Citrus Sinensis ID: 027116


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKVLINS
cccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccHHHcccccccEEEccccccccccccHHHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccc
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHffngdqhlqnwvddenysdccqWERVECNETIGRVIKLDLAQIRKWESAEWymnaslftpfqqlesldltwNSIAGCvenkgldrlsrlnnlkflhldfnwfnnsifsslgglsslkhLSLFHNrlngsvdikeldslsnleeldmsdnainnpvipkdyrglrklntlhlggteiamidgskvlins
mcgskrvwVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNleeldmsdnainnpvipkdyrGLRKLNTlhlggteiamidgskvlins
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIfsslgglsslkhlslfhNRLNGSVDIKeldslsnleeldmsdNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKVLINS
*****RVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSL**********NAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKV****
****KRV*VSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDG*******
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKVLINS
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKVL*N*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAMIDGSKVLINS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query228 2.2.26 [Sep-21-2011]
Q05091330 Polygalacturonase inhibit N/A no 0.736 0.509 0.307 1e-14
Q9M5J9330 Polygalacturonase inhibit no no 0.719 0.496 0.298 2e-11
Q9C9H7 847 Receptor-like protein 12 no no 0.771 0.207 0.341 9e-11
Q9LRT1 1016 Probably inactive leucine no no 0.868 0.194 0.285 3e-09
Q93Y06 669 Probable inactive recepto no no 0.662 0.225 0.315 4e-08
Q9LVP0 1102 Probable leucine-rich rep no no 0.785 0.162 0.277 4e-08
Q00874 372 DNA-damage-repair/tolerat no no 0.675 0.413 0.294 5e-08
Q8VZG8 1045 Probable LRR receptor-lik no no 0.758 0.165 0.266 5e-08
C0LGQ9 1037 Probable LRR receptor-lik no no 0.723 0.159 0.302 8e-08
Q9FK10 601 Probable inactive recepto no no 0.837 0.317 0.297 1e-07
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function desciption
 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 90/195 (46%), Gaps = 27/195 (13%)

Query: 18  VVKGWWSEGCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRV-- 75
           V+    S+ C   ++  LLQIK  F     L +W  D   +DCC W  V C+ T  R+  
Sbjct: 18  VLNPALSDLCNPDDKKVLLQIKKAFGDPYVLASWKSD---TDCCDWYCVTCDSTTNRINS 74

Query: 76  -----------IKLDLAQIRKWESAEWYMNASLFTPFQQ-------LESLDLTWNSIAGC 117
                      I   +  +   E+ E++   +L  P Q        L+SL L+W +++G 
Sbjct: 75  LTIFAGQVSGQIPALVGDLPYLETLEFHKQPNLTGPIQPAIAKLKGLKSLRLSWTNLSGS 134

Query: 118 VENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDS 177
           V     D LS+L NL FL L FN    +I SSL  L +L  L L  N+L G + I     
Sbjct: 135 VP----DFLSQLKNLTFLDLSFNNLTGAIPSSLSELPNLGALRLDRNKLTGHIPISFGQF 190

Query: 178 LSNLEELDMSDNAIN 192
           + N+ +L +S N ++
Sbjct: 191 IGNVPDLYLSHNQLS 205




Inhibitor of fungal polygalacturonase. It is an important factor for plant resistance to phytopathogenic fungi.
Pyrus communis (taxid: 23211)
>sp|Q9M5J9|PGIP1_ARATH Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y06|Y5720_ARATH Probable inactive receptor kinase At5g67200 OS=Arabidopsis thaliana GN=At5g67200 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
224120284 929 predicted protein [Populus trichocarpa] 0.885 0.217 0.460 2e-42
224142499 436 predicted protein [Populus trichocarpa] 0.899 0.470 0.467 3e-40
224142513290 predicted protein [Populus trichocarpa] 0.881 0.693 0.444 4e-38
224142721 926 predicted protein [Populus trichocarpa] 0.872 0.214 0.458 8e-36
224142723 923 predicted protein [Populus trichocarpa] 0.846 0.209 0.452 1e-35
255585991 743 serine-threonine protein kinase, plant-t 0.890 0.273 0.442 1e-35
224134597 947 predicted protein [Populus trichocarpa] 0.833 0.200 0.453 5e-34
224112233 976 leucine rich repeat family protein with 0.837 0.195 0.462 6e-34
224142717 876 predicted protein [Populus trichocarpa] 0.846 0.220 0.460 2e-33
224120450 935 predicted protein [Populus trichocarpa] 0.671 0.163 0.503 3e-33
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 142/217 (65%), Gaps = 15/217 (6%)

Query: 9   VSELIFILLVVKGWWSEGCLEQERSALLQIKHFFN--GDQHLQNWVDDENYSDCCQWERV 66
           V  +I ++++++GW   GCLE+ER ALLQIK  F+        +W  D N   CC+W++V
Sbjct: 10  VIMIINVVVLIQGWRCHGCLEEERVALLQIKDAFSYPNGSFPHSWGRDAN---CCEWKQV 66

Query: 67  ECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRL 126
           +CN T  RV+K+DL+  R WE  +W +NASLF PF +L +L+L  N IAGC+EN+G +RL
Sbjct: 67  QCNSTTLRVVKIDLSFSRGWELGDWLLNASLFLPFPELNALNLYGNRIAGCLENEGFERL 126

Query: 127 SRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIK----ELDSLSNLE 182
           S L NL+ L L  N FN+SIFSSLGGLSSLK+LSL +N + G++ ++    E+  +SNLE
Sbjct: 127 SVLGNLEILELGQNKFNSSIFSSLGGLSSLKNLSLHNNEIEGTISVEGGEDEVLKMSNLE 186

Query: 183 ELDMSDNAINNPVIPKDYRGLRKLNTL-----HLGGT 214
            LD+  N  +N ++   ++GL  L  L     HL GT
Sbjct: 187 YLDLGGNRFDNSIL-SSFKGLSSLKNLGLEKNHLKGT 222




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142499|ref|XP_002324594.1| predicted protein [Populus trichocarpa] gi|222866028|gb|EEF03159.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142513|ref|XP_002324601.1| predicted protein [Populus trichocarpa] gi|222866035|gb|EEF03166.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585991|ref|XP_002533665.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526433|gb|EEF28711.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112233|ref|XP_002332812.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] gi|222833206|gb|EEE71683.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.942 0.220 0.305 6.3e-21
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.820 0.205 0.313 6.1e-19
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.815 0.198 0.306 4.6e-18
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.907 0.214 0.272 7.8e-18
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.600 0.145 0.301 1e-11
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.412 0.086 0.386 3.5e-10
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.907 0.244 0.274 5.3e-10
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.565 0.177 0.326 7e-10
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.469 0.123 0.328 8.2e-09
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.688 0.176 0.254 4.2e-08
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 6.3e-21, P = 6.3e-21
 Identities = 73/239 (30%), Positives = 115/239 (48%)

Query:     3 GSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQIKHFFNG-------DQHLQNWVDDE 55
             G   +WV   + +L+ ++G+  + C+E+ER ALL++K +          D  L  W +D 
Sbjct:     8 GQNLIWV---MLLLVQLRGY--KCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDT 62

Query:    56 NYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLESLDLT---WN 112
               S+CC+WE ++CN+T GR+I+L + Q    ES+   +N SL  PF++L SL+L+   +N
Sbjct:    63 K-SNCCRWEGLKCNQTSGRIIELSIGQTNFKESS--LLNLSLLHPFEELRSLNLSGEIYN 119

Query:   113 SIAGCVEN-KGLDRLSRLNNLKFLHLDFNWFNNSIXXXXXXXXXXXXXXXXXNRLNGSVD 171
                G  ++ +G + L RL NL+ L L  N FNNSI                 N + G + 
Sbjct:   120 EFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLP 179

Query:   172 IKXXXXXXXXXXXXXXXNAINNPVIPKDYRGLRKLNTLHLGGTEIAMI---DGSKVLIN 227
             IK               +  N   IP ++  L KL  L L   + + +      KVL N
Sbjct:   180 IKELKNLTKLELLDLSRSGYNGS-IP-EFTHLEKLKALDLSANDFSSLVELQELKVLTN 236




GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 7e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 55.6 bits (134), Expect = 4e-09
 Identities = 38/113 (33%), Positives = 60/113 (53%), Gaps = 6/113 (5%)

Query: 99  TPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKH 158
           T    LE L L  N + G +  +    L ++ +LK+++L +N  +  I   +GGL+SL H
Sbjct: 185 TNLTSLEFLTLASNQLVGQIPRE----LGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNH 240

Query: 159 LSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHL 211
           L L +N L G +    L +L NL+ L +  N ++ P IP     L+KL +L L
Sbjct: 241 LDLVYNNLTGPIP-SSLGNLKNLQYLFLYQNKLSGP-IPPSIFSLQKLISLDL 291


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 228
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN03150623 hypothetical protein; Provisional 99.73
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.45
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.45
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.44
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.4
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.38
PLN03150623 hypothetical protein; Provisional 99.38
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.31
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.15
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.13
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.11
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.1
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.09
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.06
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.04
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.99
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.84
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.78
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.72
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.7
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.64
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.55
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.48
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.46
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.39
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.93
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.92
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.86
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.75
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.64
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.5
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.45
PRK15386 426 type III secretion protein GogB; Provisional 97.43
PRK15386 426 type III secretion protein GogB; Provisional 96.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.59
smart0037026 LRR Leucine-rich repeats, outliers. 96.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.54
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.44
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.31
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.98
KOG4308 478 consensus LRR-containing protein [Function unknown 94.84
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.77
smart0037026 LRR Leucine-rich repeats, outliers. 94.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.72
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 93.99
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.54
KOG1947 482 consensus Leucine rich repeat proteins, some prote 92.65
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.81
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.83
KOG4308 478 consensus LRR-containing protein [Function unknown 90.7
KOG1947 482 consensus Leucine rich repeat proteins, some prote 89.51
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 87.07
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.04
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 84.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.16
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.93  E-value=7.1e-25  Score=205.35  Aligned_cols=177  Identities=26%  Similarity=0.404  Sum_probs=121.2

Q ss_pred             cHHHHHHHHHHHhhCCCCC-CCCCCCCCCCCCCCceeeeEEECCCCCcEEEEEcCCCCcccccccccCcccccCCCCCCE
Q 027116           28 LEQERSALLQIKHFFNGDQ-HLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRKWESAEWYMNASLFTPFQQLES  106 (228)
Q Consensus        28 ~~~~~~~l~~~~~~~~~~~-~~~~W~~~~~~~~~c~~~gv~c~~~~~~v~~L~l~~n~l~~~~~~~~~~~~~~~l~~L~~  106 (228)
                      .+.|+.||++||+.+.++. .+.+|.   ...+||.|.|++|.+ .++|+.|++++|.+..  .   .+..+..+++|++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~--~---~~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGKNISG--K---ISSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCCCccc--c---CChHHhCCCCCCE
Confidence            6689999999999998775 778994   567899999999986 5799999999998743  2   1345667777777


Q ss_pred             EeCCCCCcccccCcccccccCCC----------------------CCCcEEECCCCccCcccccccCCCCCCCEEeccCc
Q 027116          107 LDLTWNSIAGCVENKGLDRLSRL----------------------NNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHN  164 (228)
Q Consensus       107 L~ls~n~l~~~~~~~~~~~l~~l----------------------~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n  164 (228)
                      |++++|++.+..|...   +..+                      ++|++|++++|.+++..|..++.+++|++|++++|
T Consensus        98 L~Ls~n~~~~~ip~~~---~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n  174 (968)
T PLN00113         98 INLSNNQLSGPIPDDI---FTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN  174 (968)
T ss_pred             EECCCCccCCcCChHH---hccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccC
Confidence            7777777765544431   2234                      44555555555555555555666666666666666


Q ss_pred             cccCccChhhhcCCCCCCEEEcccCCCCCCCChhhhcCCCCCcEEECCCCcCCc
Q 027116          165 RLNGSVDIKELDSLSNLEELDMSDNAINNPVIPKDYRGLRKLNTLHLGGTEIAM  218 (228)
Q Consensus       165 ~l~~~~p~~~~~~l~~L~~L~L~~N~l~~~~p~~~~~~l~~L~~L~L~~N~i~~  218 (228)
                      .+.+.+|. .+.++++|++|++++|.+.+.+|. .+.++++|++|++++|+++.
T Consensus       175 ~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~n~l~~  226 (968)
T PLN00113        175 VLVGKIPN-SLTNLTSLEFLTLASNQLVGQIPR-ELGQMKSLKWIYLGYNNLSG  226 (968)
T ss_pred             cccccCCh-hhhhCcCCCeeeccCCCCcCcCCh-HHcCcCCccEEECcCCccCC
Confidence            66655555 566666666666666666665555 66666666666666666653



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-12
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 7e-12
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 9e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 4e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 6e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  122 bits (308), Expect = 4e-32
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 16/195 (8%)

Query: 26  GCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQWERVECNETIGRVIKLDLAQIRK 85
             L +E   L+  K        L +W  +    + C ++ V C +   +V  +DL+    
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLPDWSSN---KNPCTFDGVTCRD--DKVTSIDLSSKP- 61

Query: 86  WESAEWYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNS 145
                  +++SL      LESL L+ + I G      +       +L  L L  N  +  
Sbjct: 62  LNVGFSAVSSSLL-SLTGLESLFLSNSHING-----SVSGFKCSASLTSLDLSRNSLSGP 115

Query: 146 I--FSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNAINNPVIP--KDYR 201
           +   +SLG  S LK L++  N L+    +     L++LE LD+S N+I+   +       
Sbjct: 116 VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD 175

Query: 202 GLRKLNTLHLGGTEI 216
           G  +L  L + G +I
Sbjct: 176 GCGELKHLAISGNKI 190


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.77
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.77
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.75
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.75
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.74
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.73
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.71
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.7
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.7
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.69
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.68
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.67
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.64
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.64
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.57
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.57
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.51
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.5
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.5
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.49
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.49
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.46
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.44
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.43
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.43
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.98
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.92
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.66
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.92
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.53
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.49
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.96  E-value=1.2e-29  Score=208.33  Aligned_cols=185  Identities=23%  Similarity=0.396  Sum_probs=153.8

Q ss_pred             CCcHHHHHHHHHHHhhCCCCCCCCCCCCCCCCCCCce--eeeEEECCCC--CcEEEEEcCCCCcccccccccCcccccCC
Q 027116           26 GCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCCQ--WERVECNETI--GRVIKLDLAQIRKWESAEWYMNASLFTPF  101 (228)
Q Consensus        26 ~~~~~~~~~l~~~~~~~~~~~~~~~W~~~~~~~~~c~--~~gv~c~~~~--~~v~~L~l~~n~l~~~~~~~~~~~~~~~l  101 (228)
                      .|.++|+.||++||+.+.++..+.+|.   .+.+||.  |.||.|+...  ++|+.|+++++.+.  +...+ +..+..+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~--~~~~~-~~~l~~l   75 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP--KPYPI-PSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS--SCEEC-CGGGGGC
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCcc--CCccc-ChhHhCC
Confidence            699999999999999998776788994   4568898  9999998644  79999999999984  31112 3467889


Q ss_pred             CCCCEEeCCC-CCcccccCcccccccCCCCCCcEEECCCCccCcccccccCCCCCCCEEeccCccccCccChhhhcCCCC
Q 027116          102 QQLESLDLTW-NSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSN  180 (228)
Q Consensus       102 ~~L~~L~ls~-n~l~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~  180 (228)
                      ++|++|++++ |.+.+..|..    +..+++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|. .+..+++
T Consensus        76 ~~L~~L~L~~~n~l~~~~p~~----l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~-~~~~l~~  150 (313)
T 1ogq_A           76 PYLNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISSLPN  150 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGGCTT
T ss_pred             CCCCeeeCCCCCcccccCChh----HhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCCh-HHhcCCC
Confidence            9999999995 8888877766    88889999999999999888888888899999999999999877777 7888999


Q ss_pred             CCEEEcccCCCCCCCChhhhcCCC-CCcEEECCCCcCCcccCC
Q 027116          181 LEELDMSDNAINNPVIPKDYRGLR-KLNTLHLGGTEIAMIDGS  222 (228)
Q Consensus       181 L~~L~L~~N~l~~~~p~~~~~~l~-~L~~L~L~~N~i~~i~~~  222 (228)
                      |++|++++|.+++.+|. .+..++ +|++|++++|+++...+.
T Consensus       151 L~~L~L~~N~l~~~~p~-~l~~l~~~L~~L~L~~N~l~~~~~~  192 (313)
T 1ogq_A          151 LVGITFDGNRISGAIPD-SYGSFSKLFTSMTISRNRLTGKIPP  192 (313)
T ss_dssp             CCEEECCSSCCEEECCG-GGGCCCTTCCEEECCSSEEEEECCG
T ss_pred             CCeEECcCCcccCcCCH-HHhhhhhcCcEEECcCCeeeccCCh
Confidence            99999999999876787 787787 888888888888744333



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 228
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 52.7 bits (125), Expect = 7e-09
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 11/100 (11%)

Query: 91  WYMNASLFTPFQQLESLDLTWNSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSL 150
              + S  +  + L  L L +N+I        +  +S L  L+ L    N    S  SSL
Sbjct: 296 QLEDISPISNLKNLTYLTLYFNNI------SDISPVSSLTKLQRLFFANNKV--SDVSSL 347

Query: 151 GGLSSLKHLSLFHNRLNGSVDIKELDSLSNLEELDMSDNA 190
             L+++  LS  HN+++    +  L +L+ + +L ++D A
Sbjct: 348 ANLTNINWLSAGHNQISD---LTPLANLTRITQLGLNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.07
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.99
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.87
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.79
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.45
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.72
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=8.9e-30  Score=206.90  Aligned_cols=187  Identities=24%  Similarity=0.396  Sum_probs=162.7

Q ss_pred             CCcHHHHHHHHHHHhhCCCCCCCCCCCCCCCCCCCc--eeeeEEECCC--CCcEEEEEcCCCCcccccccccCcccccCC
Q 027116           26 GCLEQERSALLQIKHFFNGDQHLQNWVDDENYSDCC--QWERVECNET--IGRVIKLDLAQIRKWESAEWYMNASLFTPF  101 (228)
Q Consensus        26 ~~~~~~~~~l~~~~~~~~~~~~~~~W~~~~~~~~~c--~~~gv~c~~~--~~~v~~L~l~~n~l~~~~~~~~~~~~~~~l  101 (228)
                      -|+++|++||++||+.+.++..+++|   ..+++||  .|.||+|++.  ..||++|||+++++.  |...+ +..++++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW---~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~--g~~~l-p~~l~~L   75 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSW---LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP--KPYPI-PSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTC---CTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS--SCEEC-CGGGGGC
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCC---CCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCC--CCCCC-ChHHhcC
Confidence            49999999999999999988888999   4567999  5999999863  348999999999984  33223 3568999


Q ss_pred             CCCCEEeCCC-CCcccccCcccccccCCCCCCcEEECCCCccCcccccccCCCCCCCEEeccCccccCccChhhhcCCCC
Q 027116          102 QQLESLDLTW-NSIAGCVENKGLDRLSRLNNLKFLHLDFNWFNNSIFSSLGGLSSLKHLSLFHNRLNGSVDIKELDSLSN  180 (228)
Q Consensus       102 ~~L~~L~ls~-n~l~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~  180 (228)
                      ++|++|++++ |++++.+|..    +.++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|. .+..++.
T Consensus        76 ~~L~~L~Ls~~N~l~g~iP~~----i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~-~l~~l~~  150 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISSLPN  150 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGGCTT
T ss_pred             ccccccccccccccccccccc----cccccccchhhhccccccccccccccchhhhcccccccccccccCch-hhccCcc
Confidence            9999999996 8999888776    89999999999999999998888899999999999999999988887 8999999


Q ss_pred             CCEEEcccCCCCCCCChhhhcCCCCC-cEEECCCCcCCcccCCcc
Q 027116          181 LEELDMSDNAINNPVIPKDYRGLRKL-NTLHLGGTEIAMIDGSKV  224 (228)
Q Consensus       181 L~~L~L~~N~l~~~~p~~~~~~l~~L-~~L~L~~N~i~~i~~~~~  224 (228)
                      ++.+++++|.+.+.+|. .+..+..+ +.+++++|+++......+
T Consensus       151 L~~l~l~~n~l~~~ip~-~~~~l~~l~~~l~~~~n~l~~~~~~~~  194 (313)
T d1ogqa_         151 LVGITFDGNRISGAIPD-SYGSFSKLFTSMTISRNRLTGKIPPTF  194 (313)
T ss_dssp             CCEEECCSSCCEEECCG-GGGCCCTTCCEEECCSSEEEEECCGGG
T ss_pred             cceeecccccccccccc-ccccccccccccccccccccccccccc
Confidence            99999999999988888 77777765 899999999987665443



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure