Citrus Sinensis ID: 027264


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR
cHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccHHHHHccccccEEEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccHHHHcccHHHHHHcccccHHHHHHHHHcccccc
cHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccHHHHHcccccHcccccccccccccccccEEEHHHccHHccccccccEEcccccccccHHHHccccccEEEccccEEccccHHHHHHcHHHHHHccccHHHHHHHHHHHccccc
MASILARKSLSALRARHLAVSgqalqgsqhyglrfnahpyssyfpskkddeEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLkyffdkkvtinypfekgplsprfrgehalrryptgeerciACKLCEAVCPAQAITIeaeeredgsrrttrydidmtkciycgfcqeacpvdaivegpnfeysteTHEELLYDKEKLLENGDRWETEIAENlrseslyr
MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYpfekgplsprfrgeHALRRYPTGEERCIACKLCEAVCPAQaitieaeeredgsrrttrydiDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKllengdrweteiaenlrseslyr
MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSkkddeekeqllkeISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHeellydkeklleNGDRWETEIAENLRSESLYR
****************************QHYGLRFNAHPY*******************ISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEA*********TTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLE********************
*****************************************************************SVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENL*****Y*
MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAE********TTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR
*****************************************************EQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEER*DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q9FX83222 NADH dehydrogenase [ubiqu yes no 0.982 1.0 0.876 1e-112
Q42599222 NADH dehydrogenase [ubiqu no no 0.982 1.0 0.867 1e-111
P80269229 NADH dehydrogenase [ubiqu N/A no 0.991 0.978 0.826 1e-109
O24143230 NADH dehydrogenase [ubiqu N/A no 1.0 0.982 0.804 1e-106
P42028212 NADH dehydrogenase [ubiqu yes no 0.752 0.801 0.788 3e-78
O21233162 NADH-ubiquinone oxidoredu N/A no 0.712 0.993 0.826 3e-78
Q8K3J1212 NADH dehydrogenase [ubiqu yes no 0.915 0.976 0.635 6e-78
P0CB97210 NADH dehydrogenase [ubiqu yes no 0.752 0.809 0.776 3e-77
Q60HE3210 NADH dehydrogenase [ubiqu N/A no 0.752 0.809 0.776 4e-77
P0CB98210 NADH dehydrogenase [ubiqu N/A no 0.752 0.809 0.764 4e-76
>sp|Q9FX83|NDS8B_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial OS=Arabidopsis thaliana GN=At1g16700 PE=1 SV=1 Back     alignment and function desciption
 Score =  404 bits (1038), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/226 (87%), Positives = 205/226 (90%), Gaps = 4/226 (1%)

Query: 1   MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEI 60
           MAS+LAR+S SALRARHLA SGQ LQGS   GL+  A  Y S     KDDEE EQL KEI
Sbjct: 1   MASLLARRSFSALRARHLAFSGQGLQGSHLCGLQSRAISYGS----NKDDEEAEQLAKEI 56

Query: 61  SKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRY 120
           SKDWS+VFERS+N LFLTEMVRGL LTLKYFFD KVTINYPFEKGPLSPRFRGEHALRRY
Sbjct: 57  SKDWSTVFERSMNTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRY 116

Query: 121 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 180
           PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA
Sbjct: 117 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 176

Query: 181 IVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226
           IVEGPNFE++TETHEELLYDKEKLLENGDRWETEIAENLRSESLYR
Sbjct: 177 IVEGPNFEFATETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 222




Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). May donate electrons to ubiquinone.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 9EC: 9EC: .EC: 3
>sp|Q42599|NDS8A_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana GN=At1g79010 PE=1 SV=1 Back     alignment and function description
>sp|P80269|NDUS8_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Solanum tuberosum PE=1 SV=2 Back     alignment and function description
>sp|O24143|NDUS8_TOBAC NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus GN=NDUFS8 PE=1 SV=1 Back     alignment and function description
>sp|O21233|NDUS8_RECAM NADH-ubiquinone oxidoreductase subunit 8 OS=Reclinomonas americana GN=NAD8 PE=3 SV=1 Back     alignment and function description
>sp|Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus GN=Ndufs8 PE=1 SV=1 Back     alignment and function description
>sp|P0CB97|NDUS8_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii GN=NDUFS8 PE=2 SV=1 Back     alignment and function description
>sp|Q60HE3|NDUS8_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis GN=NDUFS8 PE=2 SV=1 Back     alignment and function description
>sp|P0CB98|NDUS8_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo pygmaeus GN=NDUFS8 PE=2 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2015636222 AT1G16700 [Arabidopsis thalian 0.982 1.0 0.778 1.7e-89
TAIR|locus:2207285222 AT1G79010 [Arabidopsis thalian 0.982 1.0 0.774 1.6e-88
RGD|1309436212 Ndufs8 "NADH dehydrogenase (ub 0.725 0.773 0.719 2.3e-66
ZFIN|ZDB-GENE-040426-2153210 ndufs8a "NADH dehydrogenase (u 0.725 0.780 0.719 9.4e-66
UNIPROTKB|E2R5X8210 NDUFS8 "Uncharacterized protei 0.734 0.790 0.734 1.5e-65
UNIPROTKB|P42028212 NDUFS8 "NADH dehydrogenase [ub 0.734 0.783 0.734 2e-65
UNIPROTKB|P0CB97210 NDUFS8 "NADH dehydrogenase [ub 0.725 0.780 0.737 3.2e-65
UNIPROTKB|Q60HE3210 NDUFS8 "NADH dehydrogenase [ub 0.725 0.780 0.737 1.1e-64
ZFIN|ZDB-GENE-050522-131210 ndufs8b "NADH dehydrogenase (u 0.738 0.795 0.724 1.1e-64
UNIPROTKB|O00217210 NDUFS8 "NADH dehydrogenase [ub 0.725 0.780 0.731 1.4e-64
TAIR|locus:2015636 AT1G16700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 893 (319.4 bits), Expect = 1.7e-89, P = 1.7e-89
 Identities = 176/226 (77%), Positives = 183/226 (80%)

Query:     1 MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSXXXXXXXXXXXXXI 60
             MAS+LAR+S SALRARHLA SGQ LQGS   GL+  A  Y S                 I
Sbjct:     1 MASLLARRSFSALRARHLAFSGQGLQGSHLCGLQSRAISYGS----NKDDEEAEQLAKEI 56

Query:    61 SKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRY 120
             SKDWS+VFERS+N LFLTEMVRGL LTLKYFFD KVTINYPFEKGPLSPRFRGEHALRRY
Sbjct:    57 SKDWSTVFERSMNTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRY 116

Query:   121 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 180
             PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA
Sbjct:   117 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 176

Query:   181 IVEGPNFEYSTETHXXXXXXXXXXXXNGDRWETEIAENLRSESLYR 226
             IVEGPNFE++TETH            NGDRWETEIAENLRSESLYR
Sbjct:   177 IVEGPNFEFATETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 222




GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016651 "oxidoreductase activity, acting on NAD(P)H" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046872 "metal ion binding" evidence=IDA
GO:0005747 "mitochondrial respiratory chain complex I" evidence=IDA
TAIR|locus:2207285 AT1G79010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1309436 Ndufs8 "NADH dehydrogenase (ubiquinone) Fe-S protein 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2153 ndufs8a "NADH dehydrogenase (ubiquinone) Fe-S protein 8a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5X8 NDUFS8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P42028 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P0CB97 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q60HE3 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-131 ndufs8b "NADH dehydrogenase (ubiquinone) Fe-S protein 8b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O00217 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q163R7NUOI_ROSDO1, ., 6, ., 9, 9, ., 50.74210.70350.9695yesno
Q2W3J2NUOI_MAGSA1, ., 6, ., 9, 9, ., 50.72670.71230.9938yesno
P29921NQO9_PARDE1, ., 6, ., 9, 9, ., 50.75470.70350.9754yesno
A1B486NUOI_PARDP1, ., 6, ., 9, 9, ., 50.75470.70350.9754yesno
Q42599NDS8A_ARATH1, ., 6, ., 9, 9, ., 30.86720.98231.0nono
Q1RKD0NUOI_RICBR1, ., 6, ., 9, 9, ., 50.75480.68580.9748yesno
B0BVB0NUOI_RICRO1, ., 6, ., 9, 9, ., 50.74830.68580.9748yesno
B9JVF4NUOI_AGRVS1, ., 6, ., 9, 9, ., 50.73410.69460.9631yesno
O00217NDUS8_HUMAN1, ., 6, ., 9, 9, ., 30.76470.75220.8095yesno
C3PLS5NUOI_RICAE1, ., 6, ., 9, 9, ., 50.75480.68580.9748yesno
Q28T58NUOI_JANSC1, ., 6, ., 9, 9, ., 50.76100.70350.9695yesno
Q92G94NUOI_RICCN1, ., 6, ., 9, 9, ., 50.74830.68580.9748yesno
A7IP99NUOI_XANP21, ., 6, ., 9, 9, ., 50.74370.70350.9814yesno
Q1GIM9NUOI_RUEST1, ., 6, ., 9, 9, ., 50.76720.70350.9695yesno
A7HY41NUOI_PARL11, ., 6, ., 9, 9, ., 50.73750.70350.9754yesno
Q1MIK6NUOI_RHIL31, ., 6, ., 9, 9, ., 50.75150.69020.9570yesno
A8I407NUOI_AZOC51, ., 6, ., 9, 9, ., 50.74370.70350.9814yesno
Q8K3J1NDUS8_MOUSE1, ., 6, ., 9, 9, ., 30.63550.91590.9764yesno
A8GY32NUOI_RICB81, ., 6, ., 9, 9, ., 50.75480.68580.9748yesno
Q3J3F0NUOI1_RHOS41, ., 6, ., 9, 9, ., 50.76100.70350.9520yesno
P0CB98NDUS8_PONPY1, ., 6, ., 9, 9, ., 30.76470.75220.8095N/Ano
Q2RU32NUOI_RHORT1, ., 6, ., 9, 9, ., 50.75790.69460.9691yesno
Q0BSL0NUOI_GRABC1, ., 6, ., 9, 9, ., 50.72040.71230.9938yesno
P0CB97NDUS8_PONAB1, ., 6, ., 9, 9, ., 30.77640.75220.8095yesno
Q60HE3NDUS8_MACFA1, ., 6, ., 9, 9, ., 30.77640.75220.8095N/Ano
Q2NA74NUOI_ERYLH1, ., 6, ., 9, 9, ., 50.820.66370.9259yesno
Q92QP4NUOI1_RHIME1, ., 6, ., 9, 9, ., 50.75790.69020.9512yesno
A8F2T4NUOI_RICM51, ., 6, ., 9, 9, ., 50.74190.68580.9748yesno
Q4UK24NUOI_RICFE1, ., 6, ., 9, 9, ., 50.74190.68580.9748yesno
B6ISX3NUOI_RHOCS1, ., 6, ., 9, 9, ., 50.74210.70350.9814yesno
O21233NDUS8_RECAM1, ., 6, ., 5, ., 30.82600.71230.9938N/Ano
P80269NDUS8_SOLTU1, ., 6, ., 9, 9, ., 30.82680.99110.9781N/Ano
O24143NDUS8_TOBAC1, ., 6, ., 9, 9, ., 30.80431.00.9826N/Ano
P42031NUOI_RHOCA1, ., 6, ., 9, 9, ., 50.73580.70350.9754yesno
C4K221NUOI_RICPU1, ., 6, ., 9, 9, ., 50.74830.68580.9748yesno
Q5LPS9NUOI_RUEPO1, ., 6, ., 9, 9, ., 50.77350.70350.9695yesno
A8GPY5NUOI_RICAH1, ., 6, ., 9, 9, ., 50.73540.68580.9748yesno
A8GTS0NUOI_RICRS1, ., 6, ., 9, 9, ., 50.74830.68580.9748yesno
Q2G5Z4NUOI_NOVAD1, ., 6, ., 9, 9, ., 50.80640.68580.9627yesno
Q2K9S4NUOI1_RHIEC1, ., 6, ., 9, 9, ., 50.75150.69020.9570yesno
Q22619NDUS8_CAEEL1, ., 6, ., 9, 9, ., 30.79480.69020.7358yesno
Q12644NDUS8_NEUCR1, ., 6, ., 9, 9, ., 30.60.89820.9269N/Ano
Q9FX83NDS8B_ARATH1, ., 6, ., 9, 9, ., 30.87610.98231.0yesno
Q0MQI2NDUS8_GORGO1, ., 6, ., 9, 9, ., 30.75880.75220.8095N/Ano
Q0MQI3NDUS8_PANTR1, ., 6, ., 9, 9, ., 30.76470.75220.8095yesno
A8LIV0NUOI_DINSH1, ., 6, ., 9, 9, ., 50.74840.70350.9695yesno
Q8UFW9NUOI_AGRT51, ., 6, ., 9, 9, ., 50.74050.69460.9631yesno
A3PIX9NUOI1_RHOS11, ., 6, ., 9, 9, ., 50.76100.70350.9520yesno
Q0APY2NUOI_MARMM1, ., 6, ., 9, 9, ., 50.74050.69910.9753yesno
P42028NDUS8_BOVIN1, ., 6, ., 9, 9, ., 30.78820.75220.8018yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.6.5.30.994
3rd Layer1.6.990.998
3rd Layer1.6.99.30.994
3rd Layer1.6.50.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT1G16700
NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative; NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative; FUNCTIONS IN- NADH dehydrogenase (ubiquinone) activity, metal ion binding; LOCATED IN- mitochondrion, respiratory chain complex I; CONTAINS InterPro DOMAIN/s- 4Fe-4S ferredoxin, iron-sulphur binding, subgroup (InterPro-IPR001450), NADH-quinone oxidoreductase, chain I (InterPro-IPR010226), 4Fe-4S ferredoxin, iron-sulphur binding, conserved site (InterPro-IPR017900), 4Fe-4S ferredoxin, iron-sulpur binding domain (InterPro-IPR017896), Alpha-helica [...] (222 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
CI51
CI51 (51 kDa subunit of complex I); 4 iron, 4 sulfur cluster binding / FMN binding / NAD or NAD [...] (486 aa)
  0.999
EMB1467
EMB1467 (embryo defective 1467); NADH dehydrogenase (ubiquinone)/ NADH dehydrogenase/ electron [...] (748 aa)
  0.998
AT4G02580
NADH-ubiquinone oxidoreductase 24 kDa subunit, putative; NADH-ubiquinone oxidoreductase 24 kDa [...] (255 aa)
  0.998
AT5G11770
NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial; NADH-ubiquinone oxidoreductase 20 [...] (218 aa)
  0.997
NAD9
unknown protein; NADH dehydrogenase subunit 9 ; Core subunit of the mitochondrial membrane resp [...] (190 aa)
  0.985
NAD7
unknown protein; NADH dehydrogenase subunit 7 ; Core subunit of the mitochondrial membrane resp [...] (394 aa)
  0.975
NDHE
unknown protein; NADH dehydrogenase ND4L ; NDH shuttles electrons from NAD(P)H-plastoquinone, v [...] (101 aa)
    0.971
AT2G20360
binding / catalytic/ coenzyme binding; binding / catalytic/ coenzyme binding; FUNCTIONS IN- coe [...] (402 aa)
     0.963
AT5G47890
NADH-ubiquinone oxidoreductase B8 subunit, putative; NADH-ubiquinone oxidoreductase B8 subunit, [...] (97 aa)
    0.963
AT5G67590.1-P
FRO1 (FROSTBITE1); NADH dehydrogenase (ubiquinone); Mutant leaves have a reduced capacity for c [...] (154 aa)
    0.961

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
PRK05888164 PRK05888, PRK05888, NADH dehydrogenase subunit I; 6e-95
COG1143172 COG1143, NuoI, Formate hydrogenlyase subunit 6/NAD 9e-66
TIGR01971122 TIGR01971, NuoI, NADH-quinone oxidoreductase, chai 8e-65
PRK08222181 PRK08222, PRK08222, hydrogenase 4 subunit H; Valid 3e-17
PRK12387180 PRK12387, PRK12387, formate hydrogenlyase complex 4e-17
TIGR00403183 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase 4e-17
CHL00014167 CHL00014, ndhI, NADH dehydrogenase subunit I 7e-16
pfam1283848 pfam12838, Fer4_7, 4Fe-4S dicluster domain 1e-12
PRK13984 604 PRK13984, PRK13984, putative oxidoreductase; Provi 6e-12
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 4e-11
COG114599 COG1145, NapF, Ferredoxin [Energy production and c 7e-11
TIGR02512 374 TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, grou 1e-10
PRK08348120 PRK08348, PRK08348, NADH-plastoquinone oxidoreduct 3e-10
pfam1318744 pfam13187, Fer4_9, 4Fe-4S dicluster domain 1e-09
pfam1348467 pfam13484, Fer4_16, 4Fe-4S double cluster binding 2e-09
TIGR0217978 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoredu 2e-09
pfam1323751 pfam13237, Fer4_10, 4Fe-4S dicluster domain 4e-09
COG3383 978 COG3383, COG3383, Uncharacterized anaerobic dehydr 6e-09
TIGR02700234 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ02 6e-09
COG114668 COG1146, COG1146, Ferredoxin [Energy production an 8e-09
PRK06273165 PRK06273, PRK06273, ferredoxin; Provisional 2e-08
COG114491 COG1144, COG1144, Pyruvate:ferredoxin oxidoreducta 2e-08
COG1149 284 COG1149, COG1149, MinD superfamily P-loop ATPase c 3e-08
TIGR04105 462 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro 3e-08
COG2221317 COG2221, DsrA, Dissimilatory sulfite reductase (de 7e-08
TIGR04105 462 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro 8e-08
TIGR02494 295 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activa 2e-07
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 2e-07
PRK13795636 PRK13795, PRK13795, hypothetical protein; Provisio 3e-07
PRK14028312 PRK14028, PRK14028, pyruvate ferredoxin oxidoreduc 4e-07
COG2768354 COG2768, COG2768, Uncharacterized Fe-S center prot 4e-07
pfam0003724 pfam00037, Fer4, 4Fe-4S binding domain 1e-06
COG0437203 COG0437, HybA, Fe-S-cluster-containing hydrogenase 1e-06
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase 2e-06
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase 2e-06
pfam1318354 pfam13183, Fer4_8, 4Fe-4S dicluster domain 5e-06
PRK09623105 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxido 8e-06
PRK09898208 PRK09898, PRK09898, hypothetical protein; Provisio 1e-05
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfAB 1e-05
COG0437203 COG0437, HybA, Fe-S-cluster-containing hydrogenase 2e-05
TIGR03336595 TIGR03336, IOR_alpha, indolepyruvate ferredoxin ox 2e-05
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenas 2e-05
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 5e-05
COG4231640 COG4231, COG4231, Indolepyruvate ferredoxin oxidor 8e-05
pfam0003724 pfam00037, Fer4, 4Fe-4S binding domain 1e-04
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase 1e-04
TIGR04003 314 TIGR04003, rSAM_BssD, [benzylsuccinate synthase]-a 1e-04
TIGR03224 411 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reduc 1e-04
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfAB 2e-04
COG1148 622 COG1148, HdrA, Heterodisulfide reductase, subunit 2e-04
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 2e-04
PRK14993244 PRK14993, PRK14993, tetrathionate reductase subuni 2e-04
PRK12769 654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 2e-04
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 2e-04
pfam1283724 pfam12837, Fer4_6, 4Fe-4S binding domain 2e-04
TIGR03294228 TIGR03294, FrhG, coenzyme F420 hydrogenase, subuni 3e-04
TIGR04041 276 TIGR04041, activase_YjjW, glycine radical enzyme a 4e-04
COG1600337 COG1600, COG1600, Uncharacterized Fe-S protein [En 4e-04
PRK06991 270 PRK06991, PRK06991, ferredoxin; Provisional 4e-04
COG114668 COG1146, COG1146, Ferredoxin [Energy production an 5e-04
COG1149 284 COG1149, COG1149, MinD superfamily P-loop ATPase c 5e-04
TIGR03287391 TIGR03287, methan_mark_16, putative methanogenesis 5e-04
PRK09898208 PRK09898, PRK09898, hypothetical protein; Provisio 6e-04
pfam1345960 pfam13459, Fer4_15, 4Fe-4S single cluster domain 6e-04
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 6e-04
TIGR02163255 TIGR02163, napH_, ferredoxin-type protein, NapH/Ma 6e-04
TIGR04270535 TIGR04270, Rama_corrin_act, methylamine methyltran 7e-04
pfam1283724 pfam12837, Fer4_6, 4Fe-4S binding domain 8e-04
PRK09624105 PRK09624, porD, pyuvate ferredoxin oxidoreductase 8e-04
PRK05113191 PRK05113, PRK05113, electron transport complex pro 0.001
TIGR02486314 TIGR02486, RDH, reductive dehalogenase 0.001
PRK09326 341 PRK09326, PRK09326, F420H2 dehydrogenase subunit F 0.001
pfam1348467 pfam13484, Fer4_16, 4Fe-4S double cluster binding 0.002
COG2878198 COG2878, COG2878, Predicted NADH:ubiquinone oxidor 0.002
COG2878198 COG2878, COG2878, Predicted NADH:ubiquinone oxidor 0.002
PRK10330181 PRK10330, PRK10330, formate dehydrogenase-H ferred 0.002
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 0.002
PRK00941 781 PRK00941, PRK00941, acetyl-CoA decarbonylase/synth 0.002
COG1150195 COG1150, HdrC, Heterodisulfide reductase, subunit 0.002
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 0.003
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 0.003
TIGR00397213 TIGR00397, mauM_napG, MauM/NapG family ferredoxin- 0.003
TIGR02745 434 TIGR02745, ccoG_rdxA_fixG, cytochrome c oxidase ac 0.003
TIGR02176 1165 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flav 0.003
TIGR02060132 TIGR02060, aprB, adenosine phosphosulphate reducta 0.003
PRK00783263 PRK00783, PRK00783, DNA-directed RNA polymerase su 0.003
COG1034 693 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone 0.004
TIGR0293691 TIGR02936, fdxN_nitrog, ferredoxin III, nif-specif 0.004
PRK08764135 PRK08764, PRK08764, ferredoxin; Provisional 0.004
>gnl|CDD|235637 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
 Score =  274 bits (702), Expect = 6e-95
 Identities = 109/159 (68%), Positives = 128/159 (80%)

Query: 68  FERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERC 127
            ++ +  + L E+++GLG+TLKYFF KKVTI YP EK PLSPRFRG HALRR P GEERC
Sbjct: 1   IKQYLKSMLLKELLKGLGVTLKYFFKKKVTIQYPEEKLPLSPRFRGRHALRRDPNGEERC 60

Query: 128 IACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNF 187
           IACKLC A+CPA AITIEA EREDG RRTTRYDI+  +CI+CGFC+EACP DAIVE P+F
Sbjct: 61  IACKLCAAICPADAITIEAAEREDGRRRTTRYDINFGRCIFCGFCEEACPTDAIVETPDF 120

Query: 188 EYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226
           E +TET EEL+YDKEKLL NGDR E EIA    +++ YR
Sbjct: 121 ELATETREELIYDKEKLLANGDRVEREIAPGKAADANYR 159


Length = 164

>gnl|CDD|224066 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233661 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>gnl|CDD|181301 PRK08222, PRK08222, hydrogenase 4 subunit H; Validated Back     alignment and domain information
>gnl|CDD|183492 PRK12387, PRK12387, formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|129498 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>gnl|CDD|214334 CHL00014, ndhI, NADH dehydrogenase subunit I Back     alignment and domain information
>gnl|CDD|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|224068 COG1145, NapF, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233903 TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, group A Back     alignment and domain information
>gnl|CDD|181399 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|221966 pfam13187, Fer4_9, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain Back     alignment and domain information
>gnl|CDD|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>gnl|CDD|205417 pfam13237, Fer4_10, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>gnl|CDD|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235764 PRK06273, PRK06273, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|224067 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3 Back     alignment and domain information
>gnl|CDD|225131 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3 Back     alignment and domain information
>gnl|CDD|233895 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172522 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>gnl|CDD|225358 COG2768, COG2768, Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|215671 pfam00037, Fer4, 4Fe-4S binding domain Back     alignment and domain information
>gnl|CDD|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|170016 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234170 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>gnl|CDD|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|226684 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215671 pfam00037, Fer4, 4Fe-4S binding domain Back     alignment and domain information
>gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|188518 TIGR04003, rSAM_BssD, [benzylsuccinate synthase]-activating enzyme Back     alignment and domain information
>gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184955 PRK14993, PRK14993, tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|205098 pfam12837, Fer4_6, 4Fe-4S binding domain Back     alignment and domain information
>gnl|CDD|132337 TIGR03294, FrhG, coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>gnl|CDD|188556 TIGR04041, activase_YjjW, glycine radical enzyme activase, YjjW family Back     alignment and domain information
>gnl|CDD|224516 COG1600, COG1600, Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234157 TIGR03287, methan_mark_16, putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233754 TIGR02163, napH_, ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>gnl|CDD|211993 TIGR04270, Rama_corrin_act, methylamine methyltransferase corrinoid protein reductive activase Back     alignment and domain information
>gnl|CDD|205098 pfam12837, Fer4_6, 4Fe-4S binding domain Back     alignment and domain information
>gnl|CDD|170017 PRK09624, porD, pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional Back     alignment and domain information
>gnl|CDD|233890 TIGR02486, RDH, reductive dehalogenase Back     alignment and domain information
>gnl|CDD|181779 PRK09326, PRK09326, F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain Back     alignment and domain information
>gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|182382 PRK10330, PRK10330, formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|179174 PRK00941, PRK00941, acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|224072 COG1150, HdrC, Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|129492 TIGR00397, mauM_napG, MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>gnl|CDD|233993 TIGR02745, ccoG_rdxA_fixG, cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>gnl|CDD|131231 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>gnl|CDD|131115 TIGR02060, aprB, adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>gnl|CDD|234837 PRK00783, PRK00783, DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234064 TIGR02936, fdxN_nitrog, ferredoxin III, nif-specific Back     alignment and domain information
>gnl|CDD|181550 PRK08764, PRK08764, ferredoxin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG3256212 consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 100.0
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 99.93
PRK05888164 NADH dehydrogenase subunit I; Provisional 99.79
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 99.78
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 99.7
CHL00014167 ndhI NADH dehydrogenase subunit I 99.66
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 99.54
PRK08222181 hydrogenase 4 subunit H; Validated 99.47
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 99.44
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 99.37
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 99.31
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 99.31
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 99.27
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 99.25
PRK13984 604 putative oxidoreductase; Provisional 99.19
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 99.18
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 99.15
PRK06273165 ferredoxin; Provisional 99.15
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 99.14
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 99.14
PRK06991270 ferredoxin; Provisional 99.09
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 99.06
CHL0006581 psaC photosystem I subunit VII 99.05
PLN0007181 photosystem I subunit VII; Provisional 99.04
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 99.04
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 99.03
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 99.0
COG114668 Ferredoxin [Energy production and conversion] 99.0
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 99.0
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 98.99
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 98.97
COG114599 NapF Ferredoxin [Energy production and conversion] 98.96
PRK0265181 photosystem I subunit VII; Provisional 98.96
PRK05113191 electron transport complex protein RnfB; Provision 98.96
PRK09477271 napH quinol dehydrogenase membrane component; Prov 98.96
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 98.94
TIGR02494 295 PFLE_PFLC glycyl-radical enzyme activating protein 98.91
COG1149 284 MinD superfamily P-loop ATPase containing an inser 98.9
PRK05035 695 electron transport complex protein RnfC; Provision 98.88
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 98.87
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 98.85
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 98.85
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 98.84
PRK08764135 ferredoxin; Provisional 98.82
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 98.8
COG2768354 Uncharacterized Fe-S center protein [General funct 98.77
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 98.74
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 98.72
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 98.72
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 98.72
PRK10194163 ferredoxin-type protein; Provisional 98.71
PRK09898208 hypothetical protein; Provisional 98.7
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 98.7
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 98.69
PRK10194163 ferredoxin-type protein; Provisional 98.69
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 98.68
PRK14993244 tetrathionate reductase subunit B; Provisional 98.68
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 98.68
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 98.67
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 98.66
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 98.65
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 98.64
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 98.61
PRK08493 819 NADH dehydrogenase subunit G; Validated 98.61
PRK07118280 ferredoxin; Validated 98.61
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 98.61
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 98.6
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 98.6
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.59
PRK10882328 hydrogenase 2 protein HybA; Provisional 98.57
COG2221317 DsrA Dissimilatory sulfite reductase (desulfovirid 98.57
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 98.57
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 98.56
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 98.55
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 98.53
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 98.52
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 98.52
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 98.51
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 98.51
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 98.49
PRK07118280 ferredoxin; Validated 98.49
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 98.49
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 98.48
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 98.46
PRK14993244 tetrathionate reductase subunit B; Provisional 98.44
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 98.44
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 98.44
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 98.43
PRK09476254 napG quinol dehydrogenase periplasmic component; P 98.42
PRK09898208 hypothetical protein; Provisional 98.42
PRK09129 776 NADH dehydrogenase subunit G; Validated 98.41
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 98.4
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 98.39
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 98.39
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 98.39
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.38
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 98.37
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 98.36
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 98.36
PRK13795636 hypothetical protein; Provisional 98.35
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 98.33
PRK09476254 napG quinol dehydrogenase periplasmic component; P 98.33
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 98.33
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 98.32
PRK10882 328 hydrogenase 2 protein HybA; Provisional 98.32
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 98.31
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 98.31
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 98.31
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 98.31
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 98.3
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 98.3
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.3
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.29
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.29
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.29
PRK09130 687 NADH dehydrogenase subunit G; Validated 98.29
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 98.28
PRK1544995 ferredoxin-like protein FixX; Provisional 98.28
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 98.26
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 98.26
TIGR02066341 dsrB sulfite reductase, dissimilatory-type beta su 98.25
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 98.24
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 98.24
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 98.22
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 98.19
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 98.16
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 98.15
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 98.1
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 98.1
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 98.07
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 98.06
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 98.06
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 98.02
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.01
TIGR00314 784 cdhA CO dehydrogenase/acetyl-CoA synthase complex, 97.97
PRK00941 781 acetyl-CoA decarbonylase/synthase complex subunit 97.93
TIGR00276282 iron-sulfur cluster binding protein, putative. Thi 97.93
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as ace 97.9
PRK13409 590 putative ATPase RIL; Provisional 97.89
TIGR02486314 RDH reductive dehalogenase. This model represents 97.86
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 97.86
PRK11168 396 glpC sn-glycerol-3-phosphate dehydrogenase subunit 97.86
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 97.77
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 97.71
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 97.71
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase 97.68
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 97.68
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.66
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 97.64
TIGR02910334 sulfite_red_A sulfite reductase, subunit A. Member 97.63
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.62
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 97.59
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and co 97.58
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 97.57
COG1139459 Uncharacterized conserved protein containing a fer 97.56
COG244099 FixX Ferredoxin-like protein [Energy production an 97.55
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 97.51
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 97.5
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 97.46
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 97.4
COG1600337 Uncharacterized Fe-S protein [Energy production an 97.35
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha su 97.33
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 97.3
TIGR02064402 dsrA sulfite reductase, dissimilatory-type alpha s 97.3
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 97.27
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 97.24
PRK13984 604 putative oxidoreductase; Provisional 97.23
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 97.14
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 97.07
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 97.05
PRK09477271 napH quinol dehydrogenase membrane component; Prov 97.03
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 97.01
TIGR02484 372 CitB CitB domain protein. CobZ is essential for co 96.98
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 96.96
COG114168 Fer Ferredoxin [Energy production and conversion] 96.82
KOG3256212 consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 96.82
PF1337058 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 96.79
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 96.77
PRK08222181 hydrogenase 4 subunit H; Validated 96.66
PF1345965 Fer4_15: 4Fe-4S single cluster domain 96.65
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 96.63
PRK15033 389 tricarballylate utilization protein B; Provisional 96.62
COG114599 NapF Ferredoxin [Energy production and conversion] 96.57
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 96.41
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 96.35
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 96.33
COG114668 Ferredoxin [Energy production and conversion] 96.33
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 96.23
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 96.22
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 96.14
PF1374669 Fer4_18: 4Fe-4S dicluster domain 96.09
PLN0007181 photosystem I subunit VII; Provisional 96.05
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 96.0
PRK06273165 ferredoxin; Provisional 95.99
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 95.92
CHL0006581 psaC photosystem I subunit VII 95.91
COG1035 332 FrhB Coenzyme F420-reducing hydrogenase, beta subu 95.88
COG2221317 DsrA Dissimilatory sulfite reductase (desulfovirid 95.86
TIGR02494 295 PFLE_PFLC glycyl-radical enzyme activating protein 95.78
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 95.75
PRK08493 819 NADH dehydrogenase subunit G; Validated 95.72
COG0348386 NapH Polyferredoxin [Energy production and convers 95.65
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 95.62
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 95.58
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 95.34
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma sub 95.27
PF1374669 Fer4_18: 4Fe-4S dicluster domain 95.25
PRK06991 270 ferredoxin; Provisional 95.23
PRK05888164 NADH dehydrogenase subunit I; Provisional 95.21
CHL00014167 ndhI NADH dehydrogenase subunit I 95.17
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 94.98
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 94.97
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 94.93
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 94.9
PRK13409 590 putative ATPase RIL; Provisional 94.83
PRK0265181 photosystem I subunit VII; Provisional 94.82
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 94.67
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 94.65
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 94.63
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 94.39
PRK05113191 electron transport complex protein RnfB; Provision 94.34
PRK08764135 ferredoxin; Provisional 94.11
COG1149 284 MinD superfamily P-loop ATPase containing an inser 94.09
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 94.09
TIGR02066341 dsrB sulfite reductase, dissimilatory-type beta su 93.84
PRK12814652 putative NADPH-dependent glutamate synthase small 93.68
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 93.64
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 93.63
PRK1544995 ferredoxin-like protein FixX; Provisional 93.45
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 93.39
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 93.33
COG114168 Fer Ferredoxin [Energy production and conversion] 93.31
TIGR02486314 RDH reductive dehalogenase. This model represents 93.25
PLN02805555 D-lactate dehydrogenase [cytochrome] 93.05
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 92.99
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 92.99
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 92.91
PF1345965 Fer4_15: 4Fe-4S single cluster domain 92.73
TIGR00276282 iron-sulfur cluster binding protein, putative. Thi 92.7
PF02913248 FAD-oxidase_C: FAD linked oxidases, C-terminal dom 92.6
TIGR00387413 glcD glycolate oxidase, subunit GlcD. This protein 92.47
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 92.44
PF1337058 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 92.19
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 92.12
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 92.01
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 91.91
COG2768354 Uncharacterized Fe-S center protein [General funct 91.74
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 91.42
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 91.34
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 91.19
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 91.17
cd07032291 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA poly 90.96
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 90.85
PRK12771564 putative glutamate synthase (NADPH) small subunit; 90.68
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 90.62
PRK13795636 hypothetical protein; Provisional 90.47
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 90.27
COG1600337 Uncharacterized Fe-S protein [Energy production an 89.59
PRK07860 797 NADH dehydrogenase subunit G; Validated 89.41
PRK09129 776 NADH dehydrogenase subunit G; Validated 88.49
PRK09130 687 NADH dehydrogenase subunit G; Validated 88.26
PRK08166 847 NADH dehydrogenase subunit G; Validated 87.97
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 87.65
PRK05035 695 electron transport complex protein RnfC; Provision 86.85
COG1035 332 FrhB Coenzyme F420-reducing hydrogenase, beta subu 86.46
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 86.45
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 86.45
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 85.99
PRK11230499 glycolate oxidase subunit GlcD; Provisional 85.68
TIGR02910334 sulfite_red_A sulfite reductase, subunit A. Member 85.14
PRK12814652 putative NADPH-dependent glutamate synthase small 85.11
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 84.66
PRK098531019 putative selenate reductase subunit YgfK; Provisio 83.14
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 82.69
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 82.27
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 82.2
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 81.96
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 81.9
TIGR02064402 dsrA sulfite reductase, dissimilatory-type alpha s 81.33
KOG3049288 consensus Succinate dehydrogenase, Fe-S protein su 80.93
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 80.56
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 80.2
>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=5.5e-38  Score=239.47  Aligned_cols=205  Identities=74%  Similarity=1.197  Sum_probs=177.5

Q ss_pred             HhhhhHhhhhccCCcccCcccccCCCCCCCCCchhHHHHHHHHHHHhhhHHHHHHHHHHHhhhHHHHHHHHHHHHHhcCC
Q 027264           15 ARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDK   94 (226)
Q Consensus        15 ~~~~~i~Gha~~gn~~~~~~~~~H~~~~~~~~~~p~~~~~~~~~~~~~~v~~~~~~~i~~~~~~~~~~~l~~~~~~~f~~   94 (226)
                      ..+.+++|.++.|.  +|.+. +|+   .....+.+.++. -++++...+...++.......+.+++++++++++++|+.
T Consensus         8 ~~~~~~~gq~~~g~--~~~r~-~~~---~~~~~~~~y~~v-~~~e~~~~~~~~~n~~~~tl~~te~~rGf~itLsh~f~~   80 (212)
T KOG3256|consen    8 ALTLALSGQRLQGS--HGVRL-LSS---NYGSVKDDYKYV-NMKEMSPDITGVMNRGQQTLFATELIRGFMITLSHTFRE   80 (212)
T ss_pred             HHHHHhccCcccCC--ccccc-chh---hhccccccceee-chhccchHHHHHHHHHHHHHHHHHHHHHHHhhHHhhcCC
Confidence            33788899998888  22222 122   122223333332 236666666677777777888999999999999999999


Q ss_pred             cceecCccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhccCCccccccccCCCCCCcchhhhh
Q 027264           95 KVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQE  174 (226)
Q Consensus        95 ~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~~~~~~~~~~~~d~~~C~~Cg~Cv~  174 (226)
                      ++++|||+++++++++|+|.|.+.+++...++||.|..|+.+||..+|+++...+..+++....+.+|...|+.||.|+.
T Consensus        81 p~TInYPfEKgplS~RFRGehalrRyp~geerCIACklCeavCPaqaitieae~r~dgsrRttrYdIDmtkCIyCG~CqE  160 (212)
T KOG3256|consen   81 PVTINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEERTDGSRRTTRYDIDMTKCIYCGFCQE  160 (212)
T ss_pred             CeeecCccccCCCCcccccchhhhcCCCcchhhhhHHHHHHhCCcccceeeceecCCccccceeecccceeeeeecchhh
Confidence            99999999999999999999999999999999999999999999999999998888888888899999999999999999


Q ss_pred             cCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCchHHHHHHhhhhcccC
Q 027264          175 ACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR  226 (226)
Q Consensus       175 ~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  226 (226)
                      +||++||..++.|+++++++++++|+++.+...|+.|+..++.|+|.|-|||
T Consensus       161 aCPvdaivegpnfEfsTetheELlYnkekLl~ngd~Wese~a~N~~~~~lyr  212 (212)
T KOG3256|consen  161 ACPVDAIVEGPNFEFSTETHEELLYNKEKLLTNGDRWESEIAKNLQAELLYR  212 (212)
T ss_pred             hCCccceeccCCceeccccHHHHhhhHHHHhhccccccchhhhcccchhhcC
Confidence            9999999999999999999999999999999999999999999999999997



>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK15449 ferredoxin-like protein FixX; Provisional Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>TIGR00276 iron-sulfur cluster binding protein, putative Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>TIGR02484 CitB CitB domain protein Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PF13459 Fer4_15: 4Fe-4S single cluster domain Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>PRK15033 tricarballylate utilization protein B; Provisional Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG0348 NapH Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>PRK15449 ferredoxin-like protein FixX; Provisional Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase Back     alignment and domain information
>PLN02805 D-lactate dehydrogenase [cytochrome] Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>PF13459 Fer4_15: 4Fe-4S single cluster domain Back     alignment and domain information
>TIGR00276 iron-sulfur cluster binding protein, putative Back     alignment and domain information
>PF02913 FAD-oxidase_C: FAD linked oxidases, C-terminal domain; InterPro: IPR004113 Some oxygen-dependent oxidoreductases are flavoproteins that contain a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage Back     alignment and domain information
>TIGR00387 glcD glycolate oxidase, subunit GlcD Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK11230 glycolate oxidase subunit GlcD; Provisional Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
2fug_9182 Crystal Structure Of The Hydrophilic Domain Of Resp 1e-27
1fca_A55 Structure Of The Ferredoxin From Clostridium Acidur 1e-06
1fdn_A55 Refined Crystal Structure Of The 2[4fe-4s] Ferredox 2e-06
1clf_A55 Clostridium Pasteurianum Ferredoxin Length = 55 8e-04
>pdb|2FUG|9 Chain 9, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 182 Back     alignment and structure

Iteration: 1

Score = 119 bits (298), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 57/122 (46%), Positives = 73/122 (59%), Gaps = 6/122 (4%) Query: 75 LFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCE 134 + L + + LG+TLKY F K VT+ YP L PRF G H L R+P G E+CI C LC Sbjct: 1 MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCA 60 Query: 135 AVCPAQAITIEAEERED------GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE 188 A CPA AI +E E + G R Y+I+M +CI+CG C+EACP AIV G +FE Sbjct: 61 AACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFE 120 Query: 189 YS 190 + Sbjct: 121 MA 122
>pdb|1FCA|A Chain A, Structure Of The Ferredoxin From Clostridium Acidurici: Model At 1.8 Angstroms Resolution Length = 55 Back     alignment and structure
>pdb|1FDN|A Chain A, Refined Crystal Structure Of The 2[4fe-4s] Ferredoxin From Clostridium Acidurici At 1.84 Angstroms Resolution Length = 55 Back     alignment and structure
>pdb|1CLF|A Chain A, Clostridium Pasteurianum Ferredoxin Length = 55 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 5e-89
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 4e-23
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 2e-18
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 6e-18
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 9e-17
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 1e-16
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 5e-16
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 3e-06
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 2e-15
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 5e-07
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 6e-12
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 2e-05
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 2e-11
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 2e-10
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 4e-10
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 4e-07
1kqf_B 294 FDH-N beta S, formate dehydrogenase, nitrate-induc 8e-05
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 6e-07
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 6e-04
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 8e-07
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 1e-06
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 2e-06
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 1e-06
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 2e-06
1dax_A64 Ferredoxin I; electron transport, electron-transfe 1e-05
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 2e-05
2ivf_B 352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 2e-04
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 2e-05
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 5e-05
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 2e-05
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 2e-05
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 7e-05
1ti6_B 274 Pyrogallol hydroxytransferase small subunit; molyb 2e-04
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 1e-04
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 1e-04
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 1e-04
3or1_B386 Sulfite reductase beta; dissimilatory sulfite redu 5e-04
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 8e-04
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Length = 182 Back     alignment and structure
 Score =  259 bits (663), Expect = 5e-89
 Identities = 64/158 (40%), Positives = 89/158 (56%), Gaps = 6/158 (3%)

Query: 75  LFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCE 134
           + L  + + LG+TLKY F K VT+ YP     L PRF G H L R+P G E+CI C LC 
Sbjct: 1   MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCA 60

Query: 135 AVCPAQAITIEAEERED------GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE 188
           A CPA AI +E  E +       G R    Y+I+M +CI+CG C+EACP  AIV G +FE
Sbjct: 61  AACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFE 120

Query: 189 YSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226
            +   + +L+Y KE +L +    + +  E  R+    +
Sbjct: 121 MADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVK 158


>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Length = 103 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Length = 82 Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Length = 85 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} PDB: 1blu_A 3exy_A Length = 82 Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Length = 80 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Length = 80 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Length = 80 Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Length = 421 Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Length = 421 Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Length = 150 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574 Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 166 Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Length = 105 Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Length = 105 Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Length = 77 Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Length = 195 Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Length = 195 Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Length = 78 Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Length = 106 Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Length = 352 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Length = 352 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Length = 512 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Length = 512 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Length = 214 Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Length = 214 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 Back     alignment and structure
>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* Length = 386 Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Length = 1231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 99.78
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 99.29
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 99.29
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 99.29
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 99.27
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 99.25
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 99.23
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 99.22
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 99.22
1dax_A64 Ferredoxin I; electron transport, electron-transfe 99.21
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 99.2
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 99.2
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 99.15
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 99.15
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 99.15
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.14
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.13
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 99.12
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 99.03
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 98.96
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 98.9
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.85
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 98.8
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.76
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 98.74
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 98.72
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 98.72
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 98.68
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.63
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 98.61
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 98.61
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 98.58
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 98.58
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; 98.57
1kqf_B 294 FDH-N beta S, formate dehydrogenase, nitrate-induc 98.57
1ti6_B 274 Pyrogallol hydroxytransferase small subunit; molyb 98.55
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 98.51
3or1_B386 Sulfite reductase beta; dissimilatory sulfite redu 98.46
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 98.42
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 98.38
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 98.37
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 98.28
3mm5_A418 Sulfite reductase, dissimilatory-type subunit ALP; 98.26
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 98.26
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.12
2pa8_D265 DNA-directed RNA polymerase subunit D; ferredoxin- 97.98
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 97.96
3or1_A437 Sulfite reductase alpha; dissimilatory sulfite red 97.9
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.86
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.79
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 97.19
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.14
1dax_A64 Ferredoxin I; electron transport, electron-transfe 97.11
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 97.07
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 97.05
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 97.02
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 96.96
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 96.85
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 96.8
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 96.67
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 96.66
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 96.56
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 96.53
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 96.48
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 96.46
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 96.39
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 96.34
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 96.21
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 96.11
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.89
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.84
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 95.49
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 95.08
3or1_B386 Sulfite reductase beta; dissimilatory sulfite redu 94.57
3pm9_A476 Putative oxidoreductase; putative D-2-hydroxygluta 94.48
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.2
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 93.92
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; 93.91
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 93.81
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 92.9
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 90.88
3mm5_A418 Sulfite reductase, dissimilatory-type subunit ALP; 90.81
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 90.58
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 89.92
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 89.76
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 89.32
1e8g_A560 Vanillyl-alcohol oxidase; oxidoreductase, flavoenz 88.86
3or1_A437 Sulfite reductase alpha; dissimilatory sulfite red 87.79
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 86.04
2pa8_D265 DNA-directed RNA polymerase subunit D; ferredoxin- 84.21
1wvf_A520 4-cresol dehydrogenase [hydroxylating] flavoprote 84.01
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
Probab=99.78  E-value=8.6e-20  Score=144.88  Aligned_cols=141  Identities=43%  Similarity=0.831  Sum_probs=93.8

Q ss_pred             hhHHHHHHHHHHHHHhcCCcceecCccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhccC---
Q 027264           76 FLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDG---  152 (226)
Q Consensus        76 ~~~~~~~~l~~~~~~~f~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~~~---  152 (226)
                      .+.++++++..+++++|.+..+..||..+....+++++.+.+.....+.++|++||.|+.+||++++.+........   
T Consensus         2 ~l~~~~~~l~~~~~~~~~~~~t~~yp~~~~~~~~~~~g~~~~~~~~~d~~~Ci~C~~C~~~CP~~ai~~~~~~~~~~~~~   81 (182)
T 3i9v_9            2 TLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPV   81 (182)
T ss_dssp             ------------------------CCSSCEECCTTCCCSEEECBCTTSCBSCCCCCHHHHHCTTCCEEEEEECCCSSSCS
T ss_pred             CHHHHHHHHHHHHHHHcCCCcceECCCCCCCCCcccCCeEeeccCCCCCccCcccccchhhCCcccEEeecccccccccc
Confidence            35678899999999999999999999888788888998887776666788999999999999999987654321110   


Q ss_pred             ---CccccccccCCCCCCcchhhhhcCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCchHHHH
Q 027264          153 ---SRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIA  216 (226)
Q Consensus       153 ---~~~~~~~~~d~~~C~~Cg~Cv~~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~  216 (226)
                         ........++.+.|++||.|+.+||++||.++..++.....+..++++...+.....++...+.
T Consensus        82 ~~~~~~~~~~~~~~~~C~~C~~C~~~CP~~Ai~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~p~~~  148 (182)
T 3i9v_9           82 SAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRR  148 (182)
T ss_dssp             SSSSCEEEEEEEETTTCCCCCHHHHHCSSSCEEECSCCCCCBSSGGGGEECHHHHBTTCCSCHHHHH
T ss_pred             cccccccceeecCCCcCcChhChhhhCCccceEecCccccccccHHHHhcCHHHHhhcccCCCCCeE
Confidence               1111234567789999999999999999999999999999999999999888888888776654



>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* Back     alignment and structure
>3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* Back     alignment and structure
>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d2fug91154 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase ch 6e-41
d2fdna_55 d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici 3e-17
d2fdna_55 d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici 3e-04
d1jb0c_80 d.58.1.2 (C:) Photosystem I iron-sulfur protein Ps 5e-17
d1jb0c_80 d.58.1.2 (C:) Photosystem I iron-sulfur protein Ps 6e-06
d1blua_80 d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [T 7e-16
d1xera_103 d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. 5e-15
d1xera_103 d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. 1e-05
d1xera_103 d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. 2e-04
d1dura_55 d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as 1e-14
d1dura_55 d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as 3e-04
d1dura_55 d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as 3e-04
d1rgva_80 d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [Ta 3e-14
d1hfel285 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun 4e-14
d1hfel285 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun 2e-04
d1fxda_58 d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T 6e-14
d1gtea5173 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen 2e-13
d1gtea5173 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen 4e-04
d3c8ya383 d.58.1.5 (A:127-209) Fe-only hydrogenase, second d 6e-12
d3c8ya383 d.58.1.5 (A:127-209) Fe-only hydrogenase, second d 5e-04
d1sj1a_66 d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus 1e-11
d1sj1a_66 d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus 6e-04
d1sj1a_66 d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus 7e-04
d2c42a5117 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu 2e-10
d2c42a5117 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu 0.003
d1vjwa_59 d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T 3e-10
d1vjwa_59 d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T 0.002
d1vjwa_59 d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T 0.003
d1jnrb_149 d.58.1.5 (B:) Adenylylsulfate reductase B subunit 3e-10
d1jnrb_149 d.58.1.5 (B:) Adenylylsulfate reductase B subunit 0.002
d1bc6a_77 d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [Tax 1e-09
d1fxra_64 d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte 4e-09
d1h98a_77 d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [Ta 6e-09
d3c7bb165 d.58.1.5 (B:197-261) DsrB insert domain {Archaeogl 1e-08
d1iqza_81 d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt 1e-08
d7fd1a_106 d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [ 2e-06
d1kqfb1244 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-s 5e-06
d1y5ib1 509 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 8e-06
d1y5ib1 509 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 2e-05
d2fug34151 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase ch 1e-05
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 0.001
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: 4Fe-4S ferredoxins
family: Ferredoxin domains from multidomain proteins
domain: NADH-quinone oxidoreductase chain 9, Nqo9
species: Thermus thermophilus [TaxId: 274]
 Score =  134 bits (339), Expect = 6e-41
 Identities = 52/128 (40%), Positives = 70/128 (54%), Gaps = 8/128 (6%)

Query: 100 YPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIE------AEEREDGS 153
           YP     L PRF G H L R+P G E+CI C LC A CPA AI +E            G 
Sbjct: 1   YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGE 60

Query: 154 RRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLEN--GDRW 211
           R    Y+I+M +CI+CG C+EACP  AIV G +FE +   + +L+Y KE +L +  G + 
Sbjct: 61  RYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKP 120

Query: 212 ETEIAENL 219
           +   A+  
Sbjct: 121 QRREAKRT 128


>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Length = 55 Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Length = 55 Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Length = 80 Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Length = 80 Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Length = 80 Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Length = 80 Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 149 Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 149 Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Length = 77 Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Length = 77 Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 65 Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Length = 106 Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Length = 244 Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Length = 509 Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Length = 509 Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Length = 151 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 99.81
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 99.48
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 99.48
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 99.47
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 99.47
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 99.46
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 99.45
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 99.45
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 99.43
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 99.39
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 99.38
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 99.35
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 99.33
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 99.27
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 99.17
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 99.16
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 99.16
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 99.09
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 99.08
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 99.08
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 99.04
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 98.77
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 98.65
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 98.59
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 98.55
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.54
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 98.5
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 98.49
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.37
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 98.33
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 98.33
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 98.17
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 97.54
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 97.53
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 97.42
d2v4jb169 DsrB insert domain {Desulfovibrio vulgaris [TaxId: 97.4
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 97.37
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 97.37
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 97.36
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 97.26
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 97.2
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 97.19
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 97.13
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 97.09
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 97.07
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 97.03
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 97.03
d2gmha3102 Electron transfer flavoprotein-ubiquinone oxidored 96.98
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 96.7
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 96.56
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 96.55
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 96.45
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 96.33
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 96.04
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 95.97
d3c7ba166 DsrA insert domain {Archaeoglobus fulgidus [TaxId: 95.76
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 95.72
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 95.24
d2v4ja181 DsrA insert domain {Desulfovibrio vulgaris [TaxId: 95.02
d1e8ga1287 Vanillyl-alcohol oxidase {Fungus (Penicillium simp 93.68
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 91.67
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 91.33
d2gmha3102 Electron transfer flavoprotein-ubiquinone oxidored 90.94
d1wvfa1279 Flavoprotein subunit of p-cresol methylhydroxylase 90.04
d2v4jb169 DsrB insert domain {Desulfovibrio vulgaris [TaxId: 89.7
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 89.19
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 81.1
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: 4Fe-4S ferredoxins
family: Ferredoxin domains from multidomain proteins
domain: NADH-quinone oxidoreductase chain 9, Nqo9
species: Thermus thermophilus [TaxId: 274]
Probab=99.81  E-value=3.5e-21  Score=147.86  Aligned_cols=113  Identities=45%  Similarity=0.892  Sum_probs=91.3

Q ss_pred             CccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhc------cCCccccccccCCCCCCcchhhh
Q 027264          100 YPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEERE------DGSRRTTRYDIDMTKCIYCGFCQ  173 (226)
Q Consensus       100 ~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~------~~~~~~~~~~~d~~~C~~Cg~Cv  173 (226)
                      ||+.+..++++|+|.+.+...+.+.++||+|+.|+.+||+.++........      .+.+....+.++...|++||.|+
T Consensus         1 YP~e~~~~~~r~RG~~~l~~~~~~~ekCI~C~~C~~~CP~~~i~~~~~~~~~~~~~~~~~~~~~~~~id~~~C~~CG~Cv   80 (154)
T d2fug91           1 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCE   80 (154)
T ss_dssp             CCSSCEECCTTCCCSEEECBCTTSCBSCCCCTHHHHHCSSCCEEEEEEECCSSSCSBSSSEEEEEEEEETTTCCCCTHHH
T ss_pred             CCCCCCCCCCCcCCceecccCCCCcccCcCCCcHHhhcCCcceeccccccccccccccccccceeEEeccccCCCCCCch
Confidence            788888888999999988777777889999999999999998876443211      11223344678889999999999


Q ss_pred             hcCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCch
Q 027264          174 EACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWE  212 (226)
Q Consensus       174 ~~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~  212 (226)
                      .+||++||.++++|++++.++.+++++...++....++.
T Consensus        81 e~CPt~AI~~~~~~e~~~~~r~~l~~~k~~ll~~~~~~~  119 (154)
T d2fug91          81 EACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTK  119 (154)
T ss_dssp             HHCSSSCEEECSCCCCCBSCGGGSEECSTTTBTTCCSCH
T ss_pred             hhCCCCeEeccCccccccCCHHHhccCHHHhhhcccCCc
Confidence            999999999999999999999999998887765544433



>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1e8ga1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wvfa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure