protein	81.91
cd00505		246	Glyco_transf_8 Members of glycosyltransferase fami	81.23

>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional	Back alignment and domain information

Probab=99.94  E-value=4.2e-25  Score=187.31  Aligned_cols=122  Identities=48%  Similarity=0.802  Sum_probs=107.0

Q ss_pred             CCCCceEEEEEeecCCCCChHHHHHHHHHHHHHhhhhcCCCceEEEEEECCCCcchHHHHHHHHHHc--CCCcEEEEEcC
Q 027065           62 DPAEKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKY--TVDNVRIILLG  139 (229)
Q Consensus        62 ~~~~p~vsviip~~ne~~~l~~~l~sl~~~~~~~~~~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~--~~~~i~vi~~~  139 (229)
                      ....|.+|||||+|||++.|+++|+++.+++....-+++..++|||||||||+|+|.++++++.+++  +..+++++..+
T Consensus        66 ~~~~~~isVVIP~yNe~~~i~~~L~~l~~~~~~~~~~~~~~~~EIIVVDDgStD~T~~i~~~~~~~~~~~~~~i~vi~~~  145 (333)
T PTZ00260         66 KDSDVDLSIVIPAYNEEDRLPKMLKETIKYLESRSRKDPKFKYEIIIVNDGSKDKTLKVAKDFWRQNINPNIDIRLLSLL  145 (333)
T ss_pred             CCCCeEEEEEEeeCCCHHHHHHHHHHHHHHHHhhhccCCCCCEEEEEEeCCCCCchHHHHHHHHHhcCCCCCcEEEEEcC
Confidence            4567889999999999999999999999877643222334579999999999999999999998775  33369999999


Q ss_pred             CCCCHHHHHHHHHHhcCCCEEEEEcCCCCCChhhHHHHHHHHHH
Q 027065          140 RNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHA  183 (229)
Q Consensus       140 ~~~gk~~a~n~gl~~a~~d~v~~lD~D~~~~~~~l~~l~~~~~~  183 (229)
                      +|.|+++|+|.|++.++||+|+++|+|+..+++.+.++++.+.+
T Consensus       146 ~N~G~~~A~~~Gi~~a~gd~I~~~DaD~~~~~~~l~~l~~~l~~  189 (333)
T PTZ00260        146 RNKGKGGAVRIGMLASRGKYILMVDADGATDIDDFDKLEDIMLK  189 (333)
T ss_pred             CCCChHHHHHHHHHHccCCEEEEEeCCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999976

>PRK11204 N-glycosyltransferase; Provisional	Back alignment and domain information

>PRK14583 hmsR N-glycosyltransferase; Provisional	Back alignment and domain information

>KOG2977 consensus Glycosyltransferase [General function prediction only]	Back alignment and domain information

>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111	Back alignment and domain information

>PRK10073 putative glycosyl transferase; Provisional	Back alignment and domain information

>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI	Back alignment and domain information

>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis	Back alignment and domain information

>TIGR03469 HonB hopene-associated glycosyltransferase HpnB	Back alignment and domain information

>PRK10018 putative glycosyl transferase; Provisional	Back alignment and domain information

>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase	Back alignment and domain information

>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily	Back alignment and domain information

>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis	Back alignment and domain information

>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis	Back alignment and domain information

>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation	Back alignment and domain information

>PRK10063 putative glycosyl transferase; Provisional	Back alignment and domain information

>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional	Back alignment and domain information

>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily	Back alignment and domain information

>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex	Back alignment and domain information

>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose	Back alignment and domain information

>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans	Back alignment and domain information

>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine	Back alignment and domain information

>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1	Back alignment and domain information

>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1	Back alignment and domain information

>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming)	Back alignment and domain information

>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional	Back alignment and domain information

>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis	Back alignment and domain information

>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase	Back alignment and domain information

>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional	Back alignment and domain information

>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis	Back alignment and domain information

>cd06423 CESA_like CESA_like is the cellulose synthase superfamily	Back alignment and domain information

>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily	Back alignment and domain information

>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase	Back alignment and domain information

>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan	Back alignment and domain information

>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine	Back alignment and domain information

>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan	Back alignment and domain information

>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide	Back alignment and domain information

>KOG2978 consensus Dolichol-phosphate mannosyltransferase [General function prediction only]	Back alignment and domain information

>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A	Back alignment and domain information

>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14716 bacteriophage N4 adsorption protein B; Provisional	Back alignment and domain information

>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>PRK05454 glucosyltransferase MdoH; Provisional	Back alignment and domain information

>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function	Back alignment and domain information

>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional	Back alignment and domain information

>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan	Back alignment and domain information

>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin	Back alignment and domain information

>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase	Back alignment and domain information

>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional	Back alignment and domain information

>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ]	Back alignment and domain information

>COG1216 Predicted glycosyltransferases [General function prediction only]	Back alignment and domain information

>TIGR01556 rhamnosyltran L-rhamnosyltransferase	Back alignment and domain information

>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold	Back alignment and domain information

>KOG2547 consensus Ceramide glucosyltransferase [Lipid transport and metabolism; Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides	Back alignment and domain information

>KOG3737 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2	Back alignment and domain information

>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B	Back alignment and domain information

>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2	Back alignment and domain information

>PF13506 Glyco_transf_21: Glycosyl transferase family 21	Back alignment and domain information

>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis	Back alignment and domain information

>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni []	Back alignment and domain information

>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function	Back alignment and domain information

>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase	Back alignment and domain information

>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional	Back alignment and domain information

>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase	Back alignment and domain information

>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>PLN02458 transferase, transferring glycosyl groups	Back alignment and domain information

>PLN02893 Cellulose synthase-like protein	Back alignment and domain information

>KOG1476 consensus Beta-1,3-glucuronyltransferase B3GAT1/SQV-8 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ]	Back alignment and domain information

>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants []	Back alignment and domain information

>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis	Back alignment and domain information

>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A	Back alignment and domain information

>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	Back alignment and domain information

>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B	Back alignment and domain information

>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids	Back alignment and domain information

>KOG2571 consensus Chitin synthase/hyaluronan synthase (glycosyltransferases) [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function	Back alignment and domain information

>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB	Back alignment and domain information

>PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum	Back alignment and domain information

>PLN02189 cellulose synthase	Back alignment and domain information

>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family	Back alignment and domain information

>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function	Back alignment and domain information

>KOG3916 consensus UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed	Back alignment and domain information

>KOG3588 consensus Chondroitin synthase 1 [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1413 consensus N-acetylglucosaminyltransferase I [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans

Back alignment and domain information

>PLN02917 CMP-KDO synthetase	Back alignment and domain information

>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat	Back alignment and domain information

>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit	Back alignment and domain information

>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide	Back alignment and domain information

>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2	Back alignment and domain information

>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02190 cellulose synthase-like protein	Back alignment and domain information

>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>PLN03180 reversibly glycosylated polypeptide; Provisional	Back alignment and domain information

>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>COG2068 Uncharacterized MobA-related protein [General function prediction only]	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>PLN02195 cellulose synthase A	Back alignment and domain information

>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC	Back alignment and domain information

>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ]	Back alignment and domain information

>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional	Back alignment and domain information

>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide	Back alignment and domain information

>PF03360 Glyco_transf_43: Glycosyltransferase family 43; InterPro: IPR005027 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed	Back alignment and domain information

>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose	Back alignment and domain information

>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial	Back alignment and domain information

>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03584 PseF pseudaminic acid CMP-transferase	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety	Back alignment and domain information

>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

>PF01762 Galactosyl_T: Galactosyltransferase; InterPro: IPR002659 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>TIGR00454 conserved hypothetical protein TIGR00454	Back alignment and domain information

>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]	Back alignment and domain information

>PLN02893 Cellulose synthase-like protein	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis	Back alignment and domain information

>PLN02436 cellulose synthase A	Back alignment and domain information

>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional	Back alignment and domain information

>PLN02248 cellulose synthase-like protein	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit	Back alignment and domain information

>PLN02400 cellulose synthase	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>PLN02195 cellulose synthase A	Back alignment and domain information

>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase	Back alignment and domain information

>PLN02248 cellulose synthase-like protein	Back alignment and domain information

>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit	Back alignment and domain information

>PLN02189 cellulose synthase	Back alignment and domain information

>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit	Back alignment and domain information

>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PF01644 Chitin_synth_1: Chitin synthase; InterPro: IPR004834 This region is found commonly in chitin synthases classes I, II and III 2	Back alignment and domain information

>PF07507 WavE: WavE lipopolysaccharide synthesis; InterPro: IPR011122 These proteins are encoded by putative wav gene clusters, which are responsible for the synthesis of the core oligosaccharide (OS) region of Vibrio cholerae lipopolysaccharide []	Back alignment and domain information

>PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan	Back alignment and domain information

>PLN02436 cellulose synthase A	Back alignment and domain information

>PLN02190 cellulose synthase-like protein	Back alignment and domain information

>cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		229
3f1y_A		387	Mannosyl-3-Phosphoglycerate Synthase From Rubrobact		4e-06
3l7m_A		729	Structure Of The Wall Teichoic Acid Polymerase Tagf		5e-04
3l7j_A		729	Structure Of The Wall Teichoic Acid Polymerase Tagf		5e-04
3l7i_A		729	Structure Of The Wall Teichoic Acid Polymerase Tagf		6e-04

>pdb|3F1Y|A Chain A, Mannosyl-3-Phosphoglycerate Synthase From Rubrobacter Xylanophilus Length = 387

Back alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 40/149 (26%), Positives = 73/149 (48%), Gaps = 15/149 (10%) Query: 68 ISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRK 127 +S ++P+ N + G +DE ++ L +RA ++L++D S DGT VA + Sbjct: 96 VSAVLPSRNVADTVGGIIDE-IHALNERA----PLIDQILVVDADSEDGTAGVAASHGAE 150 Query: 128 YTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEK------LESQ- 180 +N + G HGKG+A+ + + +RG+L+L +DAD L LE Sbjct: 151 VYSENELMSGYGDAHGKGDAMWRALSVTRGDLVLYIDADTRDFRPQLAYGVLGPVLEVPG 210 Query: 181 ---IHAVGRKEYNHGDSVTVDSTFRISDI 206 + A R+ + G+S+ D R++++ Sbjct: 211 VRFVKAAYRRPFRKGESIEEDGGGRVTEL 239

PyMOL of 3f1y

>pdb|3L7M|A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a Length = 729

Back alignment and structure

>pdb|3L7J|A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H444n V Length = 729

Back alignment and structure

>pdb|3L7I|A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf Length = 729

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		229
3ckj_A		329	Putative uncharacterized protein; mycobacteria, un	2e-18
1qg8_A		255	Protein (spore coat polysaccharide biosynthesis P	1e-14
3f1y_A		387	Mannosyl-3-phosphoglycerate synthase; GT-A type gl	1e-13
2z86_A		625	Chondroitin synthase; GT-A, glycosyltransferase A,	2e-13
2z86_A		625	Chondroitin synthase; GT-A, glycosyltransferase A,	4e-12
3l7i_A		729	Teichoic acid biosynthesis protein F; GT-B fold, m	2e-13
2bo4_A		397	Mannosylglycerate synthase; catalysis, glycosyltra	1e-08
2d7i_A		570	Polypeptide N-acetylgalactosaminyltransferase 10;	2e-08
3bcv_A		240	Putative glycosyltransferase protein; protein stru	3e-08
1xhb_A		472	Polypeptide N-acetylgalactosaminyltransferase 1; g	5e-08
2ffu_A		501	Ppgalnact-2, polypeptide N-acetylgalactosaminyltra	1e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
4fix_A		657	UDP-galactofuranosyl transferase GLFT2; CAZY GT-2	3e-04

>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Length = 329	Back alignment and structure

 Score = 81.2 bits (200), Expect = 2e-18
 Identities = 24/102 (23%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 68  ISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRK 127
           IS+++PA +EE  +   +D     +            E++++D GS+D T+  A     +
Sbjct: 50  ISVVLPALDEEDTIGSVIDSISPLV-------DGLVDELIVLDSGSTDDTEIRAVAAGAR 102

Query: 128 YTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGAT 169
                  +  +    GKGEA+ + +  SRG++++ +D+D   
Sbjct: 103 VVSREQALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLIN 144

PyMOL of 3ckj

>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255	Back alignment and structure

>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Length = 387	Back alignment and structure

>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625	Back alignment and structure

>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625	Back alignment and structure

>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729	Back alignment and structure

>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Length = 397	Back alignment and structure

>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570	Back alignment and structure

>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240	Back alignment and structure

>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472	Back alignment and structure

>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Length = 657	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		229
3bcv_A		240	Putative glycosyltransferase protein; protein stru	99.93
1qg8_A		255	Protein (spore coat polysaccharide biosynthesis P	99.93
1xhb_A		472	Polypeptide N-acetylgalactosaminyltransferase 1; g	99.89
3f1y_A		387	Mannosyl-3-phosphoglycerate synthase; GT-A type gl	99.88
3ckj_A		329	Putative uncharacterized protein; mycobacteria, un	99.88
2z86_A		625	Chondroitin synthase; GT-A, glycosyltransferase A,	99.88
2d7i_A		570	Polypeptide N-acetylgalactosaminyltransferase 10;	99.88
4hg6_A		802	Cellulose synthase subunit A; membrane translocati	99.87
2ffu_A		501	Ppgalnact-2, polypeptide N-acetylgalactosaminyltra	99.85
3l7i_A		729	Teichoic acid biosynthesis protein F; GT-B fold, m	99.84
4fix_A		657	UDP-galactofuranosyl transferase GLFT2; CAZY GT-2	99.8
2z86_A		625	Chondroitin synthase; GT-A, glycosyltransferase A,	99.8
2bo4_A		397	Mannosylglycerate synthase; catalysis, glycosyltra	99.7
2wvl_A		391	Mannosyl-3-phosphoglycerate synthase; GT-A fold, t	99.65
2nxv_A		249	ATP synthase subunits region ORF 6; majastridin, A	99.6
2zu9_A		394	Mannosyl-3-phosphoglycerate synthase; GT-A fold, g	99.55
2fy7_A		287	Beta-1,4-galactosyltransferase 1; M339H mutant, AP	99.47
1fo8_A		343	Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl	99.2
3lw6_A		287	FI08434P, beta-4-galactosyltransferase 7; protein-	96.77
3cu0_A		281	Galactosylgalactosylxylosylprotein 3-beta- glucuro	96.76
1v84_A		253	Galactosylgalactosylxylosylprotein 3-beta- glucuro	96.71
2d0j_A		246	Galactosylgalactosylxylosylprotein 3-beta- glucuro	96.28
3k8d_A		264	3-deoxy-manno-octulosonate cytidylyltransferase; K	95.95
3oam_A		252	3-deoxy-manno-octulosonate cytidylyltransferase; c	95.85
1qwj_A		229	Cytidine monophospho-N-acetylneuraminic acid synth	95.4
1omz_A		293	Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro	95.18
3tqd_A		256	3-deoxy-manno-octulosonate cytidylyltransferase; c	95.17
2wee_A		197	MOBA-related protein; unknown function; 1.65A {Myc	94.62
1ezi_A		228	CMP-N-acetylneuraminic acid synthetase; homodimer,	94.38
2waw_A		199	MOBA relate protein; unknown function; HET: PGE; 1	93.59
1h7e_A		245	3-deoxy-manno-octulosonate cytidylyltransferase; n	93.52
3ngw_A		208	Molybdopterin-guanine dinucleotide biosynthesis P	93.22
4fcu_A		253	3-deoxy-manno-octulosonate cytidylyltransferase; s	93.1
3juk_A		281	UDP-glucose pyrophosphorylase (GALU); transfer; HE	92.99
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	92.88
1vic_A		262	3-deoxy-manno-octulosonate cytidylyltransferase; s	92.61
1vgw_A		231	4-diphosphocytidyl-2C-methyl-D-erythritol synthas;	92.27
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	92.27
2y6p_A		234	3-deoxy-manno-octulosonate cytidylyltransferase; l	91.77
2c0n_A		203	A197; thermophil protein, thermophilic virus, STIV	91.73
2yc3_A		228	2-C-methyl-D-erythritol 4-phosphate cytidylyltran	91.55
2ux8_A		297	Glucose-1-phosphate uridylyltransferase; UGPG, GAL	91.45
4ecm_A		269	Glucose-1-phosphate thymidylyltransferase; HET: DA	91.28
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	91.23
3d5n_A		197	Q97W15_sulso; NESG, SSR125, structural genomics, P	91.18
3pnn_A		303	Conserved domain protein; structural genomics, PSI	91.01
3f1c_A		246	Putative 2-C-methyl-D-erythritol 4-phosphate cytid	90.96
1e5k_A		201	Molybdopterin-guanine dinucleotide biosynthesis pr	90.41
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	90.21
2vsh_A		236	TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly	90.2
2qh5_A		308	PMI, ALGA, mannose-6-phosphate isomerase; structur	89.88
2xwl_A		223	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	89.32
3rsb_A		196	Adenosylcobinamide-phosphate guanylyltransferase;	89.05
2e3d_A		302	UTP--glucose-1-phosphate uridylyltransferase; UDP-	88.42
1i52_A		236	4-diphosphocytidyl-2-C-methylerythritol synthase;	87.83
2e8b_A		201	Probable molybdopterin-guanine dinucleotide biosy	87.53
3q80_A		231	2-C-methyl-D-erythritol 4-phosphate cytidyltransf;	87.09
2pa4_A		323	UTP-glucose-1-phosphate uridylyltransferase; phosp	86.6
1fxo_A		293	Glucose-1-phosphate thymidylyltransferase; rhamnos	85.36
2dpw_A		232	Hypothetical protein TTHA0179; transferase, struct	84.01
1vpa_A		234	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	82.52
1lvw_A		295	Glucose-1-phosphate thymidylyltransferase; protein	81.21

>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis}	Back alignment and structure

Probab=99.93  E-value=3.6e-25  Score=177.50  Aligned_cols=109  Identities=24%  Similarity=0.387  Sum_probs=103.2

Q ss_pred             CceEEEEEeecCCCCChHHHHHHHHHHHHHhhhhcCCCceEEEEEECCCCcchHHHHHHHHHHcCCCcEEEEEcCCCCCH
Q 027065           65 EKYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLGRNHGK  144 (229)
Q Consensus        65 ~p~vsviip~~ne~~~l~~~l~sl~~~~~~~~~~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~~~~i~vi~~~~~~gk  144 (229)
                      .|+||||||+||+++.|++||+|+++        |+++++|||||||||+|+|.++++++.++++  ++++++. +|.|+
T Consensus         4 ~p~vsViIp~yn~~~~l~~~l~Sl~~--------q~~~~~eiIvvDd~S~d~t~~~~~~~~~~~~--~i~~i~~-~n~G~   72 (240)
T 3bcv_A            4 IPKVSVIVPIYNVEKYLDQCVQALLA--------QTLSDIEIILIDDESPDNCPKICDDYAAQYP--NIKVIHK-KNAGL   72 (240)
T ss_dssp             CCSEEEEEEESSCTTTHHHHHHHHHT--------CSSSSEEEEEEECCCSSSHHHHHHHHHHHCS--SEEEEEC-CCCCH
T ss_pred             CCcEEEEEecCCCHHHHHHHHHHHHh--------CcCCCeEEEEEECCCCcCHHHHHHHHHhhCC--CEEEEEC-CCCCh
Confidence            56799999999999999999999998        7788999999999999999999999999988  8999974 69999


Q ss_pred             HHHHHHHHHhcCCCEEEEEcCCCCCChhhHHHHHHHHHHh
Q 027065          145 GEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAV  184 (229)
Q Consensus       145 ~~a~n~gl~~a~~d~v~~lD~D~~~~~~~l~~l~~~~~~~  184 (229)
                      +.|+|.|++.|+||||+|+|+|+.+.|++|+++++.+++.
T Consensus        73 ~~a~N~g~~~a~g~~i~~lD~Dd~~~~~~l~~l~~~~~~~  112 (240)
T 3bcv_A           73 GMACNSGLDVATGEYVAFCDSDDYVDSDMYMTMYNVAQKY  112 (240)
T ss_dssp             HHHHHHHHHHCCSSEEEECCTTCCCCTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCCEEEEECCCCcCCHHHHHHHHHHHHhc
Confidence            9999999999999999999999999999999999999874

PyMOL of 3bcv

>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A*	Back alignment and structure

>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17	Back alignment and structure

>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A*	Back alignment and structure

>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A	Back alignment and structure

>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A*	Back alignment and structure

>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A*	Back alignment and structure

>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides}	Back alignment and structure

>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A*	Back alignment and structure

>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A*	Back alignment and structure

>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A*	Back alignment and structure

>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A*	Back alignment and structure

>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A*	Back alignment and structure

>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A*	Back alignment and structure

>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A*	Back alignment and structure

>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A*	Back alignment and structure

>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ...	Back alignment and structure

>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A*	Back alignment and structure

>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster}	Back alignment and structure

>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A*	Back alignment and structure

>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A*	Back alignment and structure

>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens}	Back alignment and structure

>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A*	Back alignment and structure

>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13	Back alignment and structure

>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13	Back alignment and structure

>1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A*	Back alignment and structure

>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0	Back alignment and structure

>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A	Back alignment and structure

>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A	Back alignment and structure

>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP}	Back alignment and structure

>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A*	Back alignment and structure

>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus}	Back alignment and structure

>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A	Back alignment and structure

>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A*	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A*	Back alignment and structure

>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A*	Back alignment and structure

>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A*	Back alignment and structure

>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus}	Back alignment and structure

>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus}	Back alignment and structure

>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A*	Back alignment and structure

>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea}	Back alignment and structure

>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A*	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A*	Back alignment and structure

>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus}	Back alignment and structure

>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis}	Back alignment and structure

>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0	Back alignment and structure

>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A*	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A*	Back alignment and structure

>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A*	Back alignment and structure

>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori}	Back alignment and structure

>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A*	Back alignment and structure

>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii}	Back alignment and structure

>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli}	Back alignment and structure

>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A	Back alignment and structure

>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus}	Back alignment and structure

>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A*	Back alignment and structure

>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ...	Back alignment and structure

>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19	Back alignment and structure

>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13	Back alignment and structure

>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		229
d2bo4a1		381	c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG	1e-11
d1omza_		265	c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf	1e-09
d1xhba2		328	c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa	4e-08
d1qg8a_		255	c.68.1.1 (A:) Spore coat polysaccharide biosynthes	5e-08

>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: MGS-like
domain: Mannosylglycerate synthase, MGS
species: Rhodothermus marinus [TaxId: 29549]

 Score = 60.8 bits (147), Expect = 1e-11
 Identities = 19/123 (15%), Positives = 37/123 (30%), Gaps = 19/123 (15%)

Query: 70  LIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVA-------- 121
           ++ P  +E   +            +         +EVL I        + V         
Sbjct: 3   VVFPFKHEHPEVLLHNVRVAAAHPRV--------HEVLCIGYERDQTYEAVERAAPEISR 54

Query: 122 --FDFVRKYTVDNVRIILLGRNHGKGEAIRKGMLHSRGELLLMLDADGATKVTD-LEKLE 178
                V     + +  +  G+  G   A+R  +  ++ E +   DAD  +   D + K E
Sbjct: 55  ATGTPVSVRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAE 114

Query: 179 SQI 181
              
Sbjct: 115 EAA 117

PyMOL of d2bo4a1

>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265	Back information, alignment and structure

>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328	Back information, alignment and structure

>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		229
d1qg8a_		255	Spore coat polysaccharide biosynthesis protein Sps	99.93
d1xhba2		328	Polypeptide N-acetylgalactosaminyltransferase 1, N	99.92
d1omza_		265	Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga	99.85
d2bo4a1		381	Mannosylglycerate synthase, MGS {Rhodothermus mari	99.39
d1fo8a_		343	N-acetylglucosaminyltransferase I {Rabbit (Oryctol	98.23
d1pzta_		271	beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos	97.12
d1v82a_		252	Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (	96.75
d3cu0a1		261	1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo	95.88
d1qwja_		228	CMP acylneuraminate synthetase {Mouse (Mus musculu	93.43
d1fxoa_		292	RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	91.89
d1mc3a_		291	RffH {Escherichia coli [TaxId: 562]}	89.51
d1lvwa_		295	RmlA (RfbA) {Archaeon Methanobacterium thermoautot	85.96
d1w77a1		226	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	84.99
d1w55a1		205	IspD/IspF bifunctional enzyme, CDP-me synthase dom	83.09
d1h7ea_		245	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	82.37
d1g97a2		250	N-acetylglucosamine 1-phosphate uridyltransferase	80.9

>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Spore coat polysaccharide biosynthesis protein SpsA
domain: Spore coat polysaccharide biosynthesis protein SpsA
species: Bacillus subtilis [TaxId: 1423]

Probab=99.93  E-value=1.1e-25  Score=180.61  Aligned_cols=118  Identities=19%  Similarity=0.266  Sum_probs=107.3

Q ss_pred             ceEEEEEeecCCCCChHHHHHHHHHHHHHhhhhcCCCceEEEEEECCCCcchHHHHHHHHHHcCCCcEEEEEcC------
Q 027065           66 KYISLIIPAFNEEHRLPGALDETLNYLQQRAAKDKSFTYEVLIIDDGSSDGTKRVAFDFVRKYTVDNVRIILLG------  139 (229)
Q Consensus        66 p~vsviip~~ne~~~l~~~l~sl~~~~~~~~~~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~~~~i~vi~~~------  139 (229)
                      |+||||||+||++..|++||+|+++        |+++++|||||||||+|+|.++++++... +  +++++..+      
T Consensus         1 P~vSiiip~yN~~~~l~~~l~Si~~--------Qt~~~~eiivvdd~S~d~t~~~l~~~~~~-~--~i~~~~~~~~~~~~   69 (255)
T d1qg8a_           1 PKVSVIMTSYNKSDYVAKSISSILS--------QTFSDFELFIMDDNSNEETLNVIRPFLND-N--RVRFYQSDISGVKE   69 (255)
T ss_dssp             CCEEEEEEESSCTTTHHHHHHHHHT--------CSCCCEEEEEEECSCCHHHHHHHGGGGGS-T--TEEEEECCCCSHHH
T ss_pred             CEEEEEEecCCCHHHHHHHHHHHHh--------CCCCCeEEEEEECCCCccHHHHHHHhhhh-c--cccccccccccccc
Confidence            6799999999999999999999998        88999999999999999999999988654 3  58888864      


Q ss_pred             --CCCCHHHHHHHHHHhcCCCEEEEEcCCCCCChhhHHHHHHHHHHhCCcceeeccc
Q 027065          140 --RNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLESQIHAVGRKEYNHGDS  194 (229)
Q Consensus       140 --~~~gk~~a~n~gl~~a~~d~v~~lD~D~~~~~~~l~~l~~~~~~~~~~~~~~~~~  194 (229)
                        ++.|.++|+|.|++.|+|+||+++|+|+.+.|++|+.+++.+.++++..++++..
T Consensus        70 ~~~~~g~~~a~N~gi~~a~g~~i~~lD~Dd~~~p~~l~~~~~~~~~~~~~~~v~~~~  126 (255)
T d1qg8a_          70 RTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSAS  126 (255)
T ss_dssp             HHSSCHHHHHHHHHHHHCCCSEEEEEETTEEECTTHHHHHHHHHHHCTTCCEEEEEE
T ss_pred             ccccchhcccccccccccccccccccccccccccchHHHHHHHHHhCCCCCeEeecc
Confidence              5789999999999999999999999999999999999999999988877766543

PyMOL of d1qg8a_

>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}	Back information, alignment and structure

>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}	Back information, alignment and structure

>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}	Back information, alignment and structure

>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure