Citrus Sinensis ID: 027076
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 228 | 2.2.26 [Sep-21-2011] | |||||||
| O14618 | 274 | Copper chaperone for supe | yes | no | 0.947 | 0.788 | 0.406 | 1e-37 | |
| Q6PWT7 | 274 | Copper chaperone for supe | yes | no | 0.947 | 0.788 | 0.411 | 1e-37 | |
| Q9JK72 | 274 | Copper chaperone for supe | yes | no | 0.947 | 0.788 | 0.411 | 4e-37 | |
| Q9WU84 | 274 | Copper chaperone for supe | yes | no | 0.947 | 0.788 | 0.398 | 2e-36 | |
| Q6BK66 | 250 | Superoxide dismutase 1 co | yes | no | 0.942 | 0.86 | 0.310 | 2e-25 | |
| Q6BZU2 | 234 | Superoxide dismutase 1 co | yes | no | 0.894 | 0.871 | 0.321 | 3e-24 | |
| Q6FU61 | 239 | Superoxide dismutase 1 co | yes | no | 0.899 | 0.857 | 0.331 | 2e-20 | |
| Q6CIG2 | 245 | Superoxide dismutase 1 co | yes | no | 0.921 | 0.857 | 0.311 | 4e-20 | |
| Q75DD6 | 238 | Superoxide dismutase 1 co | yes | no | 0.907 | 0.869 | 0.345 | 1e-19 | |
| P40202 | 249 | Superoxide dismutase 1 co | yes | no | 0.925 | 0.847 | 0.303 | 2e-19 |
| >sp|O14618|CCS_HUMAN Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 156 bits (394), Expect = 1e-37, Method: Compositional matrix adjust.
Identities = 96/236 (40%), Positives = 129/236 (54%), Gaps = 20/236 (8%)
Query: 2 VDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVG 61
V M C+ CVDAV++ LQ V GV++VEV L +Q+V + + P + + LE TGR+A L G
Sbjct: 18 VQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKG 77
Query: 62 QGVPEDFLVSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDL 120
G + + AAVA GP V GVVR Q+ E IE GL PG HG ++++GDL
Sbjct: 78 MGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDL 137
Query: 121 TKGAVSTGRVYNPK--IEGSAKEP---LGDLGTVVADEKGEAFFSGVKEMLRVADLIGRS 175
T S G +NP G ++ GDLG V AD G A F E L+V D+IGRS
Sbjct: 138 TNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRS 197
Query: 176 IVVYGTEDKSDSG--------------VTAAVIARSAGVGENYKKICACDGTIIWE 217
+++ ED G + +IARSAG+ +N K+IC+CDG IWE
Sbjct: 198 LIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWE 253
|
Delivers copper to copper zinc superoxide dismutase (SOD1). Homo sapiens (taxid: 9606) |
| >sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9WU84|CCS_MOUSE Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6BK66|CCS1_DEBHA Superoxide dismutase 1 copper chaperone OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCS1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q6BZU2|CCS1_YARLI Superoxide dismutase 1 copper chaperone OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCS1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6FU61|CCS1_CANGA Superoxide dismutase 1 copper chaperone OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCS1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6CIG2|CCS1_KLULA Superoxide dismutase 1 copper chaperone OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCS1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q75DD6|CCS1_ASHGO Superoxide dismutase 1 copper chaperone OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCS1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P40202|CCS1_YEAST Superoxide dismutase 1 copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCS1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 228 | ||||||
| 344190168 | 323 | Cu/Zn-superoxide dismutase copper chaper | 1.0 | 0.705 | 0.842 | 1e-111 | |
| 345106302 | 319 | copper/zinc-superoxide dismutase copper | 1.0 | 0.714 | 0.855 | 1e-111 | |
| 224074743 | 323 | predicted protein [Populus trichocarpa] | 1.0 | 0.705 | 0.833 | 1e-110 | |
| 351722110 | 304 | Cu/Zn-superoxide dismutase copper chaper | 1.0 | 0.75 | 0.824 | 1e-110 | |
| 255537177 | 330 | superoxide dismutase copper chaperone, p | 1.0 | 0.690 | 0.837 | 1e-109 | |
| 256002663 | 314 | copper/zinc superoxide dismutase copper | 1.0 | 0.726 | 0.812 | 1e-107 | |
| 388498152 | 248 | unknown [Lotus japonicus] | 1.0 | 0.919 | 0.807 | 1e-106 | |
| 408717411 | 322 | Cu/Zn-superoxide dismutase copper chaper | 1.0 | 0.708 | 0.811 | 1e-106 | |
| 225426700 | 322 | PREDICTED: copper chaperone for superoxi | 1.0 | 0.708 | 0.811 | 1e-106 | |
| 297742637 | 253 | unnamed protein product [Vitis vinifera] | 1.0 | 0.901 | 0.811 | 1e-106 |
| >gi|344190168|gb|AEM97866.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Corylus heterophylla] | Back alignment and taxonomy information |
|---|
Score = 408 bits (1048), Expect = e-111, Method: Compositional matrix adjust.
Identities = 192/228 (84%), Positives = 212/228 (92%)
Query: 1 MVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLV 60
MVDMKCEGCV+AVK KLQT+ G+KNVEVDLSNQVVRILGS+P+KTMTEALEQTGRKARL+
Sbjct: 96 MVDMKCEGCVNAVKNKLQTINGIKNVEVDLSNQVVRILGSTPVKTMTEALEQTGRKARLI 155
Query: 61 GQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDL 120
GQGVPEDFL+SAAVAEFKGP++FGV RLAQ NMELARIEANFSGLSPGKHGWSINEFGDL
Sbjct: 156 GQGVPEDFLISAAVAEFKGPEIFGVARLAQGNMELARIEANFSGLSPGKHGWSINEFGDL 215
Query: 121 TKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYG 180
T+GA STG+V+NP EG A++PLGDLGT+ ADEKGEAFFSG+KE LR+ADLIGRSIV+YG
Sbjct: 216 TRGAASTGKVFNPVNEGKAEKPLGDLGTLSADEKGEAFFSGIKEKLRIADLIGRSIVIYG 275
Query: 181 TEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 228
TEDKSD GVTAAV+ARSAGVGENYKKIC CDGT IWESS +DF SKV
Sbjct: 276 TEDKSDPGVTAAVVARSAGVGENYKKICTCDGTTIWESSDSDFAISKV 323
|
Source: Corylus heterophylla Species: Corylus heterophylla Genus: Corylus Family: Betulaceae Order: Fagales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|345106302|gb|AEN71836.1| copper/zinc-superoxide dismutase copper chaperone precursor [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|224074743|ref|XP_002304450.1| predicted protein [Populus trichocarpa] gi|222841882|gb|EEE79429.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351722110|ref|NP_001235441.1| Cu/Zn-superoxide dismutase copper chaperone [Glycine max] gi|12711645|gb|AAK01931.1|AF329816_1 Cu/Zn-superoxide dismutase copper chaperone precursor [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255537177|ref|XP_002509655.1| superoxide dismutase copper chaperone, putative [Ricinus communis] gi|223549554|gb|EEF51042.1| superoxide dismutase copper chaperone, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|256002663|gb|ACU52585.1| copper/zinc superoxide dismutase copper chaperone precursor [Caragana jubata] | Back alignment and taxonomy information |
|---|
| >gi|388498152|gb|AFK37142.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|408717411|gb|AFU52882.1| Cu/Zn-superoxide dismutase copper chaperone precursor [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225426700|ref|XP_002281850.1| PREDICTED: copper chaperone for superoxide dismutase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297742637|emb|CBI34786.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 228 | ||||||
| TAIR|locus:2034740 | 320 | CCS "AT1G12520" [Arabidopsis t | 1.0 | 0.712 | 0.755 | 1.3e-91 | |
| UNIPROTKB|Q7XTY9 | 312 | OSJNBa0019K04.8 "Os04g0573200 | 0.956 | 0.698 | 0.748 | 2.1e-84 | |
| ASPGD|ASPL0000007495 | 247 | AN6045 [Emericella nidulans (t | 0.942 | 0.870 | 0.361 | 2e-31 | |
| UNIPROTKB|Q5B085 | 247 | AN6045.2 "Superoxide dismutase | 0.942 | 0.870 | 0.361 | 2e-31 | |
| UNIPROTKB|E1BE86 | 274 | CCS "Uncharacterized protein" | 0.868 | 0.722 | 0.409 | 7.9e-30 | |
| UNIPROTKB|Q6PWT7 | 274 | CCS "Copper chaperone for supe | 0.868 | 0.722 | 0.404 | 1e-29 | |
| UNIPROTKB|J9P9H0 | 350 | CCS "Uncharacterized protein" | 0.929 | 0.605 | 0.398 | 1e-29 | |
| UNIPROTKB|I3LT87 | 257 | CCS "Copper chaperone for supe | 0.890 | 0.789 | 0.382 | 1e-29 | |
| RGD|620403 | 274 | Ccs "copper chaperone for supe | 0.868 | 0.722 | 0.4 | 2.1e-29 | |
| UNIPROTKB|O14618 | 274 | CCS "Copper chaperone for supe | 0.868 | 0.722 | 0.4 | 2.7e-29 |
| TAIR|locus:2034740 CCS "AT1G12520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 913 (326.5 bits), Expect = 1.3e-91, P = 1.3e-91
Identities = 173/229 (75%), Positives = 204/229 (89%)
Query: 1 MVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLV 60
MVDM CEGCV+AVK KL+T+ G++ VEVDLSNQVVRILGSSP+K MT+ALEQTGRKARL+
Sbjct: 92 MVDMTCEGCVNAVKNKLETIEGIEKVEVDLSNQVVRILGSSPVKAMTQALEQTGRKARLI 151
Query: 61 GQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDL 120
GQGVP+DFLVSAAVAEFKGPD+FGVVR AQV+MELARIEANF+GLSPG H W INE+GDL
Sbjct: 152 GQGVPQDFLVSAAVAEFKGPDIFGVVRFAQVSMELARIEANFTGLSPGTHSWCINEYGDL 211
Query: 121 TKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYG 180
T GA STG +YNP + + EPLGDLGT+ AD+ GEAF+SG KE L+VADLIGR++VVY
Sbjct: 212 TNGAASTGSLYNPFQDQTGTEPLGDLGTLEADKNGEAFYSGKKEKLKVADLIGRAVVVYK 271
Query: 181 TED-KSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 228
T+D KS G+TAAVIARSAGVGENYKK+C+CDGT+IWE++++DFVASKV
Sbjct: 272 TDDNKSGPGLTAAVIARSAGVGENYKKLCSCDGTVIWEATNSDFVASKV 320
|
|
| UNIPROTKB|Q7XTY9 OSJNBa0019K04.8 "Os04g0573200 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000007495 AN6045 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5B085 AN6045.2 "Superoxide dismutase copper chaperone Lys7, putative (AFU_orthologue; AFUA_2G09700)" [Aspergillus nidulans FGSC A4 (taxid:227321)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BE86 CCS "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6PWT7 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P9H0 CCS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LT87 CCS "Copper chaperone for superoxide dismutase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|620403 Ccs "copper chaperone for superoxide dismutase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14618 CCS "Copper chaperone for superoxide dismutase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P40202 | CCS1_YEAST | No assigned EC number | 0.3030 | 0.9254 | 0.8473 | yes | no |
| Q6BK66 | CCS1_DEBHA | No assigned EC number | 0.3106 | 0.9429 | 0.86 | yes | no |
| Q6CIG2 | CCS1_KLULA | No assigned EC number | 0.3111 | 0.9210 | 0.8571 | yes | no |
| Q6BZU2 | CCS1_YARLI | No assigned EC number | 0.3214 | 0.8947 | 0.8717 | yes | no |
| Q6FU61 | CCS1_CANGA | No assigned EC number | 0.3318 | 0.8991 | 0.8577 | yes | no |
| Q75DD6 | CCS1_ASHGO | No assigned EC number | 0.3452 | 0.9078 | 0.8697 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 1.15.1.1 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.15.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 228 | |||
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 1e-145 | |
| pfam00080 | 140 | pfam00080, Sod_Cu, Copper/zinc superoxide dismutas | 4e-26 | |
| cd00305 | 144 | cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s | 6e-16 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-10 | |
| PLN02642 | 164 | PLN02642, PLN02642, copper, zinc superoxide dismut | 5e-10 | |
| PLN02386 | 152 | PLN02386, PLN02386, superoxide dismutase [Cu-Zn] | 1e-09 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 2e-07 | |
| COG2032 | 179 | COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan | 3e-06 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 6e-06 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 7e-04 |
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
Score = 404 bits (1039), Expect = e-145
Identities = 178/228 (78%), Positives = 201/228 (88%)
Query: 1 MVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLV 60
MVDMKCEGCV AVK KL+T+ GVK VEVDLSNQVVR+LGSSP+K MT ALEQTGRKARL+
Sbjct: 11 MVDMKCEGCVAAVKNKLETLEGVKAVEVDLSNQVVRVLGSSPVKAMTAALEQTGRKARLI 70
Query: 61 GQGVPEDFLVSAAVAEFKGPDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDL 120
GQG PEDFLVSAAVAEFKGPD+FGVVR AQV+MELARIEA FSGLSPG HGWSINE+GDL
Sbjct: 71 GQGDPEDFLVSAAVAEFKGPDIFGVVRFAQVSMELARIEAAFSGLSPGTHGWSINEYGDL 130
Query: 121 TKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYG 180
T+GA STG+VYNP + + +EPLGDLGT+ ADE GEA FSG KE L+V DLIGRS+ VY
Sbjct: 131 TRGAASTGKVYNPSDDDTDEEPLGDLGTLEADENGEATFSGTKEKLKVWDLIGRSLAVYA 190
Query: 181 TEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 228
T DKS G+ AAVIARSAGVGENYKK+C+CDGT+IWES+++DFVASKV
Sbjct: 191 TADKSGPGIAAAVIARSAGVGENYKKLCSCDGTVIWESTNSDFVASKV 238
|
Length = 238 |
| >gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) | Back alignment and domain information |
|---|
| >gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] | Back alignment and domain information |
|---|
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 228 | |||
| PLN02957 | 238 | copper, zinc superoxide dismutase | 100.0 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 100.0 | |
| PLN02386 | 152 | superoxide dismutase [Cu-Zn] | 100.0 | |
| PLN02642 | 164 | copper, zinc superoxide dismutase | 100.0 | |
| PRK15388 | 177 | Cu/Zn superoxide dismutase; Provisional | 100.0 | |
| cd00305 | 144 | Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide | 100.0 | |
| PRK10290 | 173 | superoxide dismutase; Provisional | 100.0 | |
| KOG0441 | 154 | consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino | 100.0 | |
| PF00080 | 142 | Sod_Cu: Copper/zinc superoxide dismutase (SODC); I | 100.0 | |
| COG2032 | 179 | SodC Cu/Zn superoxide dismutase [Inorganic ion tra | 100.0 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.13 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.96 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.33 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.47 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.41 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.15 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 96.62 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 96.37 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 95.54 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 94.85 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 85.86 |
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.4e-71 Score=469.03 Aligned_cols=227 Identities=78% Similarity=1.215 Sum_probs=215.6
Q ss_pred CCCcChhHHHHHHHHHhCCCCeeEEEEecCCcEEEEEecCChhHHHHHHHhcCccceeeccCCCccccceeeEEEecCCc
Q 027076 2 VDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGPD 81 (228)
Q Consensus 2 ~Gm~C~~C~~~Iek~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~i~~aI~~aGy~~~~~~~~~~~~~~~~~Ava~~~g~~ 81 (228)
++|.|..|+..+++.|++++||..+.+++..+++.+.+....+.+.+.+++.||.+++++.+.++++.++.|++.++|..
T Consensus 12 VgMsC~~Ca~~Iek~L~~~~GV~~v~vn~~~~~v~V~~~~~~~~I~~aIe~~Gy~a~~~~~~~~~~~~~~~av~~~~g~~ 91 (238)
T PLN02957 12 VDMKCEGCVAAVKNKLETLEGVKAVEVDLSNQVVRVLGSSPVKAMTAALEQTGRKARLIGQGDPEDFLVSAAVAEFKGPD 91 (238)
T ss_pred ECccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEecCCHHHHHHHHHHcCCcEEEecCCCccccccceEEEEecCCc
Confidence 47999999999999999999999999999999999987777888999999999999999887777767778999999989
Q ss_pred eEEEEEEEEeCCCcEEEEEEECCCCCCceeeEEeccCCCCCCccccCccccCCCCCCCCCCCCCCcceeeCCCccEEEEE
Q 027076 82 VFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSG 161 (228)
Q Consensus 82 v~G~i~f~q~~~~~v~v~~~i~Gl~~g~h~~hIH~~gd~~~~c~saGgh~np~~~~~~~~~~GDLgni~~~~~G~~~~~~ 161 (228)
|.|+++|+|.+++.++|+++|+||+||.|+|||||+|||+++|.|+|+||||++++|+.+|+||||||.++++|++++++
T Consensus 92 v~G~v~~~~~~~~~v~i~~~~~GL~pg~hg~hiHe~Gd~~~~~~saG~hfnp~~~~h~~~h~GDLgni~~~~~G~a~~~~ 171 (238)
T PLN02957 92 IFGVVRFAQVSMELARIEAAFSGLSPGTHGWSINEYGDLTRGAASTGKVYNPSDDDTDEEPLGDLGTLEADENGEATFSG 171 (238)
T ss_pred eEEEEEEEEcCCCCEEEEEEEcCCCCCcEEEEEcCCCCCCCCccccCCCCCCccCCCCCCCCCccCCEEeCCCceEEEEE
Confidence 99999999988667999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EecceecCCcCceEEEEecCCCCCCCceEEEEEeecccCCcCCCeEEccCCccccccCCCCCccCCC
Q 027076 162 VKEMLRVADLIGRSIVVYGTEDKSDSGVTAAVIARSAGVGENYKKICACDGTIIWESSSNDFVASKV 228 (228)
Q Consensus 162 ~~~~l~l~~iiGRSiVIh~~~dd~g~r~aCgvI~rsag~~~n~k~~c~c~g~~~w~~~~~~~~~~~~ 228 (228)
.+..++|++|+|||||||+++|+.+++++||||+||||+|||+||||+||||||||||.+||.+++|
T Consensus 172 ~~~~~~l~~iiGrs~vih~~~D~~~~~~~~gvi~rsag~~~n~k~~c~c~g~~~w~~~~~~~~~~~~ 238 (238)
T PLN02957 172 TKEKLKVWDLIGRSLAVYATADKSGPGIAAAVIARSAGVGENYKKLCSCDGTVIWESTNSDFVASKV 238 (238)
T ss_pred ECCCcCccccCCcEEEEEeCCCCCCCCeEEEEEecccccccCCceEEeCCCcEEecccCCCcccCCC
Confidence 9999999999999999999999988899999999999999999999999999999999999999876
|
|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02386 superoxide dismutase [Cu-Zn] | Back alignment and domain information |
|---|
| >PLN02642 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK15388 Cu/Zn superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) | Back alignment and domain information |
|---|
| >PRK10290 superoxide dismutase; Provisional | Back alignment and domain information |
|---|
| >KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] | Back alignment and domain information |
|---|
| >COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 228 | ||||
| 1jk9_B | 249 | Heterodimer Between H48f-Ysod1 And Yccs Length = 24 | 2e-20 | ||
| 1do5_A | 154 | Human Copper Chaperone For Superoxide Dismutase Dom | 1e-16 | ||
| 1to4_A | 156 | Structure Of The Cytosolic Cu,Zn Sod From S. Manson | 2e-13 | ||
| 1srd_A | 154 | Three-Dimensional Structure Of Cu,Zn-Superoxide Dis | 2e-13 | ||
| 3mnd_A | 152 | Crystallographic Analysis Of The Cystosolic CuZN SU | 8e-13 | ||
| 1qup_A | 222 | Crystal Structure Of The Copper Chaperone For Super | 9e-13 | ||
| 3km1_A | 154 | Zinc-Reconstituted Tomato Chloroplast Superoxide Di | 2e-11 | ||
| 3f7k_A | 152 | X-Ray Crystal Structure Of An Alvinella Pompejana C | 3e-11 | ||
| 2q2l_A | 152 | Crystal Structure Of Superoxide Dismutase From P. A | 3e-10 | ||
| 2e46_A | 157 | Crystal Structure Analysis Of The Clock Protein Ea4 | 4e-10 | ||
| 3kbe_A | 157 | Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le | 5e-10 | ||
| 2e47_A | 156 | Crystal Structure Analysis Of The Clock Protein Ea4 | 5e-10 | ||
| 1e9o_B | 152 | Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 | 7e-09 | ||
| 1sda_O | 152 | Crystal Structure Of Peroxynitrite-Modified Bovine | 7e-09 | ||
| 1e9q_B | 151 | Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng | 8e-09 | ||
| 1cb4_A | 151 | Crystal Structure Of Copper, Zinc Superoxide Dismut | 8e-09 | ||
| 1q0e_A | 152 | Atomic Resolution (1.15 ) Crystal Structure Of Bovi | 8e-09 | ||
| 1cob_A | 151 | Crystal Structure Solution And Refinement Of The Se | 8e-09 | ||
| 3sod_O | 152 | Changes In Crystallographic Structure And Thermosta | 8e-09 | ||
| 1e9q_A | 151 | Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng | 1e-08 | ||
| 1e9o_A | 152 | Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 | 1e-08 | ||
| 1f1d_A | 154 | Crystal Structure Of Yeast H46c Cuznsod Mutant Leng | 1e-08 | ||
| 1f1g_A | 154 | Crystal Structure Of Yeast Cuznsod Exposed To Nitri | 1e-08 | ||
| 1sdy_A | 153 | Structure Solution And Molecular Dynamics Refinemen | 1e-08 | ||
| 2crl_A | 98 | The Apo Form Of Hma Domain Of Copper Chaperone For | 2e-08 | ||
| 1xso_A | 150 | Three-Dimensional Structure Of Xenopus Laevis Cu,Zn | 2e-08 | ||
| 1f1a_A | 154 | Crystal Structure Of Yeast H48q Cuznsod Fals Mutant | 2e-08 | ||
| 1e9p_A | 151 | Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst | 2e-08 | ||
| 1e9p_B | 151 | Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst | 3e-08 | ||
| 3ltv_A | 153 | Mouse-Human Sod1 Chimera Length = 153 | 3e-08 | ||
| 1b4t_A | 153 | H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE | 4e-08 | ||
| 1jk9_A | 153 | Heterodimer Between H48f-Ysod1 And Yccs Length = 15 | 5e-08 | ||
| 2gbu_A | 153 | C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase | 8e-08 | ||
| 1n18_A | 154 | Thermostable Mutant Of Human Superoxide Dismutase, | 8e-08 | ||
| 3gtt_A | 153 | Mouse Sod1 Length = 153 | 1e-07 | ||
| 1fun_A | 153 | Superoxide Dismutase Mutant With Lys 136 Replaced B | 1e-07 | ||
| 1f18_A | 154 | Crystal Structure Of Yeast Copper-Zinc Superoxide D | 1e-07 | ||
| 1sos_A | 154 | Atomic Structures Of Wild-type And Thermostable Mut | 1e-07 | ||
| 1l3n_A | 153 | The Solution Structure Of Reduced Dimeric Copper Zi | 1e-07 | ||
| 1n19_A | 154 | Structure Of The Hsod A4v Mutant Length = 154 | 1e-07 | ||
| 2gbt_A | 153 | C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 | 2e-07 | ||
| 4b3e_A | 154 | Structure Of Copper-Zinc Superoxide Dismutase Compl | 2e-07 | ||
| 1uxm_A | 153 | A4v Mutant Of Human Sod1 Length = 153 | 3e-07 | ||
| 3gzq_A | 154 | Human Sod1 A4v Metal-Free Variant Length = 154 | 3e-07 | ||
| 3h2p_A | 153 | Human Sod1 D124v Variant Length = 153 | 4e-07 | ||
| 1hl4_A | 154 | The Structure Of Apo Type Human Cu, Zn Superoxide D | 4e-07 | ||
| 1hl5_A | 153 | The Structure Of Holo Type Human Cu, Zn Superoxide | 4e-07 | ||
| 2c9s_A | 153 | 1.24 Angstroms Resolution Structure Of Zn-Zn Human | 4e-07 | ||
| 1ozu_A | 153 | Crystal Structure Of Familial Als Mutant S134n Of H | 4e-07 | ||
| 1p1v_A | 153 | Crystal Structure Of Fals-Associated Human Copper-Z | 4e-07 | ||
| 3h2q_A | 153 | Human Sod1 H80r Variant, P21 Crystal Form Length = | 4e-07 | ||
| 3qqd_A | 154 | Human Sod1 H80r Variant, P212121 Crystal Form Lengt | 4e-07 | ||
| 1oez_W | 153 | Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu | 5e-07 | ||
| 2r27_A | 154 | Constitutively Zinc-Deficient Mutant Of Human Super | 5e-07 | ||
| 4a7g_A | 153 | Structure Of Human I113t Sod1 Mutant Complexed With | 6e-07 | ||
| 3gqf_A | 153 | Structural And Biophysical Properties Of The Pathog | 7e-07 | ||
| 2nnx_A | 154 | Crystal Structure Of The H46r, H48q Double Mutant O | 7e-07 | ||
| 3l9e_A | 154 | Crystal Structures Of Holo And Cu-Deficient CuZNSOD | 9e-07 | ||
| 2wyt_A | 153 | 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng | 9e-07 | ||
| 2zky_A | 159 | Crystal Structure Of Human Cu-Zn Superoxide Dismuta | 1e-06 | ||
| 2wyz_A | 153 | L38v Sod1 Mutant Complexed With Ump Length = 153 | 1e-06 | ||
| 3gtv_A | 153 | Human-Mouse Sod1 Chimera Length = 153 | 1e-06 | ||
| 3l9y_A | 154 | Crystal Structures Of Holo And Cu-Deficient CuZNSOD | 1e-06 | ||
| 1uxl_A | 153 | I113t Mutant Of Human Sod1 Length = 153 | 1e-06 | ||
| 1ptz_A | 153 | Crystal Structure Of The Human Cu, Zn Superoxide Di | 2e-06 | ||
| 3gzp_A | 153 | Human Sod1 G93a Metal-Free Variant Length = 153 | 2e-06 | ||
| 3gzo_A | 154 | Human Sod1 G93a Variant Length = 154 | 2e-06 | ||
| 2zkw_A | 159 | Crystal Structure Of Human Cu-Zn Superoxide Dismuta | 2e-06 | ||
| 2wko_F | 154 | Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 | 2e-06 | ||
| 3ecw_A | 153 | Crystal Structure Of The Als-Related Pathological M | 2e-06 | ||
| 1azv_A | 153 | Familial Als Mutant G37r Cuznsod (Human) Length = 1 | 3e-06 | ||
| 2vr7_A | 154 | Crystal Structure Of G85r Als Mutant Of Human Cu,Zn | 4e-06 | ||
| 2vr6_A | 153 | Crystal Structure Of G85r Als Mutant Of Human Cu,Zn | 4e-06 | ||
| 2vr8_A | 154 | Crystal Structure Of G85r Als Mutant Of Human Cu,Zn | 4e-06 | ||
| 3cqq_A | 153 | Human Sod1 G85r Variant, Structure Ii Length = 153 | 4e-06 | ||
| 1ba9_A | 153 | The Solution Structure Of Reduced Monomeric Superox | 2e-05 | ||
| 1mfm_A | 153 | Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC | 2e-05 | ||
| 1dsw_A | 153 | The Solution Structure Of A Monomeric, Reduced Form | 2e-05 | ||
| 2xjk_A | 153 | Monomeric Human Cu,Zn Superoxide Dismutase Length = | 2e-05 | ||
| 2xjl_A | 153 | Monomeric Human Cu,Zn Superoxide Dismutase Without | 3e-05 | ||
| 3hff_A | 153 | Monomeric Human Cu,Zn Superoxide Dismutase Without | 2e-04 | ||
| 2jlp_A | 222 | Crystal Structure Of Human Extracellular Copper-Zin | 3e-04 | ||
| 3ce1_A | 168 | Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE | 3e-04 | ||
| 4bcy_A | 153 | Monomeric Human Cu,zn Superoxide Dismutase, Mutatio | 5e-04 | ||
| 3cjk_A | 68 | Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Le | 8e-04 | ||
| 1fe4_A | 68 | Crystal Structure Of Mercury-Hah1 Length = 68 | 8e-04 |
| >pdb|1JK9|B Chain B, Heterodimer Between H48f-Ysod1 And Yccs Length = 249 | Back alignment and structure |
|
| >pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 | Back alignment and structure |
| >pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 | Back alignment and structure |
| >pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 | Back alignment and structure |
| >pdb|1QUP|A Chain A, Crystal Structure Of The Copper Chaperone For Superoxide Dismutase Length = 222 | Back alignment and structure |
| >pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 | Back alignment and structure |
| >pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 | Back alignment and structure |
| >pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 | Back alignment and structure |
| >pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 | Back alignment and structure |
| >pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 | Back alignment and structure |
| >pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 | Back alignment and structure |
| >pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 | Back alignment and structure |
| >pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 | Back alignment and structure |
| >pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 | Back alignment and structure |
| >pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 | Back alignment and structure |
| >pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 | Back alignment and structure |
| >pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 | Back alignment and structure |
| >pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 | Back alignment and structure |
| >pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 | Back alignment and structure |
| >pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 | Back alignment and structure |
| >pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 | Back alignment and structure |
| >pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 | Back alignment and structure |
| >pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|2CRL|A Chain A, The Apo Form Of Hma Domain Of Copper Chaperone For Superoxide Dismutase Length = 98 | Back alignment and structure |
| >pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 | Back alignment and structure |
| >pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 | Back alignment and structure |
| >pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 | Back alignment and structure |
| >pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 | Back alignment and structure |
| >pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 | Back alignment and structure |
| >pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 | Back alignment and structure |
| >pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 | Back alignment and structure |
| >pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 | Back alignment and structure |
| >pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 | Back alignment and structure |
| >pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 | Back alignment and structure |
| >pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 | Back alignment and structure |
| >pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 | Back alignment and structure |
| >pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 | Back alignment and structure |
| >pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 | Back alignment and structure |
| >pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 | Back alignment and structure |
| >pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 | Back alignment and structure |
| >pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 | Back alignment and structure |
| >pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 | Back alignment and structure |
| >pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 | Back alignment and structure |
| >pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 | Back alignment and structure |
| >pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 | Back alignment and structure |
| >pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 | Back alignment and structure |
| >pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 | Back alignment and structure |
| >pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 | Back alignment and structure |
| >pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 | Back alignment and structure |
| >pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 | Back alignment and structure |
| >pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 | Back alignment and structure |
| >pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 | Back alignment and structure |
| >pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 | Back alignment and structure |
| >pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 | Back alignment and structure |
| >pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 | Back alignment and structure |
| >pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 | Back alignment and structure |
| >pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 | Back alignment and structure |
| >pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 | Back alignment and structure |
| >pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 | Back alignment and structure |
| >pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 | Back alignment and structure |
| >pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 | Back alignment and structure |
| >pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 | Back alignment and structure |
| >pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 | Back alignment and structure |
| >pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 | Back alignment and structure |
| >pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 | Back alignment and structure |
| >pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 | Back alignment and structure |
| >pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 | Back alignment and structure |
| >pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 | Back alignment and structure |
| >pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 | Back alignment and structure |
| >pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 | Back alignment and structure |
| >pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 | Back alignment and structure |
| >pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 | Back alignment and structure |
| >pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 | Back alignment and structure |
| >pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 | Back alignment and structure |
| >pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 | Back alignment and structure |
| >pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 | Back alignment and structure |
| >pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 | Back alignment and structure |
| >pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 | Back alignment and structure |
| >pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 | Back alignment and structure |
| >pdb|3CJK|A Chain A, Crystal Structure Of The Adduct Hah1-Cd(Ii)-Mnk1 Length = 68 | Back alignment and structure |
| >pdb|1FE4|A Chain A, Crystal Structure Of Mercury-Hah1 Length = 68 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
Score = 191 bits (486), Expect = 3e-61
Identities = 66/240 (27%), Positives = 110/240 (45%), Gaps = 21/240 (8%)
Query: 1 MVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLV 60
+ M CE CV+ +K L+ V G+ ++ D+ Q++ + S T+ L G+ A +
Sbjct: 12 AIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIR 71
Query: 61 GQGVPEDFLVS-------AAVAEFKGPDVFGVVRLAQVNMELARIEANFS-GLSPGKHGW 112
G G P V+ + + K V G+ R+ QV + + G +
Sbjct: 72 GAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHA 131
Query: 113 SINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLI 172
SI+E GD++KG STG+V++ EP+ + + + + L LI
Sbjct: 132 SIHEKGDVSKGVESTGKVWHK-----FDEPIECFNESDLGKNLYSGKTFLSAPLPTWQLI 186
Query: 173 GRSIVVYGTEDKSDSGVTAA-------VIARSAGVGENYKKICACDGTIIWESSSNDFVA 225
GRS V+ + + ++ ++ VIARSAGV EN K++CAC G +WE D +A
Sbjct: 187 GRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWE-ERKDALA 245
|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 | Back alignment and structure |
|---|
| >1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 | Back alignment and structure |
|---|
| >2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 | Back alignment and structure |
|---|
| >3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 | Back alignment and structure |
|---|
| >1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 | Back alignment and structure |
|---|
| >3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 | Back alignment and structure |
|---|
| >2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 | Back alignment and structure |
|---|
| >2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 | Back alignment and structure |
|---|
| >3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 | Back alignment and structure |
|---|
| >1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 | Back alignment and structure |
|---|
| >1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 | Back alignment and structure |
|---|
| >3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 | Back alignment and structure |
|---|
| >2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 | Back alignment and structure |
|---|
| >1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 | Back alignment and structure |
|---|
| >1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 | Back alignment and structure |
|---|
| >1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 | Back alignment and structure |
|---|
| >2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 | Back alignment and structure |
|---|
| >1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 | Back alignment and structure |
|---|
| >1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 228 | |||
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 100.0 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 100.0 | |
| 1do5_A | 154 | Human copper chaperone for superoxide dismutase do | 100.0 | |
| 3pu7_A | 154 | Superoxide dismutase [CU-ZN], chloroplastic; oxido | 100.0 | |
| 3f7l_A | 152 | Copper,zinc superoxide dismutase; oxidoreductase ( | 100.0 | |
| 3l9y_A | 154 | Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY | 100.0 | |
| 3kbe_A | 157 | Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis | 100.0 | |
| 4a7u_A | 153 | Superoxide dismutase [CU-ZN]; oxidoreductase, amyo | 100.0 | |
| 2q2l_A | 152 | Superoxide dismutase; SOD, SAD, antioxidant, oxido | 100.0 | |
| 1f1g_A | 154 | Cuznsod, copper-zinc superoxide dismutase; nitric | 100.0 | |
| 3ce1_A | 168 | Superoxide dismutase [CU-ZN]; greek-KEY beta barre | 100.0 | |
| 1xso_A | 150 | Copper,zinc superoxide dismutase; oxidoreductase ( | 100.0 | |
| 2wyt_A | 153 | Superoxide dismutase [CU-ZN]; oxidoreductase, dise | 100.0 | |
| 1to4_A | 156 | Superoxide dismutase; beta-barrel, oxidoreductase; | 100.0 | |
| 1ej8_A | 140 | Lys7; beta barrel, copper chaperone for SOD, domai | 100.0 | |
| 2e47_A | 156 | EA4, TIME interVal measuring enzyme TIME; motallop | 100.0 | |
| 1eqw_A | 156 | Cu,Zn superoxide dismutase; greek KEY B-barrel, ox | 100.0 | |
| 1oal_A | 151 | Superoxide dismutase; oxidoreductase, prokaryotic | 100.0 | |
| 2aqm_A | 154 | Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 | 100.0 | |
| 2jlp_A | 222 | Extracellular superoxide dismutase (Cu-Zn); glycol | 100.0 | |
| 1xtm_B | 175 | Hypothetical superoxide dismutase-like protein YO; | 100.0 | |
| 2aqp_A | 164 | Superoxide dismutase [CU-ZN]; electrostatic guidan | 100.0 | |
| 1z9n_A | 177 | Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid | 100.0 | |
| 1eso_A | 154 | SOD, Cu, Zn superoxide dismutase; oxidoreductase, | 100.0 | |
| 1pzs_A | 208 | Superoxide dismutase [CU-ZN]; Cu-protein, beta cor | 100.0 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.18 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.06 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.05 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.02 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.94 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.88 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.88 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.87 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.82 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.82 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.82 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.8 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.8 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.8 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.78 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.78 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.77 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.76 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.75 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.72 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.71 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.71 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.69 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.69 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.66 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.66 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.66 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.65 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.63 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.59 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.57 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.57 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.57 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.48 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.39 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.19 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.97 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 97.93 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 97.86 |
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-68 Score=455.79 Aligned_cols=211 Identities=31% Similarity=0.479 Sum_probs=196.0
Q ss_pred CCcChhHHHHHHHHHhCCCCeeEEEEecCCcEEEEEecCChhHHHHHHHhcCccceeeccCCCccccceeeEEEecC---
Q 027076 3 DMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKG--- 79 (228)
Q Consensus 3 Gm~C~~C~~~Iek~L~~~~GV~~v~vdl~~~~v~V~~~~~~~~i~~aI~~aGy~~~~~~~~~~~~~~~~~Ava~~~g--- 79 (228)
.|+|++|+.+|+++|++++||..+++|+..+++.|....++++|.++|+++||.+.+...+.+. ++|||+|++
T Consensus 14 ~MtC~~Ca~~IekaL~~l~GV~~v~Vnl~~~~v~V~~~~~~~~I~~aIe~~Gy~a~~~~~~~~~----~~Av~~l~~~~~ 89 (249)
T 1jk9_B 14 PMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPN----SSAVAILETFQK 89 (249)
T ss_dssp CCCSSSHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHTTTCCCEEEEESSTT----SEEEEEEEESSC
T ss_pred eeccHHHHHHHHHHHhccCCeeEEEEEcCCCeEEEecCCCHHHHHHHHHHhCCCcccccCCccc----ceeEEEeccccc
Confidence 3999999999999999999999999999999999987778899999999999999887766554 479999975
Q ss_pred --------CceEEEEEEEEeCCCcEEEEEEECCCC-CCceeeEEeccCCCCCCccccCccccCCCCCCCCCCCCCCccee
Q 027076 80 --------PDVFGVVRLAQVNMELARIEANFSGLS-PGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSAKEPLGDLGTVV 150 (228)
Q Consensus 80 --------~~v~G~i~f~q~~~~~v~v~~~i~Gl~-~g~h~~hIH~~gd~~~~c~saGgh~np~~~~~~~~~~GDLgni~ 150 (228)
++|+|+++|+|..+++++|+++|+||+ ||.|+|||||+|||+++|.||||||||+++.| ||||||.
T Consensus 90 ~~~~~~~~~~v~G~v~f~q~~~~~~~v~~~~~GL~~~g~hg~hiHe~Gd~~~g~~saG~h~np~~~~h-----GDlgni~ 164 (249)
T 1jk9_B 90 YTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPI-----ECFNESD 164 (249)
T ss_dssp CTTSCTTCCSEEEEEEEEEEETTEEEEEEEEEEESSCEEEEEEEESCCCCTTGGGGGCSEEEECCSCE-----EECEECS
T ss_pred cccccccCCCcEEEEEEEEcCCCCEEEEEEEeCCCCCCcEeEEEEeCCCCCCCcccccCCcCCCCCCc-----cccCCEE
Confidence 369999999997546799999999999 99999999999999999999999999999887 9999999
Q ss_pred eCC-CccEEEEEEecceecCCcCceEEEEecCCCCC-------CCceEEEEEeecccCCcCCCeEEccCCccccccCCCC
Q 027076 151 ADE-KGEAFFSGVKEMLRVADLIGRSIVVYGTEDKS-------DSGVTAAVIARSAGVGENYKKICACDGTIIWESSSND 222 (228)
Q Consensus 151 ~~~-~G~~~~~~~~~~l~l~~iiGRSiVIh~~~dd~-------g~r~aCgvI~rsag~~~n~k~~c~c~g~~~w~~~~~~ 222 (228)
+++ +|++.+ ++++.++|++|+|||||||+++||+ ++|+|||||+|+||+|||+||||+||||||||||++.
T Consensus 165 ~~~~~G~a~~-~~~~~~~l~~iiGrs~vvh~~~Dd~~~~~~~~~~r~aCGvI~~~~g~~~n~k~vc~c~g~~~w~e~~~~ 243 (249)
T 1jk9_B 165 LGKNLYSGKT-FLSAPLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWEERKDA 243 (249)
T ss_dssp SCTTCEEEEE-EEEESCCHHHHTTSEEEEEEECSCGGGSSSSCCEEEEEEECEECCCTTSCCCCCBCCCCCCHHHHHHHH
T ss_pred ecCCCceEEE-EECCCCCccccCCeEEEEECCCccCCCCCCCCCCcEEEEEEeeccccccCCCeEecCCCccccccCchh
Confidence 999 999999 8899999999999999999999985 6899999999999999999999999999999999865
Q ss_pred C
Q 027076 223 F 223 (228)
Q Consensus 223 ~ 223 (228)
+
T Consensus 244 ~ 244 (249)
T 1jk9_B 244 L 244 (249)
T ss_dssp T
T ss_pred h
Confidence 4
|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 | Back alignment and structure |
|---|
| >3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A | Back alignment and structure |
|---|
| >3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A | Back alignment and structure |
|---|
| >3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A | Back alignment and structure |
|---|
| >3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A | Back alignment and structure |
|---|
| >4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... | Back alignment and structure |
|---|
| >2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} | Back alignment and structure |
|---|
| >1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A | Back alignment and structure |
|---|
| >3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} | Back alignment and structure |
|---|
| >1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 | Back alignment and structure |
|---|
| >2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... | Back alignment and structure |
|---|
| >1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A | Back alignment and structure |
|---|
| >1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 | Back alignment and structure |
|---|
| >2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A | Back alignment and structure |
|---|
| >1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* | Back alignment and structure |
|---|
| >1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A | Back alignment and structure |
|---|
| >2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} | Back alignment and structure |
|---|
| >2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A | Back alignment and structure |
|---|
| >2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A | Back alignment and structure |
|---|
| >1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} | Back alignment and structure |
|---|
| >1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A | Back alignment and structure |
|---|
| >1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 228 | ||||
| d1do5a_ | 154 | b.1.8.1 (A:) Copper chaperone for superoxide dismu | 1e-23 | |
| d1ej8a_ | 140 | b.1.8.1 (A:) Copper chaperone for superoxide dismu | 1e-21 | |
| d1oala_ | 151 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot | 1e-18 | |
| d2apsa_ | 155 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti | 1e-15 | |
| d1to4a_ | 156 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo | 3e-15 | |
| d2c9va1 | 153 | b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD | 5e-15 | |
| d1eqwa_ | 155 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm | 9e-15 | |
| d1srda_ | 154 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin | 2e-14 | |
| d1xsoa_ | 150 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri | 2e-14 | |
| d1f1ga_ | 153 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake | 3e-14 | |
| d1pzsa_ | 171 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco | 3e-12 | |
| d1esoa_ | 154 | b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch | 1e-11 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 6e-11 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 3e-10 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 8e-09 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 2e-07 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 3e-07 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 9e-07 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-06 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 3e-06 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-06 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 4e-06 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 4e-06 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 5e-06 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-05 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 2e-05 |
| >d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cu,Zn superoxide dismutase-like family: Cu,Zn superoxide dismutase-like domain: Copper chaperone for superoxide dismutase, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 90.9 bits (225), Expect = 1e-23
Identities = 56/151 (37%), Positives = 72/151 (47%), Gaps = 20/151 (13%)
Query: 70 VSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTG 128
+ AAVA GP V GVVR Q+ E IE GL PG HG ++++GDLT S G
Sbjct: 3 LGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCG 62
Query: 129 RVYNPK-----IEGSAKEPLGDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTED 183
+NP + GDLG V AD G A F E L+V D+IGRS+++ ED
Sbjct: 63 NHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGED 122
Query: 184 --------------KSDSGVTAAVIARSAGV 200
S + +IARSAG+
Sbjct: 123 DLGRGGHPLSKITGNSGERLACGIIARSAGL 153
|
| >d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 | Back information, alignment and structure |
|---|
| >d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 | Back information, alignment and structure |
|---|
| >d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 | Back information, alignment and structure |
|---|
| >d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 | Back information, alignment and structure |
|---|
| >d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 | Back information, alignment and structure |
|---|
| >d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 | Back information, alignment and structure |
|---|
| >d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 | Back information, alignment and structure |
|---|
| >d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 228 | |||
| d1do5a_ | 154 | Copper chaperone for superoxide dismutase, C-termi | 100.0 | |
| d1to4a_ | 156 | Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi | 100.0 | |
| d1srda_ | 154 | Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia | 100.0 | |
| d1xsoa_ | 150 | Cu,Zn superoxide dismutase, SOD {African clawed fr | 100.0 | |
| d2c9va1 | 153 | Cu,Zn superoxide dismutase, SOD {Human (Homo sapie | 100.0 | |
| d1f1ga_ | 153 | Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa | 100.0 | |
| d1ej8a_ | 140 | Copper chaperone for superoxide dismutase, C-termi | 100.0 | |
| d1oala_ | 151 | Cu,Zn superoxide dismutase, SOD {Photobacterium le | 100.0 | |
| d2apsa_ | 155 | Cu,Zn superoxide dismutase, SOD {Actinobacillus pl | 100.0 | |
| d1eqwa_ | 155 | Cu,Zn superoxide dismutase, SOD {Salmonella typhim | 100.0 | |
| d1esoa_ | 154 | Cu,Zn superoxide dismutase, SOD {Escherichia coli | 100.0 | |
| d1pzsa_ | 171 | Cu,Zn superoxide dismutase, SOD {Mycobacterium tub | 100.0 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.42 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.38 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.31 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.3 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.29 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.27 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.25 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.23 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.2 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.2 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.18 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.16 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.16 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.15 |
| >d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cu,Zn superoxide dismutase-like family: Cu,Zn superoxide dismutase-like domain: Copper chaperone for superoxide dismutase, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.3e-45 Score=287.85 Aligned_cols=132 Identities=42% Similarity=0.632 Sum_probs=124.2
Q ss_pred ceeeEEEecCC-ceEEEEEEEEeCCCcEEEEEEECCCCCCceeeEEeccCCCCCCccccCccccCCCCCCC-----CCCC
Q 027076 70 VSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSINEFGDLTKGAVSTGRVYNPKIEGSA-----KEPL 143 (228)
Q Consensus 70 ~~~Ava~~~g~-~v~G~i~f~q~~~~~v~v~~~i~Gl~~g~h~~hIH~~gd~~~~c~saGgh~np~~~~~~-----~~~~ 143 (228)
+.+|||+|+++ .|+|+++|+|..++.++|+++|+||+||.|+|||||+|||+++|.|+|+||||++..|+ .+|.
T Consensus 3 ~~~Ava~~~~~~~v~G~v~f~q~~~~~v~v~~~l~GL~pg~hg~HIHe~Gd~s~~~~s~Ggh~np~~~~h~~~~~~~~h~ 82 (154)
T d1do5a_ 3 LGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR 82 (154)
T ss_dssp CEEEEEEEBCSSSCEEEEEEEEEETTEEEEEEEEESCCSEEEEEEEESCCCCTTGGGTTCSBCCTTCCCCCCTTCSSSCT
T ss_pred cceEEEEECCCCccEEEEEEEEeCCCCEEEEEEEccCCCCceEEEEecCCcCCCCccccccceecccccccCCCCCCCcc
Confidence 35799999875 79999999998767899999999999999999999999999999999999999999983 7899
Q ss_pred CCCcceeeCCCccEEEEEEecceecCCcCceEEEEecCCCCC--------------CCceEEEEEeecccCC
Q 027076 144 GDLGTVVADEKGEAFFSGVKEMLRVADLIGRSIVVYGTEDKS--------------DSGVTAAVIARSAGVG 201 (228)
Q Consensus 144 GDLgni~~~~~G~~~~~~~~~~l~l~~iiGRSiVIh~~~dd~--------------g~r~aCgvI~rsag~~ 201 (228)
||||||.++.+|+++++++++.++|++|+|||||||+++||+ |+|+|||+|+||||+|
T Consensus 83 GDLgni~~~~~G~~~~~~~~~~~~l~~iiGRSiVIH~~~Dd~~~g~~~~s~~~G~aG~RiaCgvI~rsag~~ 154 (154)
T d1do5a_ 83 GDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF 154 (154)
T ss_dssp TEEEEEEECTTSEEEEEEEESSCCHHHHTTSEEEEESSCCCTTCSCSTTTTTTTTCCCEEEEEECEEECCCC
T ss_pred cccCcEEeCCCceEEEEEEcCCccccccCCcEEEEEcCCcccccCCCccccccCCCCCcEEEEEEEeecccC
Confidence 999999999999999999999999999999999999999985 5899999999999999
|
| >d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} | Back information, alignment and structure |
|---|
| >d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} | Back information, alignment and structure |
|---|
| >d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} | Back information, alignment and structure |
|---|
| >d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|