Citrus Sinensis ID: 027269

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEEEccEEEEEEEEEEcccccccccHHHHHHHHcccccccccccccEEEcccEEccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccEEccc
ccccccEEEEcccccccccccccccccccccccEEEEEEcccccccccccEcccccccccccccccccccHHHcccHHHcccccccccccHHHHHccHEEEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHccccccccccEEEEEEcccEEEEccccccccccccEccEccEcccccccccccccEEEEcccccccEcccEEEEccccHHEEEEEc
mastvstqmrlhspalifqgsysqgvanvcmlpmtssitnsqsghcpastlklsgraltsrshyassfpivqlskapsvkyrRMFCVNSMAKDVELQAKVTTKVffdvdiggkpagrivmglfgdvvpKTAENFRALCtgekgygykgcsFHRIIKDFMiqggdftegdgtggisiygssfedesfvlkhvgpgvlsmanagpntngsqfFICTVKVRWQLCFFC
mastvstqmrlhspaliFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRshyassfpivqlskapsVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQggdftegdgtggISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
**************ALIFQGSYSQGVANVCMLPMT***************************HYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFF*
***************************************************************************************************VTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
********MRLHSPALIFQGSYSQGVANVCMLPMTSSI**********STLKLSGRALTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
*****STQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
P34791260 Peptidyl-prolyl cis-trans yes no 0.728 0.630 0.742 7e-68
Q41651248 Peptidyl-prolyl cis-trans N/A no 0.72 0.653 0.699 2e-62
Q9ASS6259 Peptidyl-prolyl cis-trans no no 0.622 0.540 0.680 2e-53
P0CP78231 Peptidyl-prolyl cis-trans yes no 0.533 0.519 0.738 2e-49
P0CP79231 Peptidyl-prolyl cis-trans N/A no 0.533 0.519 0.738 2e-49
Q01490203 Peptidyl-prolyl cis-trans N/A no 0.537 0.596 0.727 2e-48
O93826226 Peptidyl-prolyl cis-trans N/A no 0.577 0.575 0.679 8e-48
P0C1H7164 Peptidyl-prolyl cis-trans N/A no 0.52 0.713 0.752 1e-47
P30405207 Peptidyl-prolyl cis-trans yes no 0.515 0.560 0.75 2e-47
Q8X166212 Peptidyl-prolyl cis-trans yes no 0.537 0.570 0.702 3e-47
>sp|P34791|CP20C_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 141/171 (82%), Gaps = 7/171 (4%)

Query: 54  SGRALTSRSHYASSFPIVQLSKA-PSVKYRRMFCVNSMAKD----VELQAKVTTKVFFDV 108
           SG AL+SR HYAS  PI Q S    + K++R  CV SMA +    +E QAKVT KV+FDV
Sbjct: 44  SGIALSSRLHYAS--PIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDV 101

Query: 109 DIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEG 168
           +IGG+ AGRIVMGLFG+VVPKT ENFRALCTGEK YGYKG SFHRIIKDFMIQGGDFTEG
Sbjct: 102 EIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEG 161

