Citrus Sinensis ID: 027264
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| TAIR|locus:2015636 | 222 | AT1G16700 [Arabidopsis thalian | 0.982 | 1.0 | 0.778 | 1.7e-89 | |
| TAIR|locus:2207285 | 222 | AT1G79010 [Arabidopsis thalian | 0.982 | 1.0 | 0.774 | 1.6e-88 | |
| RGD|1309436 | 212 | Ndufs8 "NADH dehydrogenase (ub | 0.725 | 0.773 | 0.719 | 2.3e-66 | |
| ZFIN|ZDB-GENE-040426-2153 | 210 | ndufs8a "NADH dehydrogenase (u | 0.725 | 0.780 | 0.719 | 9.4e-66 | |
| UNIPROTKB|E2R5X8 | 210 | NDUFS8 "Uncharacterized protei | 0.734 | 0.790 | 0.734 | 1.5e-65 | |
| UNIPROTKB|P42028 | 212 | NDUFS8 "NADH dehydrogenase [ub | 0.734 | 0.783 | 0.734 | 2e-65 | |
| UNIPROTKB|P0CB97 | 210 | NDUFS8 "NADH dehydrogenase [ub | 0.725 | 0.780 | 0.737 | 3.2e-65 | |
| UNIPROTKB|Q60HE3 | 210 | NDUFS8 "NADH dehydrogenase [ub | 0.725 | 0.780 | 0.737 | 1.1e-64 | |
| ZFIN|ZDB-GENE-050522-131 | 210 | ndufs8b "NADH dehydrogenase (u | 0.738 | 0.795 | 0.724 | 1.1e-64 | |
| UNIPROTKB|O00217 | 210 | NDUFS8 "NADH dehydrogenase [ub | 0.725 | 0.780 | 0.731 | 1.4e-64 |
| TAIR|locus:2015636 AT1G16700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 893 (319.4 bits), Expect = 1.7e-89, P = 1.7e-89
Identities = 176/226 (77%), Positives = 183/226 (80%)
Query: 1 MASILARKSLSALRARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSXXXXXXXXXXXXXI 60
MAS+LAR+S SALRARHLA SGQ LQGS GL+ A Y S I
Sbjct: 1 MASLLARRSFSALRARHLAFSGQGLQGSHLCGLQSRAISYGS----NKDDEEAEQLAKEI 56
Query: 61 SKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRY 120
SKDWS+VFERS+N LFLTEMVRGL LTLKYFFD KVTINYPFEKGPLSPRFRGEHALRRY
Sbjct: 57 SKDWSTVFERSMNTLFLTEMVRGLSLTLKYFFDPKVTINYPFEKGPLSPRFRGEHALRRY 116
Query: 121 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 180
PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA
Sbjct: 117 PTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDA 176
Query: 181 IVEGPNFEYSTETHXXXXXXXXXXXXNGDRWETEIAENLRSESLYR 226
IVEGPNFE++TETH NGDRWETEIAENLRSESLYR
Sbjct: 177 IVEGPNFEFATETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 222
|
|
| TAIR|locus:2207285 AT1G79010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1309436 Ndufs8 "NADH dehydrogenase (ubiquinone) Fe-S protein 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2153 ndufs8a "NADH dehydrogenase (ubiquinone) Fe-S protein 8a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5X8 NDUFS8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42028 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0CB97 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60HE3 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-131 ndufs8b "NADH dehydrogenase (ubiquinone) Fe-S protein 8b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00217 NDUFS8 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT1G16700 | NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative; NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial, putative; FUNCTIONS IN- NADH dehydrogenase (ubiquinone) activity, metal ion binding; LOCATED IN- mitochondrion, respiratory chain complex I; CONTAINS InterPro DOMAIN/s- 4Fe-4S ferredoxin, iron-sulphur binding, subgroup (InterPro-IPR001450), NADH-quinone oxidoreductase, chain I (InterPro-IPR010226), 4Fe-4S ferredoxin, iron-sulphur binding, conserved site (InterPro-IPR017900), 4Fe-4S ferredoxin, iron-sulpur binding domain (InterPro-IPR017896), Alpha-helica [...] (222 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| CI51 | • | • | • | • | • | • | 0.999 | ||||
| EMB1467 | • | • | • | • | • | • | 0.998 | ||||
| AT4G02580 | • | • | • | • | • | • | 0.998 | ||||
| AT5G11770 | • | • | • | • | • | • | 0.997 | ||||
| NAD9 | • | • | • | • | • | • | 0.985 | ||||
| NAD7 | • | • | • | • | • | • | 0.975 | ||||
| NDHE | • | • | • | • | 0.971 | ||||||
| AT2G20360 | • | • | • | 0.963 | |||||||
| AT5G47890 | • | • | • | • | 0.963 | ||||||
| AT5G67590.1-P | • | • | • | • | 0.961 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| PRK05888 | 164 | PRK05888, PRK05888, NADH dehydrogenase subunit I; | 6e-95 | |
| COG1143 | 172 | COG1143, NuoI, Formate hydrogenlyase subunit 6/NAD | 9e-66 | |
| TIGR01971 | 122 | TIGR01971, NuoI, NADH-quinone oxidoreductase, chai | 8e-65 | |
| PRK08222 | 181 | PRK08222, PRK08222, hydrogenase 4 subunit H; Valid | 3e-17 | |
| PRK12387 | 180 | PRK12387, PRK12387, formate hydrogenlyase complex | 4e-17 | |
| TIGR00403 | 183 | TIGR00403, ndhI, NADH-plastoquinone oxidoreductase | 4e-17 | |
| CHL00014 | 167 | CHL00014, ndhI, NADH dehydrogenase subunit I | 7e-16 | |
| pfam12838 | 48 | pfam12838, Fer4_7, 4Fe-4S dicluster domain | 1e-12 | |
| PRK13984 | 604 | PRK13984, PRK13984, putative oxidoreductase; Provi | 6e-12 | |
| PRK07118 | 280 | PRK07118, PRK07118, ferredoxin; Validated | 4e-11 | |
| COG1145 | 99 | COG1145, NapF, Ferredoxin [Energy production and c | 7e-11 | |
| TIGR02512 | 374 | TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, grou | 1e-10 | |
| PRK08348 | 120 | PRK08348, PRK08348, NADH-plastoquinone oxidoreduct | 3e-10 | |
| pfam13187 | 44 | pfam13187, Fer4_9, 4Fe-4S dicluster domain | 1e-09 | |
| pfam13484 | 67 | pfam13484, Fer4_16, 4Fe-4S double cluster binding | 2e-09 | |
| TIGR02179 | 78 | TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoredu | 2e-09 | |
| pfam13237 | 51 | pfam13237, Fer4_10, 4Fe-4S dicluster domain | 4e-09 | |
| COG3383 | 978 | COG3383, COG3383, Uncharacterized anaerobic dehydr | 6e-09 | |
| TIGR02700 | 234 | TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ02 | 6e-09 | |
| COG1146 | 68 | COG1146, COG1146, Ferredoxin [Energy production an | 8e-09 | |
| PRK06273 | 165 | PRK06273, PRK06273, ferredoxin; Provisional | 2e-08 | |
| COG1144 | 91 | COG1144, COG1144, Pyruvate:ferredoxin oxidoreducta | 2e-08 | |
| COG1149 | 284 | COG1149, COG1149, MinD superfamily P-loop ATPase c | 3e-08 | |
| TIGR04105 | 462 | TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro | 3e-08 | |
| COG2221 | 317 | COG2221, DsrA, Dissimilatory sulfite reductase (de | 7e-08 | |
| TIGR04105 | 462 | TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro | 8e-08 | |
| TIGR02494 | 295 | TIGR02494, PFLE_PFLC, glycyl-radical enzyme activa | 2e-07 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 2e-07 | |
| PRK13795 | 636 | PRK13795, PRK13795, hypothetical protein; Provisio | 3e-07 | |
| PRK14028 | 312 | PRK14028, PRK14028, pyruvate ferredoxin oxidoreduc | 4e-07 | |
| COG2768 | 354 | COG2768, COG2768, Uncharacterized Fe-S center prot | 4e-07 | |
| pfam00037 | 24 | pfam00037, Fer4, 4Fe-4S binding domain | 1e-06 | |
| COG0437 | 203 | COG0437, HybA, Fe-S-cluster-containing hydrogenase | 1e-06 | |
| COG1142 | 165 | COG1142, HycB, Fe-S-cluster-containing hydrogenase | 2e-06 | |
| COG1142 | 165 | COG1142, HycB, Fe-S-cluster-containing hydrogenase | 2e-06 | |
| pfam13183 | 54 | pfam13183, Fer4_8, 4Fe-4S dicluster domain | 5e-06 | |
| PRK09623 | 105 | PRK09623, vorD, 2-ketoisovalerate ferredoxin oxido | 8e-06 | |
| PRK09898 | 208 | PRK09898, PRK09898, hypothetical protein; Provisio | 1e-05 | |
| TIGR01944 | 165 | TIGR01944, rnfB, electron transport complex, RnfAB | 1e-05 | |
| COG0437 | 203 | COG0437, HybA, Fe-S-cluster-containing hydrogenase | 2e-05 | |
| TIGR03336 | 595 | TIGR03336, IOR_alpha, indolepyruvate ferredoxin ox | 2e-05 | |
| PRK08318 | 420 | PRK08318, PRK08318, dihydropyrimidine dehydrogenas | 2e-05 | |
| PRK07118 | 280 | PRK07118, PRK07118, ferredoxin; Validated | 5e-05 | |
| COG4231 | 640 | COG4231, COG4231, Indolepyruvate ferredoxin oxidor | 8e-05 | |
| pfam00037 | 24 | pfam00037, Fer4, 4Fe-4S binding domain | 1e-04 | |
| COG1142 | 165 | COG1142, HycB, Fe-S-cluster-containing hydrogenase | 1e-04 | |
| TIGR04003 | 314 | TIGR04003, rSAM_BssD, [benzylsuccinate synthase]-a | 1e-04 | |
| TIGR03224 | 411 | TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reduc | 1e-04 | |
| TIGR01944 | 165 | TIGR01944, rnfB, electron transport complex, RnfAB | 2e-04 | |
| COG1148 | 622 | COG1148, HdrA, Heterodisulfide reductase, subunit | 2e-04 | |
| COG1148 | 622 | COG1148, HdrA, Heterodisulfide reductase, subunit | 2e-04 | |
| PRK14993 | 244 | PRK14993, PRK14993, tetrathionate reductase subuni | 2e-04 | |
| PRK12769 | 654 | PRK12769, PRK12769, putative oxidoreductase Fe-S b | 2e-04 | |
| pfam13534 | 61 | pfam13534, Fer4_17, 4Fe-4S dicluster domain | 2e-04 | |
| pfam12837 | 24 | pfam12837, Fer4_6, 4Fe-4S binding domain | 2e-04 | |
| TIGR03294 | 228 | TIGR03294, FrhG, coenzyme F420 hydrogenase, subuni | 3e-04 | |
| TIGR04041 | 276 | TIGR04041, activase_YjjW, glycine radical enzyme a | 4e-04 | |
| COG1600 | 337 | COG1600, COG1600, Uncharacterized Fe-S protein [En | 4e-04 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 4e-04 | |
| COG1146 | 68 | COG1146, COG1146, Ferredoxin [Energy production an | 5e-04 | |
| COG1149 | 284 | COG1149, COG1149, MinD superfamily P-loop ATPase c | 5e-04 | |
| TIGR03287 | 391 | TIGR03287, methan_mark_16, putative methanogenesis | 5e-04 | |
| PRK09898 | 208 | PRK09898, PRK09898, hypothetical protein; Provisio | 6e-04 | |
| pfam13459 | 60 | pfam13459, Fer4_15, 4Fe-4S single cluster domain | 6e-04 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 6e-04 | |
| TIGR02163 | 255 | TIGR02163, napH_, ferredoxin-type protein, NapH/Ma | 6e-04 | |
| TIGR04270 | 535 | TIGR04270, Rama_corrin_act, methylamine methyltran | 7e-04 | |
| pfam12837 | 24 | pfam12837, Fer4_6, 4Fe-4S binding domain | 8e-04 | |
| PRK09624 | 105 | PRK09624, porD, pyuvate ferredoxin oxidoreductase | 8e-04 | |
| PRK05113 | 191 | PRK05113, PRK05113, electron transport complex pro | 0.001 | |
| TIGR02486 | 314 | TIGR02486, RDH, reductive dehalogenase | 0.001 | |
| PRK09326 | 341 | PRK09326, PRK09326, F420H2 dehydrogenase subunit F | 0.001 | |
| pfam13484 | 67 | pfam13484, Fer4_16, 4Fe-4S double cluster binding | 0.002 | |
| COG2878 | 198 | COG2878, COG2878, Predicted NADH:ubiquinone oxidor | 0.002 | |
| COG2878 | 198 | COG2878, COG2878, Predicted NADH:ubiquinone oxidor | 0.002 | |
| PRK10330 | 181 | PRK10330, PRK10330, formate dehydrogenase-H ferred | 0.002 | |
| PRK06259 | 486 | PRK06259, PRK06259, succinate dehydrogenase/fumara | 0.002 | |
| PRK00941 | 781 | PRK00941, PRK00941, acetyl-CoA decarbonylase/synth | 0.002 | |
| COG1150 | 195 | COG1150, HdrC, Heterodisulfide reductase, subunit | 0.002 | |
| PRK07118 | 280 | PRK07118, PRK07118, ferredoxin; Validated | 0.003 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 0.003 | |
| TIGR00397 | 213 | TIGR00397, mauM_napG, MauM/NapG family ferredoxin- | 0.003 | |
| TIGR02745 | 434 | TIGR02745, ccoG_rdxA_fixG, cytochrome c oxidase ac | 0.003 | |
| TIGR02176 | 1165 | TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flav | 0.003 | |
| TIGR02060 | 132 | TIGR02060, aprB, adenosine phosphosulphate reducta | 0.003 | |
| PRK00783 | 263 | PRK00783, PRK00783, DNA-directed RNA polymerase su | 0.003 | |
| COG1034 | 693 | COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone | 0.004 | |
| TIGR02936 | 91 | TIGR02936, fdxN_nitrog, ferredoxin III, nif-specif | 0.004 | |
| PRK08764 | 135 | PRK08764, PRK08764, ferredoxin; Provisional | 0.004 |
| >gnl|CDD|235637 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
Score = 274 bits (702), Expect = 6e-95
Identities = 109/159 (68%), Positives = 128/159 (80%)
Query: 68 FERSINMLFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERC 127
++ + + L E+++GLG+TLKYFF KKVTI YP EK PLSPRFRG HALRR P GEERC
Sbjct: 1 IKQYLKSMLLKELLKGLGVTLKYFFKKKVTIQYPEEKLPLSPRFRGRHALRRDPNGEERC 60
Query: 128 IACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNF 187
IACKLC A+CPA AITIEA EREDG RRTTRYDI+ +CI+CGFC+EACP DAIVE P+F
Sbjct: 61 IACKLCAAICPADAITIEAAEREDGRRRTTRYDINFGRCIFCGFCEEACPTDAIVETPDF 120
Query: 188 EYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226
E +TET EEL+YDKEKLL NGDR E EIA +++ YR
Sbjct: 121 ELATETREELIYDKEKLLANGDRVEREIAPGKAADANYR 159
|
Length = 164 |
| >gnl|CDD|224066 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233661 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >gnl|CDD|181301 PRK08222, PRK08222, hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183492 PRK12387, PRK12387, formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129498 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >gnl|CDD|214334 CHL00014, ndhI, NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >gnl|CDD|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224068 COG1145, NapF, Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233903 TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, group A | Back alignment and domain information |
|---|
| >gnl|CDD|181399 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221966 pfam13187, Fer4_9, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >gnl|CDD|205417 pfam13237, Fer4_10, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >gnl|CDD|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235764 PRK06273, PRK06273, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224067 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3 | Back alignment and domain information |
|---|
| >gnl|CDD|225131 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3 | Back alignment and domain information |
|---|
| >gnl|CDD|233895 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172522 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225358 COG2768, COG2768, Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215671 pfam00037, Fer4, 4Fe-4S binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|170016 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234170 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226684 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215671 pfam00037, Fer4, 4Fe-4S binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|188518 TIGR04003, rSAM_BssD, [benzylsuccinate synthase]-activating enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|184955 PRK14993, PRK14993, tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|205098 pfam12837, Fer4_6, 4Fe-4S binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132337 TIGR03294, FrhG, coenzyme F420 hydrogenase, subunit gamma | Back alignment and domain information |
|---|
| >gnl|CDD|188556 TIGR04041, activase_YjjW, glycine radical enzyme activase, YjjW family | Back alignment and domain information |
|---|
| >gnl|CDD|224516 COG1600, COG1600, Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234157 TIGR03287, methan_mark_16, putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233754 TIGR02163, napH_, ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >gnl|CDD|211993 TIGR04270, Rama_corrin_act, methylamine methyltransferase corrinoid protein reductive activase | Back alignment and domain information |
|---|
| >gnl|CDD|205098 pfam12837, Fer4_6, 4Fe-4S binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|170017 PRK09624, porD, pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233890 TIGR02486, RDH, reductive dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|181779 PRK09326, PRK09326, F420H2 dehydrogenase subunit F; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|182382 PRK10330, PRK10330, formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179174 PRK00941, PRK00941, acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224072 COG1150, HdrC, Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235941 PRK07118, PRK07118, ferredoxin; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129492 TIGR00397, mauM_napG, MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >gnl|CDD|233993 TIGR02745, ccoG_rdxA_fixG, cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >gnl|CDD|131231 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >gnl|CDD|131115 TIGR02060, aprB, adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234837 PRK00783, PRK00783, DNA-directed RNA polymerase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234064 TIGR02936, fdxN_nitrog, ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >gnl|CDD|181550 PRK08764, PRK08764, ferredoxin; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 100.0 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 99.93 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 99.79 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 99.78 | |
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 99.7 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 99.66 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 99.54 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 99.47 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 99.44 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 99.37 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 99.31 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 99.31 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 99.27 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 99.25 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 99.19 | |
| COG1144 | 91 | Pyruvate:ferredoxin oxidoreductase and related 2-o | 99.18 | |
| PRK09624 | 105 | porD pyuvate ferredoxin oxidoreductase subunit del | 99.15 | |
| PRK06273 | 165 | ferredoxin; Provisional | 99.15 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 99.14 | |
| TIGR02179 | 78 | PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta | 99.14 | |
| PRK06991 | 270 | ferredoxin; Provisional | 99.09 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 99.06 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 99.05 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 99.04 | |
| PRK09623 | 105 | vorD 2-ketoisovalerate ferredoxin oxidoreductase s | 99.04 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 99.03 | |
| PRK09625 | 133 | porD pyruvate flavodoxin oxidoreductase subunit de | 99.0 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 99.0 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 99.0 | |
| TIGR02060 | 132 | aprB adenosine phosphosulphate reductase, beta sub | 98.99 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 98.97 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 98.96 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 98.96 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 98.96 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 98.96 | |
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 98.94 | |
| TIGR02494 | 295 | PFLE_PFLC glycyl-radical enzyme activating protein | 98.91 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 98.9 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 98.88 | |
| TIGR02700 | 234 | flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T | 98.87 | |
| PRK14028 | 312 | pyruvate ferredoxin oxidoreductase subunit gamma/d | 98.85 | |
| TIGR00402 | 101 | napF ferredoxin-type protein NapF. The gene codes | 98.85 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 98.84 | |
| PRK08764 | 135 | ferredoxin; Provisional | 98.82 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 98.8 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 98.77 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 98.74 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 98.72 | |
| TIGR02512 | 374 | Fe_only_hydrog hydrogenases, Fe-only. This model d | 98.72 | |
| TIGR02912 | 314 | sulfite_red_C sulfite reductase, subunit C. Member | 98.72 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 98.71 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 98.7 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 98.7 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 98.69 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 98.69 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 98.68 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 98.68 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 98.68 | |
| PRK00783 | 263 | DNA-directed RNA polymerase subunit D; Provisional | 98.67 | |
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 98.66 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 98.65 | |
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 98.64 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 98.61 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 98.61 | |
| PRK07118 | 280 | ferredoxin; Validated | 98.61 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 98.61 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 98.6 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 98.6 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 98.59 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 98.57 | |
| COG2221 | 317 | DsrA Dissimilatory sulfite reductase (desulfovirid | 98.57 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 98.57 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 98.56 | |
| cd07030 | 259 | RNAP_D D subunit of Archaeal RNA polymerase. The D | 98.55 | |
| TIGR03287 | 391 | methan_mark_16 putative methanogenesis marker 16 m | 98.53 | |
| COG2878 | 198 | Predicted NADH:ubiquinone oxidoreductase, subunit | 98.52 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 98.52 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 98.51 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 98.51 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 98.49 | |
| PRK07118 | 280 | ferredoxin; Validated | 98.49 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 98.49 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 98.48 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 98.46 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 98.44 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 98.44 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 98.44 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 98.43 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 98.42 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 98.42 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 98.41 | |
| TIGR03294 | 228 | FrhG coenzyme F420 hydrogenase, subunit gamma. Thi | 98.4 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 98.39 | |
| PLN00129 | 276 | succinate dehydrogenase [ubiquinone] iron-sulfur s | 98.39 | |
| PRK12575 | 235 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.39 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 98.38 | |
| PRK09326 | 341 | F420H2 dehydrogenase subunit F; Provisional | 98.37 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.36 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 98.36 | |
| PRK13795 | 636 | hypothetical protein; Provisional | 98.35 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 98.33 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 98.33 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 98.33 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 98.32 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 98.32 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 98.31 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 98.31 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 98.31 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 98.31 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 98.3 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 98.3 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 98.3 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 98.29 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 98.29 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 98.29 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 98.29 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 98.28 | |
| PRK15449 | 95 | ferredoxin-like protein FixX; Provisional | 98.28 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 98.26 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 98.26 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 98.25 | |
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 98.24 | |
| TIGR03290 | 144 | CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s | 98.24 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 98.22 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 98.19 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 98.16 | |
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 98.15 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 98.1 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 98.1 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 98.07 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 98.06 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 98.06 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 98.02 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.01 | |
| TIGR00314 | 784 | cdhA CO dehydrogenase/acetyl-CoA synthase complex, | 97.97 | |
| PRK00941 | 781 | acetyl-CoA decarbonylase/synthase complex subunit | 97.93 | |
| TIGR00276 | 282 | iron-sulfur cluster binding protein, putative. Thi | 97.93 | |
| cd01916 | 731 | ACS_1 Acetyl-CoA synthase (ACS), also known as ace | 97.9 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.89 | |
| TIGR02486 | 314 | RDH reductive dehalogenase. This model represents | 97.86 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 97.86 | |
| PRK11168 | 396 | glpC sn-glycerol-3-phosphate dehydrogenase subunit | 97.86 | |
| TIGR00273 | 432 | iron-sulfur cluster-binding protein. Members of th | 97.77 | |
| PRK09193 | 1165 | indolepyruvate ferredoxin oxidoreductase; Validate | 97.71 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 97.71 | |
| TIGR03379 | 397 | glycerol3P_GlpC glycerol-3-phosphate dehydrogenase | 97.68 | |
| PRK11274 | 407 | glcF glycolate oxidase iron-sulfur subunit; Provis | 97.68 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 97.66 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 97.64 | |
| TIGR02910 | 334 | sulfite_red_A sulfite reductase, subunit A. Member | 97.63 | |
| PRK13030 | 1159 | 2-oxoacid ferredoxin oxidoreductase; Provisional | 97.62 | |
| COG1150 | 195 | HdrC Heterodisulfide reductase, subunit C [Energy | 97.59 | |
| COG0247 | 388 | GlpC Fe-S oxidoreductase [Energy production and co | 97.58 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 97.57 | |
| COG1139 | 459 | Uncharacterized conserved protein containing a fer | 97.56 | |
| COG2440 | 99 | FixX Ferredoxin-like protein [Energy production an | 97.55 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 97.51 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 97.5 | |
| PRK15055 | 344 | anaerobic sulfite reductase subunit A; Provisional | 97.46 | |
| PRK13029 | 1186 | 2-oxoacid ferredoxin oxidoreductase; Provisional | 97.4 | |
| COG1600 | 337 | Uncharacterized Fe-S protein [Energy production an | 97.35 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 97.33 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 97.3 | |
| TIGR02064 | 402 | dsrA sulfite reductase, dissimilatory-type alpha s | 97.3 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 97.27 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 97.24 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.23 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 97.14 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 97.07 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 97.05 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 97.03 | |
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 97.01 | |
| TIGR02484 | 372 | CitB CitB domain protein. CobZ is essential for co | 96.98 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 96.96 | |
| COG1141 | 68 | Fer Ferredoxin [Energy production and conversion] | 96.82 | |
| KOG3256 | 212 | consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 | 96.82 | |
| PF13370 | 58 | Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A | 96.79 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 96.77 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 96.66 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 96.65 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 96.63 | |
| PRK15033 | 389 | tricarballylate utilization protein B; Provisional | 96.62 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 96.57 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 96.41 | |
| COG1144 | 91 | Pyruvate:ferredoxin oxidoreductase and related 2-o | 96.35 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 96.33 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 96.33 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 96.23 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 96.22 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 96.14 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 96.09 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 96.05 | |
| PRK09623 | 105 | vorD 2-ketoisovalerate ferredoxin oxidoreductase s | 96.0 | |
| PRK06273 | 165 | ferredoxin; Provisional | 95.99 | |
| TIGR02179 | 78 | PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta | 95.92 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 95.91 | |
| COG1035 | 332 | FrhB Coenzyme F420-reducing hydrogenase, beta subu | 95.88 | |
| COG2221 | 317 | DsrA Dissimilatory sulfite reductase (desulfovirid | 95.86 | |
| TIGR02494 | 295 | PFLE_PFLC glycyl-radical enzyme activating protein | 95.78 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 95.75 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 95.72 | |
| COG0348 | 386 | NapH Polyferredoxin [Energy production and convers | 95.65 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 95.62 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 95.58 | |
| COG1140 | 513 | NarY Nitrate reductase beta subunit [Energy produc | 95.34 | |
| COG1941 | 247 | FrhG Coenzyme F420-reducing hydrogenase, gamma sub | 95.27 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 95.25 | |
| PRK06991 | 270 | ferredoxin; Provisional | 95.23 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 95.21 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 95.17 | |
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 94.98 | |
| PRK09625 | 133 | porD pyruvate flavodoxin oxidoreductase subunit de | 94.97 | |
| TIGR02060 | 132 | aprB adenosine phosphosulphate reductase, beta sub | 94.93 | |
| PRK09624 | 105 | porD pyuvate ferredoxin oxidoreductase subunit del | 94.9 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 94.83 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 94.82 | |
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 94.67 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 94.65 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 94.63 | |
| PRK09326 | 341 | F420H2 dehydrogenase subunit F; Provisional | 94.39 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 94.34 | |
| PRK08764 | 135 | ferredoxin; Provisional | 94.11 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 94.09 | |
| TIGR02512 | 374 | Fe_only_hydrog hydrogenases, Fe-only. This model d | 94.09 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 93.84 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 93.68 | |
| TIGR02700 | 234 | flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T | 93.64 | |
| TIGR00402 | 101 | napF ferredoxin-type protein NapF. The gene codes | 93.63 | |
| PRK15449 | 95 | ferredoxin-like protein FixX; Provisional | 93.45 | |
| TIGR03294 | 228 | FrhG coenzyme F420 hydrogenase, subunit gamma. Thi | 93.39 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 93.33 | |
| COG1141 | 68 | Fer Ferredoxin [Energy production and conversion] | 93.31 | |
| TIGR02486 | 314 | RDH reductive dehalogenase. This model represents | 93.25 | |
| PLN02805 | 555 | D-lactate dehydrogenase [cytochrome] | 93.05 | |
| COG2878 | 198 | Predicted NADH:ubiquinone oxidoreductase, subunit | 92.99 | |
| TIGR02912 | 314 | sulfite_red_C sulfite reductase, subunit C. Member | 92.99 | |
| PRK14028 | 312 | pyruvate ferredoxin oxidoreductase subunit gamma/d | 92.91 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 92.73 | |
| TIGR00276 | 282 | iron-sulfur cluster binding protein, putative. Thi | 92.7 | |
| PF02913 | 248 | FAD-oxidase_C: FAD linked oxidases, C-terminal dom | 92.6 | |
| TIGR00387 | 413 | glcD glycolate oxidase, subunit GlcD. This protein | 92.47 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 92.44 | |
| PF13370 | 58 | Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A | 92.19 | |
| COG1140 | 513 | NarY Nitrate reductase beta subunit [Energy produc | 92.12 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 92.01 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 91.91 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 91.74 | |
| TIGR03287 | 391 | methan_mark_16 putative methanogenesis marker 16 m | 91.42 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 91.34 | |
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 91.19 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 91.17 | |
| cd07032 | 291 | RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA poly | 90.96 | |
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 90.85 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 90.68 | |
| PF13534 | 61 | Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 | 90.62 | |
| PRK13795 | 636 | hypothetical protein; Provisional | 90.47 | |
| PRK00783 | 263 | DNA-directed RNA polymerase subunit D; Provisional | 90.27 | |
| COG1600 | 337 | Uncharacterized Fe-S protein [Energy production an | 89.59 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 89.41 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 88.49 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 88.26 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 87.97 | |
| cd07030 | 259 | RNAP_D D subunit of Archaeal RNA polymerase. The D | 87.65 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 86.85 | |
| COG1035 | 332 | FrhB Coenzyme F420-reducing hydrogenase, beta subu | 86.46 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 86.45 | |
| TIGR03290 | 144 | CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s | 86.45 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 85.99 | |
| PRK11230 | 499 | glycolate oxidase subunit GlcD; Provisional | 85.68 | |
| TIGR02910 | 334 | sulfite_red_A sulfite reductase, subunit A. Member | 85.14 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 85.11 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 84.66 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 83.14 | |
| PRK15055 | 344 | anaerobic sulfite reductase subunit A; Provisional | 82.69 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 82.27 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 82.2 | |
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 81.96 | |
| PRK08640 | 249 | sdhB succinate dehydrogenase iron-sulfur subunit; | 81.9 | |
| TIGR02064 | 402 | dsrA sulfite reductase, dissimilatory-type alpha s | 81.33 | |
| KOG3049 | 288 | consensus Succinate dehydrogenase, Fe-S protein su | 80.93 | |
| TIGR00273 | 432 | iron-sulfur cluster-binding protein. Members of th | 80.56 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 80.2 |
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-38 Score=239.47 Aligned_cols=205 Identities=74% Similarity=1.197 Sum_probs=177.5
Q ss_pred HhhhhHhhhhccCCcccCcccccCCCCCCCCCchhHHHHHHHHHHHhhhHHHHHHHHHHHhhhHHHHHHHHHHHHHhcCC
Q 027264 15 ARHLAVSGQALQGSQHYGLRFNAHPYSSYFPSKKDDEEKEQLLKEISKDWSSVFERSINMLFLTEMVRGLGLTLKYFFDK 94 (226)
Q Consensus 15 ~~~~~i~Gha~~gn~~~~~~~~~H~~~~~~~~~~p~~~~~~~~~~~~~~v~~~~~~~i~~~~~~~~~~~l~~~~~~~f~~ 94 (226)
..+.+++|.++.|. +|.+. +|+ .....+.+.++. -++++...+...++.......+.+++++++++++++|+.
T Consensus 8 ~~~~~~~gq~~~g~--~~~r~-~~~---~~~~~~~~y~~v-~~~e~~~~~~~~~n~~~~tl~~te~~rGf~itLsh~f~~ 80 (212)
T KOG3256|consen 8 ALTLALSGQRLQGS--HGVRL-LSS---NYGSVKDDYKYV-NMKEMSPDITGVMNRGQQTLFATELIRGFMITLSHTFRE 80 (212)
T ss_pred HHHHHhccCcccCC--ccccc-chh---hhccccccceee-chhccchHHHHHHHHHHHHHHHHHHHHHHHhhHHhhcCC
Confidence 33788899998888 22222 122 122223333332 236666666677777777888999999999999999999
Q ss_pred cceecCccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhccCCccccccccCCCCCCcchhhhh
Q 027264 95 KVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQE 174 (226)
Q Consensus 95 ~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~~~~~~~~~~~~d~~~C~~Cg~Cv~ 174 (226)
++++|||+++++++++|+|.|.+.+++...++||.|..|+.+||..+|+++...+..+++....+.+|...|+.||.|+.
T Consensus 81 p~TInYPfEKgplS~RFRGehalrRyp~geerCIACklCeavCPaqaitieae~r~dgsrRttrYdIDmtkCIyCG~CqE 160 (212)
T KOG3256|consen 81 PVTINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEERTDGSRRTTRYDIDMTKCIYCGFCQE 160 (212)
T ss_pred CeeecCccccCCCCcccccchhhhcCCCcchhhhhHHHHHHhCCcccceeeceecCCccccceeecccceeeeeecchhh
Confidence 99999999999999999999999999999999999999999999999999998888888888899999999999999999
Q ss_pred cCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCchHHHHHHhhhhcccC
Q 027264 175 ACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226 (226)
Q Consensus 175 ~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~ 226 (226)
+||++||..++.|+++++++++++|+++.+...|+.|+..++.|+|.|-|||
T Consensus 161 aCPvdaivegpnfEfsTetheELlYnkekLl~ngd~Wese~a~N~~~~~lyr 212 (212)
T KOG3256|consen 161 ACPVDAIVEGPNFEFSTETHEELLYNKEKLLTNGDRWESEIAKNLQAELLYR 212 (212)
T ss_pred hCCccceeccCCceeccccHHHHhhhHHHHhhccccccchhhhcccchhhcC
Confidence 9999999999999999999999999999999999999999999999999997
|
|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >TIGR00402 napF ferredoxin-type protein NapF | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >TIGR02512 Fe_only_hydrog hydrogenases, Fe-only | Back alignment and domain information |
|---|
| >TIGR02912 sulfite_red_C sulfite reductase, subunit C | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >PRK00783 DNA-directed RNA polymerase subunit D; Provisional | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >cd07030 RNAP_D D subunit of Archaeal RNA polymerase | Back alignment and domain information |
|---|
| >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK09326 F420H2 dehydrogenase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK13795 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15449 ferredoxin-like protein FixX; Provisional | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00276 iron-sulfur cluster binding protein, putative | Back alignment and domain information |
|---|
| >cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR02486 RDH reductive dehalogenase | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional | Back alignment and domain information |
|---|
| >TIGR00273 iron-sulfur cluster-binding protein | Back alignment and domain information |
|---|
| >PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit | Back alignment and domain information |
|---|
| >PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR02910 sulfite_red_A sulfite reductase, subunit A | Back alignment and domain information |
|---|
| >PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2440 FixX Ferredoxin-like protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK15055 anaerobic sulfite reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1600 Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >TIGR02484 CitB CitB domain protein | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >COG1141 Fer Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >PRK15033 tricarballylate utilization protein B; Provisional | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >COG0348 NapH Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09326 F420H2 dehydrogenase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02512 Fe_only_hydrog hydrogenases, Fe-only | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >TIGR00402 napF ferredoxin-type protein NapF | Back alignment and domain information |
|---|
| >PRK15449 ferredoxin-like protein FixX; Provisional | Back alignment and domain information |
|---|
| >TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >COG1141 Fer Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02486 RDH reductive dehalogenase | Back alignment and domain information |
|---|
| >PLN02805 D-lactate dehydrogenase [cytochrome] | Back alignment and domain information |
|---|
| >COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02912 sulfite_red_C sulfite reductase, subunit C | Back alignment and domain information |
|---|
| >PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >TIGR00276 iron-sulfur cluster binding protein, putative | Back alignment and domain information |
|---|
| >PF02913 FAD-oxidase_C: FAD linked oxidases, C-terminal domain; InterPro: IPR004113 Some oxygen-dependent oxidoreductases are flavoproteins that contain a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage | Back alignment and domain information |
|---|
| >TIGR00387 glcD glycolate oxidase, subunit GlcD | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A | Back alignment and domain information |
|---|
| >COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B | Back alignment and domain information |
|---|
| >PRK13795 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00783 DNA-directed RNA polymerase subunit D; Provisional | Back alignment and domain information |
|---|
| >COG1600 Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >cd07030 RNAP_D D subunit of Archaeal RNA polymerase | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK11230 glycolate oxidase subunit GlcD; Provisional | Back alignment and domain information |
|---|
| >TIGR02910 sulfite_red_A sulfite reductase, subunit A | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK15055 anaerobic sulfite reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit | Back alignment and domain information |
|---|
| >KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00273 iron-sulfur cluster-binding protein | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 226 | ||||
| 2fug_9 | 182 | Crystal Structure Of The Hydrophilic Domain Of Resp | 1e-27 | ||
| 1fca_A | 55 | Structure Of The Ferredoxin From Clostridium Acidur | 1e-06 | ||
| 1fdn_A | 55 | Refined Crystal Structure Of The 2[4fe-4s] Ferredox | 2e-06 | ||
| 1clf_A | 55 | Clostridium Pasteurianum Ferredoxin Length = 55 | 8e-04 |
| >pdb|2FUG|9 Chain 9, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 182 | Back alignment and structure |
|
| >pdb|1FCA|A Chain A, Structure Of The Ferredoxin From Clostridium Acidurici: Model At 1.8 Angstroms Resolution Length = 55 | Back alignment and structure |
| >pdb|1FDN|A Chain A, Refined Crystal Structure Of The 2[4fe-4s] Ferredoxin From Clostridium Acidurici At 1.84 Angstroms Resolution Length = 55 | Back alignment and structure |
| >pdb|1CLF|A Chain A, Clostridium Pasteurianum Ferredoxin Length = 55 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 5e-89 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 4e-23 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 2e-18 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 6e-18 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 9e-17 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 1e-16 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 5e-16 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 3e-06 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 2e-15 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 5e-07 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 6e-12 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 2e-05 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 2e-11 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 2e-10 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 4e-10 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 4e-07 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 8e-05 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 6e-07 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 6e-04 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 8e-07 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 1e-06 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 2e-06 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 1e-06 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 2e-06 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 1e-05 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 2e-05 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 2e-04 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 2e-05 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 5e-05 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 2e-05 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 2e-05 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 7e-05 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 2e-04 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 1e-04 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 1e-04 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 1e-04 | |
| 3or1_B | 386 | Sulfite reductase beta; dissimilatory sulfite redu | 5e-04 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 8e-04 |
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Length = 182 | Back alignment and structure |
|---|
Score = 259 bits (663), Expect = 5e-89
Identities = 64/158 (40%), Positives = 89/158 (56%), Gaps = 6/158 (3%)
Query: 75 LFLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCE 134
+ L + + LG+TLKY F K VT+ YP L PRF G H L R+P G E+CI C LC
Sbjct: 1 MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCA 60
Query: 135 AVCPAQAITIEAEERED------GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE 188
A CPA AI +E E + G R Y+I+M +CI+CG C+EACP AIV G +FE
Sbjct: 61 AACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFE 120
Query: 189 YSTETHEELLYDKEKLLENGDRWETEIAENLRSESLYR 226
+ + +L+Y KE +L + + + E R+ +
Sbjct: 121 MADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVK 158
|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Length = 103 | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Length = 82 | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} PDB: 1blu_A 3exy_A Length = 82 | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Length = 80 | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Length = 80 | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Length = 80 | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Length = 421 | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Length = 421 | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Length = 150 | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574 | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 166 | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Length = 105 | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Length = 105 | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Length = 77 | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Length = 195 | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Length = 195 | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Length = 78 | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Length = 106 | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Length = 352 | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Length = 352 | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Length = 512 | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Length = 512 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Length = 214 | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Length = 214 | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 | Back alignment and structure |
|---|
| >3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* Length = 386 | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Length = 1231 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 99.78 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 99.29 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 99.29 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 99.29 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 99.27 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 99.25 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 99.23 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 99.22 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 99.22 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 99.21 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 99.2 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 99.2 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 99.15 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 99.15 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 99.15 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 99.14 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 99.13 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 99.12 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 99.03 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 98.96 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 98.9 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 98.85 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 98.8 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 98.76 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 98.74 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 98.72 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 98.72 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 98.68 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 98.63 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 98.61 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 98.61 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 98.58 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 98.58 | |
| 3mm5_B | 366 | Sulfite reductase, dissimilatory-type subunit BET; | 98.57 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 98.57 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 98.55 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 98.51 | |
| 3or1_B | 386 | Sulfite reductase beta; dissimilatory sulfite redu | 98.46 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 98.42 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 98.38 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 98.37 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 98.28 | |
| 3mm5_A | 418 | Sulfite reductase, dissimilatory-type subunit ALP; | 98.26 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 98.26 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 98.12 | |
| 2pa8_D | 265 | DNA-directed RNA polymerase subunit D; ferredoxin- | 97.98 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 97.96 | |
| 3or1_A | 437 | Sulfite reductase alpha; dissimilatory sulfite red | 97.9 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.86 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.79 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 97.19 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.14 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 97.11 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 97.07 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 97.05 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 97.02 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 96.96 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 96.85 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 96.8 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 96.67 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 96.66 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 96.56 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 96.53 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 96.48 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 96.46 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 96.39 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 96.34 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 96.21 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 96.11 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 95.89 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 95.84 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 95.49 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 95.08 | |
| 3or1_B | 386 | Sulfite reductase beta; dissimilatory sulfite redu | 94.57 | |
| 3pm9_A | 476 | Putative oxidoreductase; putative D-2-hydroxygluta | 94.48 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 94.2 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 93.92 | |
| 3mm5_B | 366 | Sulfite reductase, dissimilatory-type subunit BET; | 93.91 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 93.81 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 92.9 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 90.88 | |
| 3mm5_A | 418 | Sulfite reductase, dissimilatory-type subunit ALP; | 90.81 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 90.58 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 89.92 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 89.76 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 89.32 | |
| 1e8g_A | 560 | Vanillyl-alcohol oxidase; oxidoreductase, flavoenz | 88.86 | |
| 3or1_A | 437 | Sulfite reductase alpha; dissimilatory sulfite red | 87.79 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 86.04 | |
| 2pa8_D | 265 | DNA-directed RNA polymerase subunit D; ferredoxin- | 84.21 | |
| 1wvf_A | 520 | 4-cresol dehydrogenase [hydroxylating] flavoprote | 84.01 |
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
Probab=99.78 E-value=8.6e-20 Score=144.88 Aligned_cols=141 Identities=43% Similarity=0.831 Sum_probs=93.8
Q ss_pred hhHHHHHHHHHHHHHhcCCcceecCccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhccC---
Q 027264 76 FLTEMVRGLGLTLKYFFDKKVTINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDG--- 152 (226)
Q Consensus 76 ~~~~~~~~l~~~~~~~f~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~~~--- 152 (226)
.+.++++++..+++++|.+..+..||..+....+++++.+.+.....+.++|++||.|+.+||++++.+........
T Consensus 2 ~l~~~~~~l~~~~~~~~~~~~t~~yp~~~~~~~~~~~g~~~~~~~~~d~~~Ci~C~~C~~~CP~~ai~~~~~~~~~~~~~ 81 (182)
T 3i9v_9 2 TLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPV 81 (182)
T ss_dssp ------------------------CCSSCEECCTTCCCSEEECBCTTSCBSCCCCCHHHHHCTTCCEEEEEECCCSSSCS
T ss_pred CHHHHHHHHHHHHHHHcCCCcceECCCCCCCCCcccCCeEeeccCCCCCccCcccccchhhCCcccEEeecccccccccc
Confidence 35678899999999999999999999888788888998887776666788999999999999999987654321110
Q ss_pred ---CccccccccCCCCCCcchhhhhcCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCchHHHH
Q 027264 153 ---SRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWETEIA 216 (226)
Q Consensus 153 ---~~~~~~~~~d~~~C~~Cg~Cv~~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~ 216 (226)
........++.+.|++||.|+.+||++||.++..++.....+..++++...+.....++...+.
T Consensus 82 ~~~~~~~~~~~~~~~~C~~C~~C~~~CP~~Ai~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~p~~~ 148 (182)
T 3i9v_9 82 SAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRR 148 (182)
T ss_dssp SSSSCEEEEEEEETTTCCCCCHHHHHCSSSCEEECSCCCCCBSSGGGGEECHHHHBTTCCSCHHHHH
T ss_pred cccccccceeecCCCcCcChhChhhhCCccceEecCccccccccHHHHhcCHHHHhhcccCCCCCeE
Confidence 1111234567789999999999999999999999999999999999999888888888776654
|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* | Back alignment and structure |
|---|
| >3pm9_A Putative oxidoreductase; putative D-2-hydroxyglutarate dehydrogenase, putative D-LACT dehydrogenase; HET: FAD; 2.57A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >1e8g_A Vanillyl-alcohol oxidase; oxidoreductase, flavoenzyme, specificity; HET: FAD FCR; 2.1A {Penicillium simplicissimum} SCOP: d.58.32.1 d.145.1.1 PDB: 1e8f_A* 1e8h_A* 1qlt_A* 1qlu_A* 1vao_A* 1ahv_A* 1ahz_A* 1ahu_A* 2vao_A* 1w1j_A* 1dzn_A* 1w1l_A* 1e0y_A* 1w1k_A* 1w1m_A* | Back alignment and structure |
|---|
| >3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D | Back alignment and structure |
|---|
| >1wvf_A 4-cresol dehydrogenase [hydroxylating] flavoprote subunit; flavoprotein, electron-transfer, FAD, oxidoreductase; HET: FAD; 1.30A {Pseudomonas putida} SCOP: d.58.32.1 d.145.1.1 PDB: 1wve_A* 1dii_A* 1diq_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 226 | ||||
| d2fug91 | 154 | d.58.1.5 (9:26-179) NADH-quinone oxidoreductase ch | 6e-41 | |
| d2fdna_ | 55 | d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici | 3e-17 | |
| d2fdna_ | 55 | d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici | 3e-04 | |
| d1jb0c_ | 80 | d.58.1.2 (C:) Photosystem I iron-sulfur protein Ps | 5e-17 | |
| d1jb0c_ | 80 | d.58.1.2 (C:) Photosystem I iron-sulfur protein Ps | 6e-06 | |
| d1blua_ | 80 | d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [T | 7e-16 | |
| d1xera_ | 103 | d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. | 5e-15 | |
| d1xera_ | 103 | d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. | 1e-05 | |
| d1xera_ | 103 | d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. | 2e-04 | |
| d1dura_ | 55 | d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as | 1e-14 | |
| d1dura_ | 55 | d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as | 3e-04 | |
| d1dura_ | 55 | d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as | 3e-04 | |
| d1rgva_ | 80 | d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [Ta | 3e-14 | |
| d1hfel2 | 85 | d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun | 4e-14 | |
| d1hfel2 | 85 | d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun | 2e-04 | |
| d1fxda_ | 58 | d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T | 6e-14 | |
| d1gtea5 | 173 | d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen | 2e-13 | |
| d1gtea5 | 173 | d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen | 4e-04 | |
| d3c8ya3 | 83 | d.58.1.5 (A:127-209) Fe-only hydrogenase, second d | 6e-12 | |
| d3c8ya3 | 83 | d.58.1.5 (A:127-209) Fe-only hydrogenase, second d | 5e-04 | |
| d1sj1a_ | 66 | d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus | 1e-11 | |
| d1sj1a_ | 66 | d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus | 6e-04 | |
| d1sj1a_ | 66 | d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus | 7e-04 | |
| d2c42a5 | 117 | d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu | 2e-10 | |
| d2c42a5 | 117 | d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu | 0.003 | |
| d1vjwa_ | 59 | d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T | 3e-10 | |
| d1vjwa_ | 59 | d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T | 0.002 | |
| d1vjwa_ | 59 | d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T | 0.003 | |
| d1jnrb_ | 149 | d.58.1.5 (B:) Adenylylsulfate reductase B subunit | 3e-10 | |
| d1jnrb_ | 149 | d.58.1.5 (B:) Adenylylsulfate reductase B subunit | 0.002 | |
| d1bc6a_ | 77 | d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [Tax | 1e-09 | |
| d1fxra_ | 64 | d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte | 4e-09 | |
| d1h98a_ | 77 | d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [Ta | 6e-09 | |
| d3c7bb1 | 65 | d.58.1.5 (B:197-261) DsrB insert domain {Archaeogl | 1e-08 | |
| d1iqza_ | 81 | d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt | 1e-08 | |
| d7fd1a_ | 106 | d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [ | 2e-06 | |
| d1kqfb1 | 244 | d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-s | 5e-06 | |
| d1y5ib1 | 509 | d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 | 8e-06 | |
| d1y5ib1 | 509 | d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 | 2e-05 | |
| d2fug34 | 151 | d.58.1.5 (3:96-246) NADH-quinone oxidoreductase ch | 1e-05 | |
| d2bs2b1 | 133 | a.1.2.1 (B:107-239) Fumarate reductase {Wolinella | 0.001 |
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Length = 154 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: 4Fe-4S ferredoxins family: Ferredoxin domains from multidomain proteins domain: NADH-quinone oxidoreductase chain 9, Nqo9 species: Thermus thermophilus [TaxId: 274]
Score = 134 bits (339), Expect = 6e-41
Identities = 52/128 (40%), Positives = 70/128 (54%), Gaps = 8/128 (6%)
Query: 100 YPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIE------AEEREDGS 153
YP L PRF G H L R+P G E+CI C LC A CPA AI +E G
Sbjct: 1 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGE 60
Query: 154 RRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYDKEKLLEN--GDRW 211
R Y+I+M +CI+CG C+EACP AIV G +FE + + +L+Y KE +L + G +
Sbjct: 61 RYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKP 120
Query: 212 ETEIAENL 219
+ A+
Sbjct: 121 QRREAKRT 128
|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Length = 55 | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Length = 55 | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Length = 80 | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Length = 80 | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Length = 80 | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 149 | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 149 | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Length = 77 | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 65 | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Length = 106 | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Length = 244 | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Length = 509 | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Length = 509 | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Length = 151 | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 99.81 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 99.48 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 99.48 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 99.47 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 99.47 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 99.46 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 99.45 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 99.45 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 99.43 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 99.39 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 99.38 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 99.35 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 99.33 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 99.27 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 99.17 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 99.16 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 99.16 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 99.09 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 99.08 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 99.08 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 99.04 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 98.77 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 98.65 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 98.59 | |
| d1vlfn2 | 195 | Transhydroxylase beta subunit, BthL, N-terminal do | 98.55 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.54 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 98.5 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 98.49 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 98.37 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 98.33 | |
| d1vlfn2 | 195 | Transhydroxylase beta subunit, BthL, N-terminal do | 98.33 | |
| d1h0hb_ | 214 | Tungsten containing formate dehydrogenase, small s | 98.17 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 97.54 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 97.53 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 97.42 | |
| d2v4jb1 | 69 | DsrB insert domain {Desulfovibrio vulgaris [TaxId: | 97.4 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 97.37 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 97.37 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 97.36 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 97.26 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 97.2 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 97.19 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 97.13 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 97.09 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 97.07 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 97.03 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 97.03 | |
| d2gmha3 | 102 | Electron transfer flavoprotein-ubiquinone oxidored | 96.98 | |
| d1h0hb_ | 214 | Tungsten containing formate dehydrogenase, small s | 96.7 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 96.56 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 96.55 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 96.45 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 96.33 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 96.04 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 95.97 | |
| d3c7ba1 | 66 | DsrA insert domain {Archaeoglobus fulgidus [TaxId: | 95.76 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 95.72 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 95.24 | |
| d2v4ja1 | 81 | DsrA insert domain {Desulfovibrio vulgaris [TaxId: | 95.02 | |
| d1e8ga1 | 287 | Vanillyl-alcohol oxidase {Fungus (Penicillium simp | 93.68 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 91.67 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 91.33 | |
| d2gmha3 | 102 | Electron transfer flavoprotein-ubiquinone oxidored | 90.94 | |
| d1wvfa1 | 279 | Flavoprotein subunit of p-cresol methylhydroxylase | 90.04 | |
| d2v4jb1 | 69 | DsrB insert domain {Desulfovibrio vulgaris [TaxId: | 89.7 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 89.19 | |
| d1gtea1 | 182 | Dihydropyrimidine dehydrogenase, N-terminal domain | 81.1 |
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: 4Fe-4S ferredoxins family: Ferredoxin domains from multidomain proteins domain: NADH-quinone oxidoreductase chain 9, Nqo9 species: Thermus thermophilus [TaxId: 274]
Probab=99.81 E-value=3.5e-21 Score=147.86 Aligned_cols=113 Identities=45% Similarity=0.892 Sum_probs=91.3
Q ss_pred CccccCCCCCCccCccccccCCCccccccccccchhccccccccchhhhhc------cCCccccccccCCCCCCcchhhh
Q 027264 100 YPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEERE------DGSRRTTRYDIDMTKCIYCGFCQ 173 (226)
Q Consensus 100 ~p~~~~~~~~~~~~~~~~~~~~~~~~~Ci~Cg~C~~~CP~~ai~~~~~~~~------~~~~~~~~~~~d~~~C~~Cg~Cv 173 (226)
||+.+..++++|+|.+.+...+.+.++||+|+.|+.+||+.++........ .+.+....+.++...|++||.|+
T Consensus 1 YP~e~~~~~~r~RG~~~l~~~~~~~ekCI~C~~C~~~CP~~~i~~~~~~~~~~~~~~~~~~~~~~~~id~~~C~~CG~Cv 80 (154)
T d2fug91 1 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCE 80 (154)
T ss_dssp CCSSCEECCTTCCCSEEECBCTTSCBSCCCCTHHHHHCSSCCEEEEEEECCSSSCSBSSSEEEEEEEEETTTCCCCTHHH
T ss_pred CCCCCCCCCCCcCCceecccCCCCcccCcCCCcHHhhcCCcceeccccccccccccccccccceeEEeccccCCCCCCch
Confidence 788888888999999988777777889999999999999998876443211 11223344678889999999999
Q ss_pred hcCcccccccCCCcccchhcHHHhhcCHHHHhhcCCCch
Q 027264 174 EACPVDAIVEGPNFEYSTETHEELLYDKEKLLENGDRWE 212 (226)
Q Consensus 174 ~~CP~~Ai~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~ 212 (226)
.+||++||.++++|++++.++.+++++...++....++.
T Consensus 81 e~CPt~AI~~~~~~e~~~~~r~~l~~~k~~ll~~~~~~~ 119 (154)
T d2fug91 81 EACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTK 119 (154)
T ss_dssp HHCSSSCEEECSCCCCCBSCGGGSEECSTTTBTTCCSCH
T ss_pred hhCCCCeEeccCccccccCCHHHhccCHHHhhhcccCCc
Confidence 999999999999999999999999998887765544433
|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1e8ga1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wvfa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|