Query: 169 DGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRW 219
           +GTGGISIYG+ FEDE+F LKH GPG+LSMANAGPNTNGSQFFICTVK  W
Sbjct: 162 NGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSW 212
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q41651|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1 Back     alignment and function description
>sp|Q9ASS6|CP20B_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic OS=Arabidopsis thaliana GN=CYP20-2 PE=1 SV=1 Back     alignment and function description
>sp|P0CP78|PPIB_CRYNJ Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR2 PE=3 SV=1 Back     alignment and function description
>sp|P0CP79|PPIB_CRYNB Peptidyl-prolyl cis-trans isomerase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q01490|PPIB_ORPSP Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 Back     alignment and function description
>sp|O93826|PPIB_ARTBE Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1 Back     alignment and function description
>sp|P0C1H7|PPIA1_RHIO9 Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp2 PE=3 SV=1 Back     alignment and function description
>sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1 Back     alignment and function description
>sp|Q8X166|PPIB_ASPNG Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
255548201261 peptidyl-prolyl cis-trans isomerase, put 0.946 0.816 0.753 5e-89
224064414266 predicted protein [Populus trichocarpa] 0.968 0.819 0.744 7e-89
147766520253 hypothetical protein VITISV_015631 [Viti 0.871 0.774 0.733 2e-79
359480225253 PREDICTED: peptidyl-prolyl cis-trans iso 0.871 0.774 0.729 1e-78
359480227211 PREDICTED: peptidyl-prolyl cis-trans iso 0.857 0.914 0.735 2e-77
359806424260 uncharacterized protein LOC100785805 [Gl 0.937 0.811 0.659 2e-73
255631244243 unknown [Glycine max] 0.92 0.851 0.607 2e-71
356534945263 PREDICTED: peptidyl-prolyl cis-trans iso 0.92 0.787 0.607 4e-71
388500332262 unknown [Lotus japonicus] 0.924 0.793 0.633 1e-70
449511931252 PREDICTED: peptidyl-prolyl cis-trans iso 0.888 0.793 0.648 2e-68
>gi|255548201|ref|XP_002515157.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223545637|gb|EEF47141.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 186/219 (84%), Gaps = 6/219 (2%)

Query: 1   MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTS 60
           MAST S Q  + +P L+F+G+  Q V N+    M S++ +S SG     TL  +GRALTS
Sbjct: 1   MASTFSLQT-VPAPRLVFKGTDGQDVKNLSRTCMISAMRSSASG-----TLSFAGRALTS 54

Query: 61  RSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDVELQAKVTTKVFFDVDIGGKPAGRIVM 120
           RS Y+ SFPI QLSKAPSVK++RM C+ +MA D+E+QAKVTTKVFFDVDIGG+PAGRIVM
Sbjct: 55  RSRYSLSFPITQLSKAPSVKHQRMACIKAMANDLEVQAKVTTKVFFDVDIGGEPAGRIVM 114

Query: 121 GLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSS 180
           GLFGDVVPKTAENFRALCTG+KGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGG+SI+GSS
Sbjct: 115 GLFGDVVPKTAENFRALCTGDKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGVSIFGSS 174

Query: 181 FEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRW 219
           FEDESF LKHVGPGVLSMANAGPNTNGSQFFICTVK  W
Sbjct: 175 FEDESFDLKHVGPGVLSMANAGPNTNGSQFFICTVKTPW 213

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224064414|ref|XP_002301464.1| predicted protein [Populus trichocarpa] gi|222843190|gb|EEE80737.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766520|emb|CAN69876.1| hypothetical protein VITISV_015631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480225|ref|XP_002273421.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like isoform 1 [Vitis vinifera] gi|297744066|emb|CBI37036.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480227|ref|XP_003632419.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359806424|ref|NP_001240987.1| uncharacterized protein LOC100785805 [Glycine max] gi|255645203|gb|ACU23099.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255631244|gb|ACU15989.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356534945|ref|XP_003536011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|388500332|gb|AFK38232.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449511931|ref|XP_004164092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2079507313 ROC4 "rotamase CYP 4" [Arabido 0.92 0.661 0.584 6.8e-56
TAIR|locus:2179822259 Pnsl5 "Photosynthetic NDH subc 0.764 0.664 0.527 8.1e-44
UNIPROTKB|H0Y548165 PPIF "Peptidyl-prolyl cis-tran 0.524 0.715 0.669 5.3e-40
UNIPROTKB|P30405207 PPIF "Peptidyl-prolyl cis-tran 0.515 0.560 0.681 8.7e-40
ZFIN|ZDB-GENE-030131-7459164 ppiab "peptidylprolyl isomeras 0.52 0.713 0.675 2.1e-38
UNIPROTKB|F1S2E3207 LOC100152612 "Peptidyl-prolyl 0.515 0.560 0.663 2.6e-38
UNIPROTKB|P14851164 PPIA "Peptidyl-prolyl cis-tran 0.533 0.731 0.641 2.6e-38
MGI|MGI:2145814206 Ppif "peptidylprolyl isomerase 0.515 0.563 0.663 2.6e-38
RGD|3372164 Ppia "peptidylprolyl isomerase 0.533 0.731 0.641 2.6e-38
RGD|628670206 Ppif "peptidylprolyl isomerase 0.515 0.563 0.663 2.6e-38
TAIR|locus:2079507 ROC4 "rotamase CYP 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 576 (207.8 bits), Expect = 6.8e-56, P = 6.8e-56
 Identities = 131/224 (58%), Positives = 154/224 (68%)

Query:     1 MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTS 60
             MAS+ S QM +H+   I Q  +  GV +     + S+   +QS  C  +  + SG AL+S
Sbjct:    54 MASSSSMQM-VHTSRSIAQIGF--GVKS----QLVSANRTTQSV-CFGA--RSSGIALSS 103

Query:    61 RSHYASSFPIVQLSKA-PSVKYRRMFCVNSMAKD----VELQAKVTTKVFFDVDIGGKPA 115
             R HYAS  PI Q S    + K++R  CV SMA +    +E QAKVT KV+FDV+IGG+ A
Sbjct:   104 RLHYAS--PIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVA 161

Query:   116 GRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXIS 175
             GRIVMGLFG+VVPKT ENFRALCTGEK YGYKG SFHRIIKDFMIQ            IS
Sbjct:   162 GRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGIS 221

Query:   176 IYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRW 219
             IYG+ FEDE+F LKH GPG+LSMANAGPNTNGSQFFICTVK  W
Sbjct:   222 IYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSW 265
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS;IDA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IEP;RCA
GO:0048046 "apoplast" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0009642 "response to light intensity" evidence=IMP
GO:0009651 "response to salt stress" evidence=IMP
GO:0010555 "response to mannitol stimulus" evidence=IMP
GO:0019344 "cysteine biosynthetic process" evidence=RCA;IMP
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=IDA;RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0007165 "signal transduction" evidence=ISS
TAIR|locus:2179822 Pnsl5 "Photosynthetic NDH subcomplex L 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y548 PPIF "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30405 PPIF "Peptidyl-prolyl cis-trans isomerase F, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7459 ppiab "peptidylprolyl isomerase Ab (cyclophilin A)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2E3 LOC100152612 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P14851 PPIA "Peptidyl-prolyl cis-trans isomerase A" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
MGI|MGI:2145814 Ppif "peptidylprolyl isomerase F (cyclophilin F)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3372 Ppia "peptidylprolyl isomerase A (cyclophilin A)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|628670 Ppif "peptidylprolyl isomerase F" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0CP78PPIB_CRYNJ5, ., 2, ., 1, ., 80.73800.53330.5194yesno
Q8X166PPIB_ASPNG5, ., 2, ., 1, ., 80.70240.53770.5707yesno
P34791CP20C_ARATH5, ., 2, ., 1, ., 80.74260.72880.6307yesno
P30405PPIF_HUMAN5, ., 2, ., 1, ., 80.750.51550.5603yesno
P52015CYP7_CAEEL5, ., 2, ., 1, ., 80.71770.520.6842yesno
Q0ZQK7PPIA_NOMLE5, ., 2, ., 1, ., 80.70830.53330.7272yesno
Q4WP12PPIB_ASPFU5, ., 2, ., 1, ., 80.70240.53770.5789yesno
Q08E11PPIC_BOVIN5, ., 2, ., 1, ., 80.75830.53330.5660yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_II1684
hypothetical protein; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) (266 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 3e-84
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 3e-65
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 1e-60
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 3e-45
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-44
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 7e-42
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 9e-42
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 6e-36
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 9e-36
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 6e-35
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 4e-28
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 4e-20
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 1e-18
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 5e-11
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 6e-08
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 5e-06
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-04
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information 
 Score =  247 bits (632), Expect = 3e-84
 Identities = 94/122 (77%), Positives = 102/122 (83%), Gaps = 5/122 (4%)

Query: 103 KVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKG-----YGYKGCSFHRIIKD 157
           KVFFD+ IGG+PAGRIVM LF DVVPKTAENFRALCTGEKG     +GYKG +FHR+I D
Sbjct: 2   KVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKGGKPFGYKGSTFHRVIPD 61

Query: 158 FMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKV 217
           FMIQGGDFT G+GTGG SIYG  F DE+F LKH GPG+LSMANAGPNTNGSQFFI TVK 
Sbjct: 62  FMIQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFITTVKT 121

Query: 218 RW 219
            W
Sbjct: 122 PW 123

This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00060183 cyclophilin; Provisional 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 99.98
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 99.97
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 99.97
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 99.97
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 99.97
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.97
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 99.97
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.96
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.95
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 99.91
PRK00969508 hypothetical protein; Provisional 91.44
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 90.7
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 81.52
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-47  Score=345.11  Aligned_cols=124  Identities=69%  Similarity=1.112  Sum_probs=120.9

Q ss_pred             ccceEEEEEEECCeeceeEEEEEcCCCChhhHHHHHHHhhCCCCc--------ccCCCeEEEeecCceeecCccccCCCC
Q 027269          100 VTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGY--------GYKGCSFHRIIKDFMIQGGDFTEGDGT  171 (225)
Q Consensus       100 ~~~~vf~di~v~~t~~G~IvIeL~~~~aP~tv~NFl~L~~G~kG~--------~Y~gt~FhRVip~f~IQgGd~~~~~g~  171 (225)
                      .+++|||||+|++++.||||||||.++||+||+||+.||+|++|.        .|+|+.||||||+|||||||++.++|+
T Consensus         7 ~~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGt   86 (372)
T KOG0546|consen    7 TNPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGT   86 (372)
T ss_pred             CCceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCCC
Confidence            378999999999999999999999999999999999999999985        499999999999999999999999999


Q ss_pred             CCccccCCCCCCCccCccCCCceEEEEecCCCCCCCceEEEEcCCCCcccCC
Q 027269          172 GGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCF  223 (225)
Q Consensus       172 gg~si~g~~~~dE~~~l~H~~~G~LsMa~~gpns~gSQFfItl~~~p~LDg~  223 (225)
                      ||.+|||..|+||+|.++|+++++|||||.||||||||||||+.++|||||.
T Consensus        87 GGeSIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGk  138 (372)
T KOG0546|consen   87 GGESIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGK  138 (372)
T ss_pred             CcccccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCc
Confidence            9999999999999999999999999999999999999999999999999995

>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 2e-42
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-42
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-42
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 2e-42
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 3e-41
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 1e-40
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 1e-40
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-40
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-40
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-40
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 3e-40
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 3e-40
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 3e-40
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 3e-40
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 3e-40
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 3e-40
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 4e-40
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 4e-40
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 5e-40
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 6e-40
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 9e-40
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-39
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 8e-39
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 5e-38
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 6e-38
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 6e-38
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 1e-37
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 1e-37
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-37
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 5e-37
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 6e-37
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 2e-36
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-36
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 6e-36
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 7e-35
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-34
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 1e-33
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-33
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 1e-32
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 1e-32
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-32
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-32
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-32
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 1e-31
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 2e-30
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-30
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-30
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 7e-30
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 1e-29
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-29
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-29
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 1e-28
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 8e-28
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 3e-26
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 8e-19
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 8e-19
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 8e-19
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 6e-17
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 7e-17
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 3e-16
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 3e-15
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 5e-14
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 1e-13
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 6e-13
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-09
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 8e-08
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 5e-07
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 4e-04
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure 
Iteration: 1

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 87/116 (75%)
Query: 104 VFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXX 163
           V+ DVD  GKP GR+V+ L  DVVPKTAENFRALCTGEKG+GYKG +FHR+I  FM Q  
Sbjct: 7   VYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAG 66
Query: 164 XXXXXXXXXXISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRW 219
                      SIYGS F DE+F LKHVGPGVLSMANAGPNTNGSQFFICT+K  W
Sbjct: 67  DFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDW 122
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-95
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 2e-94
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 5e-94
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 9e-94
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 2e-93
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 2e-93
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 2e-93
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-93
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 7e-93
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-92
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-91
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 2e-91
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 4e-91
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 5e-91
1z81_A229 Cyclophilin; structural genomics, structural genom 8e-91
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-90
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 7e-90
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 7e-89
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 3e-80
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 3e-60
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 2e-59
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 4e-59
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-58
2b71_A196 Cyclophilin-like protein; structural genomics, str 5e-57
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 3e-52
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 4e-52
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 6e-52
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 5e-51
2hq6_A185 Serologically defined colon cancer antigen 10; pro 7e-51
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 1e-44
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 5e-44
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 8e-32
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 1e-31
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 1e-29
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 2e-25
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
 Score =  276 bits (708), Expect = 1e-95
 Identities = 84/129 (65%), Positives = 98/129 (75%)

Query: 91  AKDVELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCS 150
           + + +   KVT KV+FD+ IG +  GR++ GLFG  VPKT +NF AL TGEKG+GYK   
Sbjct: 5   SDEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSK 64

Query: 151 FHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQF 210
           FHR+IKDFMIQGGDFT GDGTGG SIYG  F DE+F LKH GPG +SMANAG +TNGSQF
Sbjct: 65  FHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQF 124

Query: 211 FICTVKVRW 219
           FI TVK  W
Sbjct: 125 FITTVKTAW 133
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.97
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
Probab=100.00  E-value=8.3e-44  Score=298.24  Aligned_cols=130  Identities=60%  Similarity=1.004  Sum_probs=123.9

Q ss_pred             hhcccccceEEEEEEECCeeceeEEEEEcCCCChhhHHHHHHHhhCCCCcccCCCeEEEeecCceeecCccccCCCCCCc
Q 027269           95 ELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGI  174 (225)
Q Consensus        95 ~~~~~~~~~vf~di~v~~t~~G~IvIeL~~~~aP~tv~NFl~L~~G~kG~~Y~gt~FhRVip~f~IQgGd~~~~~g~gg~  174 (225)
                      ..++.++++|||||.+++++.|+|+||||.+.||+||+||++||+|++||+|+|+.||||+|+|||||||+..++|.|+.
T Consensus         5 ~~~~~~~~~v~~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~g~~g~~Y~g~~FhRvi~~f~iQgGd~~~~~g~gg~   84 (172)
T 2haq_A            5 HHEPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDGTGGK   84 (172)
T ss_dssp             --CCCCCEEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTSCCSTTCBCCEEETTTEEEECCTTTSSSSCCC
T ss_pred             cCCCCCCCeEEEEEEECCEecceEEEEEeCCCCcHHHHHHHHHhccCCCcccCCCEEEEEECCCEEecCCccCCCCCCCc
Confidence            35688899999999999999999999999999999999999999999999999999999999999999998778999999


Q ss_pred             cccCCCCCCCccCccCCCceEEEEecCCCCCCCceEEEEcCCCCcccCCCC
Q 027269          175 SIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC  225 (225)
Q Consensus       175 si~g~~~~dE~~~l~H~~~G~LsMa~~gpns~gSQFfItl~~~p~LDg~~~  225 (225)
                      ++||+.|++|++.++|. +|+|||||.+||+|+||||||+.++|||||+|.
T Consensus        85 si~g~~f~dE~~~l~h~-~G~lsmAn~gp~tngSQFfIt~~~~~~LDg~~~  134 (172)
T 2haq_A           85 SIYGEKFADENLNVKHF-VGALSMANAGPNTNGSQFFITTAPTPWLDGRHV  134 (172)
T ss_dssp             CSSSSCBCCCCCCSCCC-TTEEEECCSSTTCBCSCEEEESSCCGGGTTTSC
T ss_pred             cccCCcccCcCCCcccC-ceEEEEccCCCCCcccEEEEECCCCCccCCCEe
Confidence            99999999999999998 999999999999999999999999999999874
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 2e-46
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 5e-43
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-42
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-42
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 6e-40
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 4e-39
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 7e-38
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 2e-37
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 3e-35
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 1e-34
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-34
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 5e-34
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-33
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 1e-31
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-29
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 4e-27
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-26
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 1e-21
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 2e-20
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 9e-20
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 8e-19
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-15
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like allergen Mal s 6
species: Malassezia sympodialis [TaxId: 76777]

 Score =  149 bits (377), Expect = 2e-46
 Identities = 82/124 (66%), Positives = 91/124 (73%)

Query: 102 TKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQ 161
           + VFFD+   G P G I   LF DVVPKTA NFRALCTGEKG+GY G  FHR+I DFM+Q
Sbjct: 2   SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFMLQ 61

Query: 162 GGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQL 221
           GGDFT G+GTGG SIYG+ F DE+F LKH  PG+LSMANAGPNTNGSQFFI TV   W  
Sbjct: 62  GGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLD 121

Query: 222 CFFC 225
               
Sbjct: 122 GKHV 125
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 99.97
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 99.97
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 99.97
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 99.97
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 99.96
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.96
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.96
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.96
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.95
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.9e-36  Score=245.49  Aligned_cols=124  Identities=63%  Similarity=1.019  Sum_probs=116.7

Q ss_pred             cceEEEEEEECCeeceeEEEEEcCCCChhhHHHHHHHhhCCC-CcccCCCeEEEeecCceeecCccccCCCCCCccccCC
Q 027269          101 TTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEK-GYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGS  179 (225)
Q Consensus       101 ~~~vf~di~v~~t~~G~IvIeL~~~~aP~tv~NFl~L~~G~k-G~~Y~gt~FhRVip~f~IQgGd~~~~~g~gg~si~g~  179 (225)
                      +++|||||+++++.+|+|+||||.+.||+||+||++||++++ ++ |+|+.||||+|+|+||+|++...++.++...++.
T Consensus         1 np~vy~di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~-Y~g~~f~Rv~~~~~iq~G~~~~~~~~~~~~~~~~   79 (161)
T d2r99a1           1 NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGK   79 (161)
T ss_dssp             CCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTSCC-STTCBEEEEETTTEEEECCTTTSSSSCCCBTTBS
T ss_pred             CCEEEEEEEECCEeceEEEEEEcCCCCcHHHHHHHHhhhhccccc-cCCcEEEEEEEeeeEEeeeccCCCCCCCccccCc
Confidence            578999999999999999999999999999999999998765 56 9999999999999999999998788888888888


Q ss_pred             CCCCCccCccCCCceEEEEecCCCCCCCceEEEEcCCCCcccCCCC
Q 027269          180 SFEDESFVLKHVGPGVLSMANAGPNTNGSQFFICTVKVRWQLCFFC  225 (225)
Q Consensus       180 ~~~dE~~~l~H~~~G~LsMa~~gpns~gSQFfItl~~~p~LDg~~~  225 (225)
                      .+++|...++|+++|+|+|++.+||+++|||||+|.++|+|||+|.
T Consensus        80 ~~~~~~~~~~~~~~G~ls~~~~~~~s~~sqFfI~~~~~~~Ldg~~t  125 (161)
T d2r99a1          80 KFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHV  125 (161)
T ss_dssp             CBCCCCCCSCCCSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSC
T ss_pred             cccccccccccccceeeeecccCCCCcCcceEeccCCccccCCcce
Confidence            8899999999999999999999999999999999999999999874
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure