Citrus Sinensis ID: 027330

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS

ccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccEEEEEccccccccHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccccccEEEHHHHHcccccccccccHHHHHccccccccEEEccHHHHHccccccc

cccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccHHHHccccccccEEEcHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHcccccHEEEEEHHHccccccHHHcccEEEEEccccccHHHHHHHHHHHccccccc

mdsplnseiesffdsapplndrAAISQKLKEFIALNSSESGTRRVACVtsggttvpleqRCVRYidnfssghrgaasTEHLIKMGYAVIFLYRrgtcepycsslpddafLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSsrslgpcsMFYLAAAVsdfyvpwksMVTIHESILHTCSSFVLLRLHFMLgkgrsfrs

MDSPLNSEIEsffdsapplNDRAAISQKLKEFIalnssesgtrrvacvtsggttvpleqrCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLgkgrsfrs

*******************************FIAL******TRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLG*******

******S**ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYV**********************RLHFMLGKGRSF**

*********ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS

******SEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGR****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		225	2.2.26 [Sep-21-2011]
Q9LZM3		309	Phosphopantothenate--cyst	yes	no	0.848	0.618	0.680	1e-75
Q8GXR5		317	Phosphopantothenate--cyst	yes	no	0.844	0.599	0.675	6e-73
Q9HAB8		311	Phosphopantothenate--cyst	yes	no	0.675	0.488	0.452	4e-31
Q9USK7		316	Uncharacterized protein C	yes	no	0.8	0.569	0.4	7e-30
Q8VDG5		311	Phosphopantothenate--cyst	yes	no	0.795	0.575	0.404	1e-26
P40506		365	Phosphopantothenate--cyst	yes	no	0.8	0.493	0.393	1e-25

>sp\|Q9LZM3\|PPCS2_ARATH Phosphopantothenate--cysteine ligase 2 OS=Arabidopsis thaliana GN=PPCS2 PE=2 SV=2	Back alignment and function desciption

 Score =  283 bits (723), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (80%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRY 64
           +  EI SFF+S+PP  +   I + L EFI LNSS  G RR+ CVTSGGTTVPLEQRCVRY
Sbjct: 1   MEDEISSFFESSPPQKNMEEILENLNEFIKLNSSSQGGRRIVCVTSGGTTVPLEQRCVRY 60

Query: 65  IDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVC 124
           IDNFSSG+RGAASTE+ +K GYAVIFLYRRGTC+PYC SLPDD FLECFE ++++ +QV 
Sbjct: 61  IDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRSLPDDPFLECFEFSDKTNIQVH 120

Query: 125 QPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAV 184
             + EAVK A+ D   AVA G LLKLPF+TI+EYLQML++IA + + +GPCSMFYLAAAV
Sbjct: 121 TSHLEAVKMAVMDQQTAVAEGSLLKLPFSTIYEYLQMLRLIAEALKDVGPCSMFYLAAAV 180

Query: 185 SDFYVPWKSMV 195
           SDFYVPWKSM 
Sbjct: 181 SDFYVPWKSMT 191

Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 5

>sp\|Q8GXR5\|PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana GN=PPCS1 PE=2 SV=1	Back alignment and function description

>sp\|Q9HAB8\|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens GN=PPCS PE=1 SV=2	Back alignment and function description

>sp\|Q9USK7\|YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.18 PE=3 SV=1	Back alignment and function description

>sp\|Q8VDG5\|PPCS_MOUSE Phosphopantothenate--cysteine ligase OS=Mus musculus GN=Ppcs PE=2 SV=1	Back alignment and function description

>sp\|P40506\|PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB2 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		225
224063167		327	predicted protein [Populus trichocarpa]	0.915	0.629	0.679	5e-79
449458083		332	PREDICTED: phosphopantothenate--cysteine	0.844	0.572	0.704	3e-78
358248488		320	uncharacterized protein LOC100777777 [Gl	0.888	0.625	0.665	9e-76
356515833		326	PREDICTED: phosphopantothenate--cysteine	0.848	0.585	0.685	2e-75
308191544		309	RecName: Full=Phosphopantothenate--cyste	0.848	0.618	0.680	5e-74
302141894		363	unnamed protein product [Vitis vinifera]	0.857	0.531	0.683	2e-73
147766524		329	hypothetical protein VITISV_039485 [Viti	0.928	0.635	0.641	3e-73
357477655		321	Phosphopantothenate-cysteine ligase [Med	0.848	0.595	0.670	3e-73
297844096		317	predicted protein [Arabidopsis lyrata su	0.844	0.599	0.691	4e-73
359492425		329	PREDICTED: phosphopantothenate--cysteine	0.857	0.586	0.683	4e-73

>gi\|224063167\|ref\|XP_002301023.1\| predicted protein [Populus trichocarpa] gi\|222842749\|gb\|EEE80296.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 146/215 (67%), Positives = 171/215 (79%), Gaps = 9/215 (4%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSS------ESGTRRVACVTSGGTTVPLE 58
           L++EIESFFDSAPPL DRA I +KLKEFI  NS+      +   RRV CVTSGGTTVPLE
Sbjct: 13  LDAEIESFFDSAPPLKDRAGIIKKLKEFIEYNSTPPVNAGKGSPRRVVCVTSGGTTVPLE 72

Query: 59  QRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEE 118
           QRCVRYIDNFSSGHRGA STE+ IK GYAVIFLYRRGT +PYC SLP+D  LECFE +++
Sbjct: 73  QRCVRYIDNFSSGHRGATSTEYFIKAGYAVIFLYRRGTFQPYCQSLPEDPLLECFECSDD 132

Query: 119 SAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMF 178
           S +QV QP++EAVKRA+ DHHAA+AGG LLKL FTTIFEYLQ+LQ IA+S + LG  ++F
Sbjct: 133 STIQVRQPHTEAVKRAVSDHHAAIAGGHLLKLSFTTIFEYLQILQSIAMSMKDLGSLAVF 192

Query: 179 YLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRL 213
           YLAAAVSDFYVPWKSM    E  + + S  + +RL
Sbjct: 193 YLAAAVSDFYVPWKSMA---EHKIQSASGPLDMRL 224

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449458083\|ref\|XP_004146777.1\| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus] gi\|449511568\|ref\|XP_004163992.1\| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|358248488\|ref\|NP_001239890.1\| uncharacterized protein LOC100777777 [Glycine max] gi\|255642574\|gb\|ACU21550.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|356515833\|ref\|XP_003526602.1\| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|308191544\|sp\|Q9LZM3.2\|PPCS2_ARATH RecName: Full=Phosphopantothenate--cysteine ligase 2; AltName: Full=Phosphopantothenoylcysteine synthetase 2; Short=PPC synthetase 2	Back alignment and taxonomy information

>gi\|302141894\|emb\|CBI19097.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147766524\|emb\|CAN76608.1\| hypothetical protein VITISV_039485 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357477655\|ref\|XP_003609113.1\| Phosphopantothenate-cysteine ligase [Medicago truncatula] gi\|355510168\|gb\|AES91310.1\| Phosphopantothenate-cysteine ligase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297844096\|ref\|XP_002889929.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297335771\|gb\|EFH66188.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|359492425\|ref\|XP_002284301.2\| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		225
TAIR\|locus:2034690		317	COAB "AT1G12350" [Arabidopsis	0.862	0.611	0.668	2.2e-66
UNIPROTKB\|G5EH02		439	MGCH7_ch7g472 "Phosphopantothe	0.804	0.412	0.446	2e-33
MGI\|MGI:1915237		311	Ppcs "phosphopantothenoylcyste	0.737	0.533	0.436	2.7e-29
UNIPROTKB\|Q9HAB8		311	PPCS "Phosphopantothenate--cys	0.675	0.488	0.458	5.6e-29
POMBASE\|SPCC4B3.18		316	SPCC4B3.18 "phosphopantothenat	0.835	0.594	0.388	1.9e-28
ZFIN\|ZDB-GENE-060512-104		320	ppcs "phosphopantothenoylcyste	0.742	0.521	0.406	1.3e-27
SGD\|S000001345		365	CAB2 "Probable phosphopantothe	0.813	0.501	0.394	1.2e-24
FB\|FBgn0261285		313	Ppcs "Phosphopantothenoylcyste	0.831	0.597	0.326	2.3e-23
DICTYBASE\|DDB_G0282611		389	DDB_G0282611 "phosphopantothen	0.413	0.239	0.368	1.1e-19
GENEDB_PFALCIPARUM\|PF11_0036		660	PF11_0036 "hypothetical protei	0.377	0.128	0.404	4.1e-10

TAIR\|locus:2034690 COAB "AT1G12350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 675 (242.7 bits), Expect = 2.2e-66, P = 2.2e-66
 Identities = 131/196 (66%), Positives = 154/196 (78%)

Query:     5 LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSS-ESGTRRVACVTSGGTTVPLEQRCVR 63
             +  EI SFF+S+PPL ++  I   L +FI LNSS + G RR+ CVTSGGTTVPLEQRCVR
Sbjct:     8 VEDEISSFFESSPPLKNKEEIVANLNQFIELNSSCQGGMRRIVCVTSGGTTVPLEQRCVR 67

Query:    64 YIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQV 123
             YIDNFSSG+RGAASTE+ +K GYAVIFLYRRGTC+PYC  LPDD FLECFE  +   +QV
Sbjct:    68 YIDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRYLPDDPFLECFEFPDAKNIQV 127

Query:   124 CQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAA 183
                +S AVK A+ D  AAVA G LLKLPF+TI+EYLQML++IA   + +GPCSMFYLAAA
Sbjct:   128 HGSHSGAVKMAVMDQQAAVAEGRLLKLPFSTIYEYLQMLRLIATILKDVGPCSMFYLAAA 187

Query:   184 VSDFYVPWKSMVTIHE 199
             VSDFYVPW SM T H+
Sbjct:   188 VSDFYVPWLSM-TEHK 202

GO:0003824 "catalytic activity" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016020 "membrane" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0004632 "phosphopantothenate--cysteine ligase activity" evidence=IDA

GO:0015937 "coenzyme A biosynthetic process" evidence=IDA

UNIPROTKB\|G5EH02 MGCH7_ch7g472 "Phosphopantothenate-cysteine ligase" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

MGI\|MGI:1915237 Ppcs "phosphopantothenoylcysteine synthetase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9HAB8 PPCS "Phosphopantothenate--cysteine ligase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

POMBASE\|SPCC4B3.18 SPCC4B3.18 "phosphopantothenate-cysteine ligase (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060512-104 ppcs "phosphopantothenoylcysteine synthetase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

SGD\|S000001345 CAB2 "Probable phosphopantothenoylcysteine synthetase (PPCS)" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

FB\|FBgn0261285 Ppcs "Phosphopantothenoylcysteine synthetase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0282611 DDB_G0282611 "phosphopantothenatecysteine ligase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF11_0036 PF11_0036 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LZM3	PPCS2_ARATH	6, ., 3, ., 2, ., 5	0.6806	0.8488	0.6181	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.921
3rd Layer	6.3.2.5	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		225
pfam04127		184	pfam04127, DFP, DNA / pantothenate metabolism flav	1e-06
PRK05579		399	PRK05579, PRK05579, bifunctional phosphopantotheno	1e-06
PRK06732		229	PRK06732, PRK06732, phosphopantothenate--cysteine	2e-05
TIGR02114		227	TIGR02114, coaB_strep, phosphopantothenate--cystei	1e-04

>gnl\|CDD\|217913 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein	Back alignment and domain information

 Score = 47.0 bits (113), Expect = 1e-06
 Identities = 40/113 (35%), Positives = 49/113 (43%), Gaps = 35/113 (30%)

Query: 43  RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAV-IFLYRRGTCE--- 98
           ++V  +T+G T  P++   VRYI N SSG           KMGYA+     RRG  E   
Sbjct: 4   KKV-LITAGPTREPIDP--VRYITNRSSG-----------KMGYALAEAAARRG-AEVTL 48

Query: 99  ---PYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHH-----AAVA 143
              P   SLP    +E   V  ESA +      EAV  A  D       AAVA
Sbjct: 49  VSGP--VSLPPPPGVEVIRV--ESAEE----MLEAVLEAFPDADIIIMAAAVA 93

The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism. Length = 184

>gnl\|CDD\|235513 PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|235856 PRK06732, PRK06732, phosphopantothenate--cysteine ligase; Validated	Back alignment and domain information

>gnl\|CDD\|131169 TIGR02114, coaB_strep, phosphopantothenate--cysteine ligase, streptococcal	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		225
KOG2728		302	consensus Uncharacterized conserved protein with s	100.0
PF04127		185	DFP: DNA / pantothenate metabolism flavoprotein; I	100.0
PRK13982		475	bifunctional SbtC-like/phosphopantothenoylcysteine	100.0
PRK09620		229	hypothetical protein; Provisional	100.0
PRK05579		399	bifunctional phosphopantothenoylcysteine decarboxy	99.97
TIGR00521		390	coaBC_dfp phosphopantothenoylcysteine decarboxylas	99.97
PRK06732		229	phosphopantothenate--cysteine ligase; Validated	99.96
TIGR02114		227	coaB_strep phosphopantothenate--cysteine ligase, s	99.95
COG0452		392	Dfp Phosphopantothenoylcysteine synthetase/decarbo	99.93
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	96.8
PRK07370		258	enoyl-(acyl carrier protein) reductase; Validated	96.67
PRK06114		254	short chain dehydrogenase; Provisional	96.67
PRK08589		272	short chain dehydrogenase; Validated	96.62
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	96.61
PRK07478		254	short chain dehydrogenase; Provisional	96.61
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	96.6
PRK06841		255	short chain dehydrogenase; Provisional	96.57
PRK07856		252	short chain dehydrogenase; Provisional	96.56
PRK08936		261	glucose-1-dehydrogenase; Provisional	96.54
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	96.52
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	96.5
PRK08159		272	enoyl-(acyl carrier protein) reductase; Provisiona	96.48
PRK07791		286	short chain dehydrogenase; Provisional	96.47
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	96.47
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	96.45
PRK06523		260	short chain dehydrogenase; Provisional	96.44
PRK06128		300	oxidoreductase; Provisional	96.41
PRK07035		252	short chain dehydrogenase; Provisional	96.4
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	96.37
PRK08628		258	short chain dehydrogenase; Provisional	96.37
PRK07062		265	short chain dehydrogenase; Provisional	96.36
PRK06179		270	short chain dehydrogenase; Provisional	96.35
PRK07097		265	gluconate 5-dehydrogenase; Provisional	96.32
PRK08213		259	gluconate 5-dehydrogenase; Provisional	96.28
PRK08690		261	enoyl-(acyl carrier protein) reductase; Provisiona	96.28
PRK12937		245	short chain dehydrogenase; Provisional	96.27
PRK05867		253	short chain dehydrogenase; Provisional	96.27
PRK06603		260	enoyl-(acyl carrier protein) reductase; Provisiona	96.22
PRK06398		258	aldose dehydrogenase; Validated	96.21
PRK07985		294	oxidoreductase; Provisional	96.2
PRK07109		334	short chain dehydrogenase; Provisional	96.18
PRK07523		255	gluconate 5-dehydrogenase; Provisional	96.17
PRK06138		252	short chain dehydrogenase; Provisional	96.16
PRK08226		263	short chain dehydrogenase; Provisional	96.15
PRK05717		255	oxidoreductase; Validated	96.14
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	96.12
PRK07774		250	short chain dehydrogenase; Provisional	96.12
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	96.11
PRK07063		260	short chain dehydrogenase; Provisional	96.11
PRK06196		315	oxidoreductase; Provisional	96.09
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	96.09
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	96.06
PRK08415		274	enoyl-(acyl carrier protein) reductase; Provisiona	96.06
PRK08265		261	short chain dehydrogenase; Provisional	96.04
PRK07814		263	short chain dehydrogenase; Provisional	96.04
PRK06997		260	enoyl-(acyl carrier protein) reductase; Provisiona	96.03
PRK08277		278	D-mannonate oxidoreductase; Provisional	96.02
PRK12744		257	short chain dehydrogenase; Provisional	95.99
PRK12748		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	95.99
PRK12938		246	acetyacetyl-CoA reductase; Provisional	95.97
PRK08643		256	acetoin reductase; Validated	95.96
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	95.94
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	95.93
PLN02253		280	xanthoxin dehydrogenase	95.9
PRK05876		275	short chain dehydrogenase; Provisional	95.88
PRK06124		256	gluconate 5-dehydrogenase; Provisional	95.88
PRK05866		293	short chain dehydrogenase; Provisional	95.88
PRK08278		273	short chain dehydrogenase; Provisional	95.88
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	95.88
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	95.87
PRK07792		306	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.86
PRK05854		313	short chain dehydrogenase; Provisional	95.86
PRK06194		287	hypothetical protein; Provisional	95.85
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	95.84
PRK08085		254	gluconate 5-dehydrogenase; Provisional	95.82
PRK06500		249	short chain dehydrogenase; Provisional	95.81
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.81
PRK12743		256	oxidoreductase; Provisional	95.8
PRK12939		250	short chain dehydrogenase; Provisional	95.76
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	95.75
PRK06197		306	short chain dehydrogenase; Provisional	95.74
PRK12746		254	short chain dehydrogenase; Provisional	95.7
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.67
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	95.66
PRK12829		264	short chain dehydrogenase; Provisional	95.66
PRK08303		305	short chain dehydrogenase; Provisional	95.64
PRK12827		249	short chain dehydrogenase; Provisional	95.64
PRK05875		276	short chain dehydrogenase; Provisional	95.64
PRK07825		273	short chain dehydrogenase; Provisional	95.64
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.61
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	95.6
PRK06701		290	short chain dehydrogenase; Provisional	95.6
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	95.53
PRK08862		227	short chain dehydrogenase; Provisional	95.52
PRK07067		257	sorbitol dehydrogenase; Provisional	95.51
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	95.5
PRK06139		330	short chain dehydrogenase; Provisional	95.48
PRK12859		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	95.47
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	95.46
PRK07806		248	short chain dehydrogenase; Provisional	95.46
PRK12935		247	acetoacetyl-CoA reductase; Provisional	95.45
PRK09242		257	tropinone reductase; Provisional	95.44
PRK09134		258	short chain dehydrogenase; Provisional	95.38
PRK06484		520	short chain dehydrogenase; Validated	95.34
PRK12747		252	short chain dehydrogenase; Provisional	95.34
PRK07074		257	short chain dehydrogenase; Provisional	95.29
PRK06484		520	short chain dehydrogenase; Validated	95.2
PRK09135		249	pteridine reductase; Provisional	95.18
PRK07577		234	short chain dehydrogenase; Provisional	95.15
PRK05872		296	short chain dehydrogenase; Provisional	95.14
PRK06172		253	short chain dehydrogenase; Provisional	95.13
TIGR01829		242	AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy	95.13
PRK06720		169	hypothetical protein; Provisional	95.12
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	95.11
PRK06182		273	short chain dehydrogenase; Validated	95.1
PRK08251		248	short chain dehydrogenase; Provisional	95.1
PRK06949		258	short chain dehydrogenase; Provisional	95.09
PRK07890		258	short chain dehydrogenase; Provisional	95.07
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	95.05
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.05
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.03
PRK07576		264	short chain dehydrogenase; Provisional	94.93
PRK08264		238	short chain dehydrogenase; Validated	94.87
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	94.77
PF13561		241	adh_short_C2: Enoyl-(Acyl carrier protein) reducta	94.74
PRK07024		257	short chain dehydrogenase; Provisional	94.73
PRK06180		277	short chain dehydrogenase; Provisional	94.71
PRK07454		241	short chain dehydrogenase; Provisional	94.7
PRK07453		322	protochlorophyllide oxidoreductase; Validated	94.69
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.66
PRK06123		248	short chain dehydrogenase; Provisional	94.65
PRK08642		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.64
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.6
PRK07677		252	short chain dehydrogenase; Provisional	94.57
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.48
PRK07326		237	short chain dehydrogenase; Provisional	94.45
PRK06198		260	short chain dehydrogenase; Provisional	94.44
PRK06181		263	short chain dehydrogenase; Provisional	94.4
PRK06947		248	glucose-1-dehydrogenase; Provisional	94.33
PRK07201		657	short chain dehydrogenase; Provisional	94.31
PRK06482		276	short chain dehydrogenase; Provisional	94.28
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	93.97
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	93.91
PRK05693		274	short chain dehydrogenase; Provisional	93.86
TIGR01289		314	LPOR light-dependent protochlorophyllide reductase	93.77
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.73
PRK06914		280	short chain dehydrogenase; Provisional	93.71
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.46
TIGR02632		676	RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc	93.41
PRK09186		256	flagellin modification protein A; Provisional	93.21
PRK05855		582	short chain dehydrogenase; Validated	92.95
PRK08339		263	short chain dehydrogenase; Provisional	92.87
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	92.58
PRK07775		274	short chain dehydrogenase; Provisional	92.52
PRK08340		259	glucose-1-dehydrogenase; Provisional	92.5
PRK07102		243	short chain dehydrogenase; Provisional	92.46
PRK12367		245	short chain dehydrogenase; Provisional	92.45
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	92.41
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	92.41
PLN02583		297	cinnamoyl-CoA reductase	92.37
PRK09072		263	short chain dehydrogenase; Provisional	92.22
PRK08703		239	short chain dehydrogenase; Provisional	92.14
PRK12828		239	short chain dehydrogenase; Provisional	92.13
KOG1502		327	consensus Flavonol reductase/cinnamoyl-CoA reducta	92.13
PLN02653		340	GDP-mannose 4,6-dehydratase	92.08
PRK06483		236	dihydromonapterin reductase; Provisional	92.02
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	91.97
PRK13656		398	trans-2-enoyl-CoA reductase; Provisional	91.84
PRK06057		255	short chain dehydrogenase; Provisional	91.79
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	91.71
KOG1201		300	consensus Hydroxysteroid 17-beta dehydrogenase 11	91.7
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	91.62
PLN02780		320	ketoreductase/ oxidoreductase	91.59
PRK07069		251	short chain dehydrogenase; Validated	91.4
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	91.38
PRK06125		259	short chain dehydrogenase; Provisional	91.35
PRK12742		237	oxidoreductase; Provisional	91.17
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	91.12
PRK05993		277	short chain dehydrogenase; Provisional	91.0
PRK07831		262	short chain dehydrogenase; Provisional	90.91
PRK08324		681	short chain dehydrogenase; Validated	90.88
COG1028		251	FabG Dehydrogenases with different specificities (	90.86
PLN02686		367	cinnamoyl-CoA reductase	90.84
PRK07904		253	short chain dehydrogenase; Provisional	90.82
PLN00198		338	anthocyanidin reductase; Provisional	90.8
PRK06300		299	enoyl-(acyl carrier protein) reductase; Provisiona	90.68
COG0300		265	DltE Short-chain dehydrogenases of various substra	90.63
KOG1205		282	consensus Predicted dehydrogenase [Secondary metab	90.45
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	90.34
PRK08177		225	short chain dehydrogenase; Provisional	90.2
PLN00016		378	RNA-binding protein; Provisional	90.07
PRK12446		352	undecaprenyldiphospho-muramoylpentapeptide beta-N-	89.72
PRK05599		246	hypothetical protein; Provisional	89.68
PLN02572		442	UDP-sulfoquinovose synthase	89.64
PRK05650		270	short chain dehydrogenase; Provisional	89.6
PRK08263		275	short chain dehydrogenase; Provisional	89.57
KOG1014		312	consensus 17 beta-hydroxysteroid dehydrogenase typ	89.52
PRK09291		257	short chain dehydrogenase; Provisional	89.5
PLN02896		353	cinnamyl-alcohol dehydrogenase	89.48
TIGR02415		254	23BDH acetoin reductases. One member of this famil	89.37
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	89.32
PLN02240		352	UDP-glucose 4-epimerase	89.3
PF01073		280	3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso	89.29
PRK07832		272	short chain dehydrogenase; Provisional	89.28
TIGR01472		343	gmd GDP-mannose 4,6-dehydratase. Excluded from thi	89.18
PRK09730		247	putative NAD(P)-binding oxidoreductase; Provisiona	89.15
TIGR01830		239	3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re	89.11
COG1089		345	Gmd GDP-D-mannose dehydratase [Cell envelope bioge	89.04
TIGR02685		267	pter_reduc_Leis pteridine reductase. Pteridine red	89.03
smart00822		180	PKS_KR This enzymatic domain is part of bacterial	89.02
PLN02650		351	dihydroflavonol-4-reductase	88.91
PRK09987		299	dTDP-4-dehydrorhamnose reductase; Provisional	88.83
PLN02214		342	cinnamoyl-CoA reductase	88.66
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	88.65
PLN02730		303	enoyl-[acyl-carrier-protein] reductase	88.61
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	88.6
PLN03209		576	translocon at the inner envelope of chloroplast su	88.47
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	88.42
TIGR01831		239	fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas	87.79
PLN02695		370	GDP-D-mannose-3',5'-epimerase	87.36
PRK07060		245	short chain dehydrogenase; Provisional	87.35
PRK12824		245	acetoacetyl-CoA reductase; Provisional	87.26
PF03033		139	Glyco_transf_28: Glycosyltransferase family 28 N-t	87.1
PLN02206		442	UDP-glucuronate decarboxylase	86.72
COG2910		211	Putative NADH-flavin reductase [General function p	86.25
PRK08267		260	short chain dehydrogenase; Provisional	86.23
KOG0725		270	consensus Reductases with broad range of substrate	86.0
PLN02778		298	3,5-epimerase/4-reductase	85.95
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	84.53
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	84.34
PRK06924		251	short chain dehydrogenase; Provisional	84.12
PLN00015		308	protochlorophyllide reductase	83.72
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	83.51
PLN02166		436	dTDP-glucose 4,6-dehydratase	83.0
PLN02427		386	UDP-apiose/xylose synthase	82.78
PRK10217		355	dTDP-glucose 4,6-dehydratase; Provisional	82.77
PRK07041		230	short chain dehydrogenase; Provisional	82.65
PRK06101		240	short chain dehydrogenase; Provisional	82.65
PF04321		286	RmlD_sub_bind: RmlD substrate binding domain; Inte	82.61
TIGR01133		348	murG undecaprenyldiphospho-muramoylpentapeptide be	82.57
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	82.31
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	81.31
PRK08125		660	bifunctional UDP-glucuronic acid decarboxylase/UDP	80.86

>KOG2728 consensus Uncharacterized conserved protein with similarity to phosphopantothenoylcysteine synthetase/decarboxylase [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=3.6e-60  Score=414.04  Aligned_cols=209  Identities=39%  Similarity=0.553  Sum_probs=186.9

Q ss_pred             hhccCCCCCCHHHHHHHHHHHHhhCCCCCCCCceEEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCCCEEEEE
Q 027330           12 FFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFL   91 (225)
Q Consensus        12 ff~~~~~~~~~~~i~~~l~~f~~~~~~~~~~~~~vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G~~Vi~l   91 (225)
                      ||+.+|+|+++++....+++|+.++... +.+++|+||||||+||||+|+||||||||+|+||+++||+|++.||+|||+
T Consensus         1 ~~~~~p~p~~~~d~~s~~~eFi~~q~s~-~~rrIVlVTSGGTtVPLE~ntVRFiDNFSaGtRGAaSAE~Fl~agYaVIFl   79 (302)
T KOG2728|consen    1 FFEMNPVPESLDDPGSLIEEFIKLQASL-QGRRIVLVTSGGTTVPLEQNTVRFIDNFSAGTRGAASAEYFLAAGYAVIFL   79 (302)
T ss_pred             CCCcCCCcccccchhHHHHHHHHHHhhc-cCceEEEEecCCeEeecccCceEeeeccCcCCccchhHHHHHhCCceEEEE
Confidence            7999999999999999999999987542 356699999999999999999999999999999999999999999999999


Q ss_pred             eecCCCCCCccCCCCcccchhhhcccCCc---eEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHHHHHHHHHH
Q 027330           92 YRRGTCEPYCSSLPDDAFLECFEVTEESA---VQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVS  168 (225)
Q Consensus        92 ~r~~s~~P~~~~l~~~~~~~~l~~~~~~~---i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~~L~~i~~~  168 (225)
                      ||..|+.||+|++|.+.+..+++..+...   |...+...+.+.++++.|+..-..++|+.+||||+.|||++|++||++
T Consensus        80 ~R~~Sl~Py~R~f~~~~~~~~l~~~g~~~~~~i~~~e~~~~vf~~~~~~~k~~~k~~~lL~vpFtT~~~Yl~~L~aiae~  159 (302)
T KOG2728|consen   80 YRERSLFPYTRHFPGQTWFLFLRPSGSALSGLIEKEENALPVFAEALEKYKYAEKAGTLLYVPFTTLADYLWLLRAIAEA  159 (302)
T ss_pred             eeccccccccccCCCchhhhhhccCCcccccceecCchhhHHHHHHHHHHHHHHhhCcEEEEecchHHHHHHHHHHHHHH
Confidence            99999999999999888888888765321   333333344466677777776678999999999999999999999999


Q ss_pred             hhccCCcceEEEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhccc
Q 027330          169 SRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGR  221 (225)
Q Consensus       169 l~~~~~~~~~~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~  221 (225)
                      |++++++.|+|+||||||||||++.|++|||.|+++.+.|+|...||+|..+.
T Consensus       160 Ln~~~sramfYLAAAVSDFyVP~~~mpeHKIqSg~~~l~i~l~~VPK~L~~Lv  212 (302)
T KOG2728|consen  160 LNPLGSRAMFYLAAAVSDFYVPESEMPEHKIQSGSGPLQITLKPVPKMLSPLV  212 (302)
T ss_pred             hccccchHHHHHHHHhcccccChhhcchhhcccCCCCceEEeccchHHHHHHH
Confidence            99999999999999999999999999999999998999999999999998654

>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism	Back alignment and domain information

>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional	Back alignment and domain information

>PRK09620 hypothetical protein; Provisional	Back alignment and domain information

>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated	Back alignment and domain information

>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic	Back alignment and domain information

>PRK06732 phosphopantothenate--cysteine ligase; Validated	Back alignment and domain information

>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal	Back alignment and domain information

>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism]	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07370 enoyl-(acyl carrier protein) reductase; Validated	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07791 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>PRK12744 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08278 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK12743 oxidoreductase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08303 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12935 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>PRK09134 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase	Back alignment and domain information

>PRK06720 hypothetical protein; Provisional	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06123 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01289 LPOR light-dependent protochlorophyllide reductase	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07775 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]	Back alignment and domain information

>PLN02653 GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK13656 trans-2-enoyl-CoA reductase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>PLN02686 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00198 anthocyanidin reductase; Provisional	Back alignment and domain information

>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed	Back alignment and domain information

>PRK05599 hypothetical protein; Provisional	Back alignment and domain information

>PLN02572 UDP-sulfoquinovose synthase	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones

Back alignment and domain information

>PRK07832 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01472 gmd GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional	Back alignment and domain information

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase	Back alignment and domain information

>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02685 pter_reduc_Leis pteridine reductase	Back alignment and domain information

>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional	Back alignment and domain information

>PLN02214 cinnamoyl-CoA reductase	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>PLN02730 enoyl-[acyl-carrier-protein] reductase	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12824 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PLN02206 UDP-glucuronate decarboxylase	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only]	Back alignment and domain information

>PLN02778 3,5-epimerase/4-reductase	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00015 protochlorophyllide reductase	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PLN02166 dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional	Back alignment and domain information

>PRK07041 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1	Back alignment and domain information

>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		225
1p9o_A		313	Crystal Structure Of Phosphopantothenoylcysteine Sy		5e-32

>pdb|1P9O|A Chain A, Crystal Structure Of Phosphopantothenoylcysteine Synthetase Length = 313

Back alignment and structure

Iteration: 1

Score = 134 bits (336), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 71/157 (45%), Positives = 89/157 (56%), Gaps = 5/157 (3%) Query: 43 RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCS 102 RRV VTSGGT VPLE R VR++DNFSSG RGA S E + GY V+FLYR + PY Sbjct: 37 RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAH 96 Query: 103 SLPDDAFLECFEVTEESAVQVCQPYSE-----AVKRAIRDHHAAVAGGLLLKLPFTTIFE 157 P +L + + + +E A+R + A A G L + FTT+ + Sbjct: 97 RFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLAD 156 Query: 158 YLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSM 194 YL +LQ A + LGP +MFYLAAAVSDFYVP M Sbjct: 157 YLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEM 193

PyMOL of 1p9o

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		225
1p9o_A		313	Phosphopantothenoylcysteine synthetase; ligase; 2.	5e-51
2gk4_A		232	Conserved hypothetical protein; alpha-beta-alpha s	7e-06
1u7z_A		226	Coenzyme A biosynthesis bifunctional protein coabc	2e-04

>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Length = 313	Back alignment and structure

 Score =  166 bits (422), Expect = 5e-51
 Identities = 74/194 (38%), Positives = 98/194 (50%), Gaps = 7/194 (3%)

Query: 10  ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFS 69
                  P     A  ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFS
Sbjct: 6   MDPVAEFPQPPGAARWAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFS 63

Query: 70  SGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESA-----VQVC 124
           SG RGA S E  +  GY V+FLYR  +  PY    P   +L     +  +      ++  
Sbjct: 64  SGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAE 123

Query: 125 QPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAV 184
           +        A+R +  A A G  L + FTT+ +YL +LQ  A +   LGP +MFYLAAAV
Sbjct: 124 ENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAV 183

Query: 185 SDFYVPWKSMVTIH 198
           SDFYVP   M    
Sbjct: 184 SDFYVPVSEMPEHK 197

PyMOL of 1p9o

>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Length = 232	Back alignment and structure

>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Length = 226	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		225
1p9o_A		313	Phosphopantothenoylcysteine synthetase; ligase; 2.	100.0
2gk4_A		232	Conserved hypothetical protein; alpha-beta-alpha s	100.0
1u7z_A		226	Coenzyme A biosynthesis bifunctional protein coabc	99.97
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	97.69
3pxx_A		287	Carveol dehydrogenase; structural genomics, seattl	97.6
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	97.52
3tsc_A		277	Putative oxidoreductase; structural genomics, seat	97.51
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	97.47
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	97.46
4fn4_A		254	Short chain dehydrogenase; NADH-binding, rossmann	97.41
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	97.41
3oec_A		317	Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO;	97.33
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	97.29
3e03_A		274	Short chain dehydrogenase; structural genomics, PS	97.25
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	97.22
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	97.22
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	97.19
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	97.19
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	97.19
4gkb_A		258	3-oxoacyl-[acyl-carrier protein] reductase; putati	97.17
4g81_D		255	Putative hexonate dehydrogenase; enzyme function i	97.14
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	97.14
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	97.13
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	97.13
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	97.12
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	97.11
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	97.1
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	97.1
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	97.09
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	97.09
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	97.08
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	97.08
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	97.07
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	97.07
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	97.06
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	97.05
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	97.05
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	97.04
3sc4_A		285	Short chain dehydrogenase (A0QTM2 homolog); ssgcid	97.04
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	97.02
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	97.02
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	97.01
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	97.01
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	97.0
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	97.0
1g0o_A		283	Trihydroxynaphthalene reductase; protein-NADPH-act	97.0
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	96.99
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	96.99
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	96.99
4dry_A		281	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.99
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	96.98
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	96.97
2jah_A		247	Clavulanic acid dehydrogenase; short-chain dehydro	96.97
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.96
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	96.96
3imf_A		257	Short chain dehydrogenase; structural genomics, in	96.96
3k31_A		296	Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI	96.95
3kvo_A		346	Hydroxysteroid dehydrogenase-like protein 2; HSDL2	96.95
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	96.94
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	96.94
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	96.93
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	96.92
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.92
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	96.91
4h15_A		261	Short chain alcohol dehydrogenase-related dehydro;	96.91
3i1j_A		247	Oxidoreductase, short chain dehydrogenase/reducta;	96.91
3uxy_A		266	Short-chain dehydrogenase/reductase SDR; structura	96.91
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	96.91
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	96.9
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	96.9
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	96.89
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	96.89
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	96.88
3grk_A		293	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	96.88
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	96.87
3v2h_A		281	D-beta-hydroxybutyrate dehydrogenase; structural g	96.86
3qlj_A		322	Short chain dehydrogenase; structural genomics, se	96.86
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	96.86
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	96.86
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	96.85
1ja9_A		274	4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p	96.85
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	96.84
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	96.84
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	96.84
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	96.83
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	96.81
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	96.81
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	96.8
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	96.79
3cxt_A		291	Dehydrogenase with different specificities; rossma	96.77
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	96.77
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	96.76
3r3s_A		294	Oxidoreductase; structural genomics, csgid, center	96.76
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	96.76
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	96.75
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	96.75
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	96.75
4fs3_A		256	Enoyl-[acyl-carrier-protein] reductase [NADPH] FA;	96.74
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	96.74
4fgs_A		273	Probable dehydrogenase protein; PSI-biology, nysgr	96.74
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	96.74
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	96.73
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	96.73
3zv4_A		281	CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox	96.73
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	96.72
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	96.7
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	96.7
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	96.7
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	96.68
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	96.67
1xkq_A		280	Short-chain reductase family member (5D234); parra	96.66
1zem_A		262	Xylitol dehydrogenase; rossmann fold, dinucleotide	96.66
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	96.65
3rih_A		293	Short chain dehydrogenase or reductase; structural	96.65
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	96.65
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	96.64
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	96.64
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	96.64
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	96.64
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	96.63
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	96.63
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	96.62
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	96.61
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	96.61
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	96.59
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	96.59
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	96.59
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	96.58
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	96.58
1xq1_A		266	Putative tropinone reducatse; structural genomics,	96.57
3gvc_A		277	Oxidoreductase, probable short-chain type dehydrog	96.57
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	96.57
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	96.56
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	96.55
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	96.55
1xg5_A		279	ARPG836; short chain dehydrogenase, human, SGC, st	96.53
2ew8_A		249	(S)-1-phenylethanol dehydrogenase; transferase; 2.	96.53
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	96.52
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	96.51
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	96.51
3o26_A		311	Salutaridine reductase; short chain dehydrogenase/	96.5
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	96.49
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	96.49
1gz6_A		319	Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF	96.48
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	96.48
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	96.47
2ph3_A		245	3-oxoacyl-[acyl carrier protein] reductase; TTHA04	96.44
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	96.44
1xhl_A		297	Short-chain dehydrogenase/reductase family member	96.44
4dqx_A		277	Probable oxidoreductase protein; structural genomi	96.43
1yxm_A		303	Pecra, peroxisomal trans 2-enoyl COA reductase; pe	96.43
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	96.43
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	96.42
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	96.42
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	96.41
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	96.41
3u9l_A		324	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.41
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	96.4
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	96.38
1spx_A		278	Short-chain reductase family member (5L265); paral	96.36
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	96.36
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	96.35
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	96.35
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	96.34
1h5q_A		265	NADP-dependent mannitol dehydrogenase; oxidoreduct	96.33
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	96.31
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	96.28
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	96.28
1dhr_A		241	Dihydropteridine reductase; oxidoreductase(acting	96.26
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	96.21
1e7w_A		291	Pteridine reductase; dihydrofolate reductase, shor	96.17
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	96.15
3uce_A		223	Dehydrogenase; rossmann fold, oxidoreductase; HET:	96.14
2qq5_A		260	DHRS1, dehydrogenase/reductase SDR family member 1	96.13
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	96.11
2bd0_A		244	Sepiapterin reductase; oxidoreductase; HET: NAP BI	96.1
1uay_A		242	Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid	96.09
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	96.07
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	96.03
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	96.01
4b79_A		242	PA4098, probable short-chain dehydrogenase; oxidor	96.0
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	95.93
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	95.9
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	95.84
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	95.81
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	95.77
3sxp_A		362	ADP-L-glycero-D-mannoheptose-6-epimerase; rossman	95.74
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	95.6
3d7l_A		202	LIN1944 protein; APC89317, structural genomics, PS	95.48
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	95.38
1zmt_A		254	Haloalcohol dehalogenase HHEC; halohydrin dehaloge	95.29
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	95.28
1fjh_A		257	3alpha-hydroxysteroid dehydrogenase/carbonyl reduc	95.26
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	95.12
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	95.04
3qp9_A		525	Type I polyketide synthase pikaii; rossmann fold,	95.02
2h7i_A		269	Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi	94.96
3u0b_A		454	Oxidoreductase, short chain dehydrogenase/reducta	94.95
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	94.91
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	94.9
1d7o_A		297	Enoyl-[acyl-carrier protein] reductase (NADH) PRE;	94.85
4e4y_A		244	Short chain dehydrogenase family protein; structur	94.84
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	94.83
4hp8_A		247	2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi	94.81
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	94.81
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	94.79
2ekp_A		239	2-deoxy-D-gluconate 3-dehydrogenase; structural ge	94.76
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	94.74
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	94.67
2ptg_A		319	Enoyl-acyl carrier reductase; apicomplexa, enoyl (	94.58
2o2s_A		315	Enoyl-acyl carrier reductase; enoyl reductase, tri	94.54
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	94.48
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	94.43
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	94.32
3lt0_A		329	Enoyl-ACP reductase; triclosan, triclosan variant,	94.3
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	94.26
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	94.23
3slg_A		372	PBGP3 protein; structural genomics, seattle struct	94.2
4egb_A		346	DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce	93.91
1xq6_A		253	Unknown protein; structural genomics, protein stru	93.82
2p4h_X		322	Vestitone reductase; NADPH-dependent reductase, is	93.82
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	93.82
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	93.81
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	93.74
2dkn_A		255	3-alpha-hydroxysteroid dehydrogenase; oxidoreducta	93.73
2et6_A		604	(3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox	93.71
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	93.69
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	93.68
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	93.67
3mje_A		496	AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.	93.66
2z5l_A		511	Tylkr1, tylactone synthase starter module and modu	93.56
2et6_A		604	(3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox	93.47
3vps_A		321	TUNA, NAD-dependent epimerase/dehydratase; tunicam	93.47
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	93.41
1rpn_A		335	GDP-mannose 4,6-dehydratase; short-chain dehydroge	93.41
1oaa_A		259	Sepiapterin reductase; tetrahydrobiopterin, oxidor	93.39
2fr1_A		486	Erythromycin synthase, eryai; short chain dehydrog	93.37
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	93.25
1oc2_A		348	DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos	93.24
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	93.23
1kew_A		361	RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo	93.16
3guy_A		230	Short-chain dehydrogenase/reductase SDR; structura	93.03
2c29_D		337	Dihydroflavonol 4-reductase; flavonoids, short deh	92.91
2uv8_A		1887	Fatty acid synthase subunit alpha (FAS2); fatty ac	92.81
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	92.65
3zen_D		3089	Fatty acid synthase; transferase, mycolic acid bio	92.65
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	92.6
2ydy_A		315	Methionine adenosyltransferase 2 subunit beta; oxi	92.53
1i24_A		404	Sulfolipid biosynthesis protein SQD1; SDR, short-c	92.51
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	92.48
3e9n_A		245	Putative short-chain dehydrogenase/reductase; stru	92.38
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	92.37
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	92.31
2uv9_A		1878	Fatty acid synthase alpha subunits; fungal, dehydr	92.27
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	92.27
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	92.04
1gy8_A		397	UDP-galactose 4-epimerase; oxidoreductase; HET: NA	92.02
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	92.02
1db3_A		372	GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya	91.96
1ek6_A		348	UDP-galactose 4-epimerase; short-chain dehydrogena	91.96
2a35_A		215	Hypothetical protein PA4017; alpha-beta-alpha sand	91.89
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	91.84
2b69_A		343	UDP-glucuronate decarboxylase 1; UDP-glucoronic ac	91.69
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	91.57
4eue_A		418	Putative reductase CA_C0462; TER, biofuel, synthet	91.57
2x6t_A		357	ADP-L-glycero-D-manno-heptose-6-epimerase; isomera	91.4
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	91.23
1orr_A		347	CDP-tyvelose-2-epimerase; rossmann fold, short-cha	91.21
1n7h_A		381	GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR,	91.18
1t2a_A		375	GDP-mannose 4,6 dehydratase; structural genomics c	91.06
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	91.04
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	90.96
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	90.91
2q1s_A		377	Putative nucleotide sugar epimerase/ dehydratase;	90.86
2hrz_A		342	AGR_C_4963P, nucleoside-diphosphate-sugar epimeras	90.64
3oh8_A		516	Nucleoside-diphosphate sugar epimerase (SULA FAMI;	90.47
1vl0_A		292	DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s	90.4
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	90.37
2bll_A		345	Protein YFBG; decarboxylase, short chain dehydroge	90.35
3s8m_A		422	Enoyl-ACP reductase; rossmann fold, oxidoreductase	90.32
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	90.23
3zu3_A		405	Putative reductase YPO4104/Y4119/YP_4011; oxidored	90.1
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	90.06
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	89.86
1udb_A		338	Epimerase, UDP-galactose-4-epimerase; isomerase; H	89.8
4ggo_A		401	Trans-2-enoyl-COA reductase; rossmann fold, oxidor	89.73
2yut_A		207	Putative short-chain oxidoreductase; alpha and bet	89.66
1e6u_A		321	GDP-fucose synthetase; epimerase/reductase, SDR, R	89.54
1jtv_A		327	17 beta-hydroxysteroid dehydrogenase type 1; stero	89.5
2p5y_A		311	UDP-glucose 4-epimerase; TTHA0591, structural geno	89.5
2yy7_A		312	L-threonine dehydrogenase; thermolabIle, flavobact	89.47
3nzo_A		399	UDP-N-acetylglucosamine 4,6-dehydratase; structura	89.38
1xgk_A		352	Nitrogen metabolite repression regulator NMRA; ros	89.33
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	89.26
2v6g_A		364	Progesterone 5-beta-reductase; tyrosine-dependent	88.3
2hun_A		336	336AA long hypothetical DTDP-glucose 4,6-dehydrat;	88.25
4f6c_A		427	AUSA reductase domain protein; thioester reductase	88.08
3ay3_A		267	NAD-dependent epimerase/dehydratase; glucuronic ac	87.82
1z45_A		699	GAL10 bifunctional protein; epimerase, mutarotase,	87.81
2vz8_A		2512	Fatty acid synthase; transferase, phosphopantethei	87.78
4dqv_A		478	Probable peptide synthetase NRP (peptide synthase;	87.18
2jl1_A		287	Triphenylmethane reductase; oxidoreductase, biorem	86.93
1eq2_A		310	ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin	86.92
3slk_A		795	Polyketide synthase extender module 2; rossmann fo	86.91
2ggs_A		273	273AA long hypothetical DTDP-4-dehydrorhamnose red	86.82
1n2s_A		299	DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold	85.64
3gxh_A		157	Putative phosphatase (DUF442); YP_001181608.1, str	85.03
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	84.03
1z7e_A		660	Protein aRNA; rossmann fold, OB-like fold, hydrola	82.57
1r6d_A		337	TDP-glucose-4,6-dehydratase; rossmann fold, short-	82.51
3ado_A		319	Lambda-crystallin; L-gulonate 3-dehydrogenase, str	82.36
2pff_A		1688	Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl	80.38

>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1	Back alignment and structure

Probab=100.00  E-value=3.8e-59  Score=422.53  Aligned_cols=212  Identities=35%  Similarity=0.520  Sum_probs=163.6

Q ss_pred             hhHHhhhccCCCCCCHHHHHHHHHHHHhhCCCCCCCCce-EEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCC
Q 027330            7 SEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRV-ACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMG   85 (225)
Q Consensus         7 ~~~~~ff~~~~~~~~~~~i~~~l~~f~~~~~~~~~~~~~-vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G   85 (225)
                      ..| +||++.|+|+++++|.+.+++|+.++.   +.|++ ||||||||+||||++|||||||||||+||++|||+|+++|
T Consensus         4 ~~~-~ff~~~p~p~~~~~i~~~i~~~~~~~~---l~gk~~VLITaGgT~EpID~DpVRfItN~SSGkmG~aiAe~~~~~G   79 (313)
T 1p9o_A            4 AEM-DPVAEFPQPPGAARWAEVMARFAARLG---AQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAG   79 (313)
T ss_dssp             -----------------CHHHHHHHHHHHHH---HTTCCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTT
T ss_pred             hHH-HHHhcCCCcccHHHHHHHHHHHhhhhh---hcCCeEEEEeCCCcccccCCCceeEecCCCCcHHHHHHHHHHHHCC
Confidence            466 999999999999999999999997652   36777 9999999999998889999999999999999999999999


Q ss_pred             CEEEEEeecCCCCCCccCCCCcccchhhhccc---CC--ceEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHH
Q 027330           86 YAVIFLYRRGTCEPYCSSLPDDAFLECFEVTE---ES--AVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQ  160 (225)
Q Consensus        86 ~~Vi~l~r~~s~~P~~~~l~~~~~~~~l~~~~---~~--~i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~  160 (225)
                      |+|+||||++++.||.|+++..++++.|+..+   ++  .+.+...++++|.++++.|++++++++|+.++|+|+.||++
T Consensus        80 a~V~lv~g~~sl~p~~r~~~~~~~~~~~~~~~~~~~~~~~i~v~v~sa~~m~~av~~~~~~~~~~~l~~i~f~tv~eyl~  159 (313)
T 1p9o_A           80 YGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLH  159 (313)
T ss_dssp             CEEEEEEETTSCCTTGGGSCHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHH
T ss_pred             CEEEEEecCCCcCcchhccCccchhhhhccccccccccceeeeccccHHHHHHHHHHHhhhhccccceeeccccHHHHHH
Confidence            99999999999999998887555566665532   22  35666678999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCCcceEEEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhcccc
Q 027330          161 MLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRS  222 (225)
Q Consensus       161 ~L~~i~~~l~~~~~~~~~~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~~  222 (225)
                      .|+.++..++.++++|++|+||||||||+|++.+++|||||+++.++|+|++|||||+.++.
T Consensus       160 ~L~~~~~~l~~~~~~di~i~aAAVsDf~~p~~~~~~~KIkk~~~~l~L~L~~~PdIL~~l~~  221 (313)
T 1p9o_A          160 LLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVK  221 (313)
T ss_dssp             HHHHHHHHHGGGGGGEEEEECSBCCSEECC--------------CEEEECEECGGGGSCCGG
T ss_pred             HHHHhhHHhhccCCCCEEEECCchhhccCCcccccccccccCCCCceEEeecCchHHHHHHh
Confidence            99999999999999999999999999999988999999999766799999999999997753

PyMOL of 1p9o

>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae}	Back alignment and structure

>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A*	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius}	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV}	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A*	Back alignment and structure

>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp}	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile}	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A*	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A*	Back alignment and structure

>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens}	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A*	Back alignment and structure

>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0	Back alignment and structure

>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides}	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A*	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium}	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp}	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli}	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A*	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A*	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8}	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A*	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A*	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus}	Back alignment and structure

>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens}	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2	Back alignment and structure

>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori}	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua}	Back alignment and structure

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A*	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae}	Back alignment and structure

>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ...	Back alignment and structure

>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A*	Back alignment and structure

>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp}	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens}	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A	Back alignment and structure

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella}	Back alignment and structure

>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A*	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ...	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei}	Back alignment and structure

>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis}	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa}	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP}	Back alignment and structure

>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis}	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A*	Back alignment and structure

>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae}	Back alignment and structure

>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis}	Back alignment and structure

>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis}	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A*	Back alignment and structure

>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A*	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A*	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A*	Back alignment and structure

>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A*	Back alignment and structure

>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A*	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A*	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A	Back alignment and structure

>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A*	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A*	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A*	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A*	Back alignment and structure

>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A*	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A*	Back alignment and structure

>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A*	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2	Back alignment and structure

>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*	Back alignment and structure

>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A*	Back alignment and structure

>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens}	Back alignment and structure

>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum}	Back alignment and structure

>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A	Back alignment and structure

>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV}	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A*	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A*	Back alignment and structure

>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A	Back alignment and structure

>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus}	Back alignment and structure

>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A*	Back alignment and structure

>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ...	Back alignment and structure

>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A*	Back alignment and structure

>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris}	Back alignment and structure

>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A*	Back alignment and structure

>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus}	Back alignment and structure

>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens}	Back alignment and structure

>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2	Back alignment and structure

>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A*	Back alignment and structure

>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis}	Back alignment and structure

>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D	Back alignment and structure

>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa}	Back alignment and structure

>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii}	Back alignment and structure

>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A*	Back alignment and structure

>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A*	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1	Back alignment and structure

>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A*	Back alignment and structure

>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A*	Back alignment and structure

>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		225
d1p9oa_		290	c.72.3.1 (A:) Phosphopantothenoylcysteine syntheta	2e-38
d1u7za_		223	c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional	3e-09

>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 290	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  133 bits (334), Expect = 2e-38
 Identities = 72/178 (40%), Positives = 97/178 (54%), Gaps = 7/178 (3%)

Query: 25  ISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKM 84
            ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFSSG RGA S E  +  
Sbjct: 2   WAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAA 59

Query: 85  GYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEES-----AVQVCQPYSEAVKRAIRDHH 139
           GY V+FLYR  +  PY    P   +L     +  +     +++  +        A+R + 
Sbjct: 60  GYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQ 119

Query: 140 AAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTI 197
            A A G  L + FTT+ +YL +LQ  A +   LGP +MFYLAAAVSDFYVP   M   
Sbjct: 120 EAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEH 177

PyMOL of d1p9oa_

>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Length = 223	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		225
d1p9oa_		290	Phosphopantothenoylcysteine synthetase {Human (Hom	100.0
d1u7za_		223	Coenzyme A biosynthesis bifunctional protein CoaBC	100.0
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	97.5
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	97.45
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	97.44
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	97.37
d1geea_		261	Glucose dehydrogenase {Bacillus megaterium [TaxId:	97.32
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	97.32
d2pd4a1		274	Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2	97.32
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	97.31
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	97.29
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	97.29
d2c07a1		251	beta-keto acyl carrier protein reductase {Malaria	97.29
d1g0oa_		272	1,3,8-trihydroxynaphtalene reductase (THNR, naphto	97.26
d1iy8a_		258	Levodione reductase {Corynebacterium aquaticum [Ta	97.25
d1uzma1		237	beta-keto acyl carrier protein reductase {Mycobact	97.24
d1xq1a_		259	Tropinone reductase {Thale cress (Arabidopsis thal	97.23
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	97.21
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	97.2
d2gdza1		254	15-hydroxyprostaglandin dehydrogenase, PGDH {Human	97.19
d1vl8a_		251	Gluconate 5-dehydrogenase {Thermotoga maritima [Ta	97.17
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	97.13
d1h5qa_		260	Mannitol dehydrogenase {Mushroom (Agaricus bisporu	97.12
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	97.12
d2ew8a1		247	(s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb	97.1
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	97.07
d1gz6a_		302	(3R)-hydroxyacyl-CoA dehydrogenase domain of estra	97.06
d1x1ta1		260	D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas	97.06
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	97.05
d1spxa_		264	Glucose dehydrogenase (5l265) {Nematode (Caenorhab	97.04
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	97.03
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	97.0
d1ulua_		256	Enoyl-ACP reductase {Thermus thermophilus [TaxId:	96.99
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	96.98
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	96.98
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	96.98
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	96.94
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	96.85
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	96.84
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	96.82
d1qsga_		258	Enoyl-ACP reductase {Escherichia coli [TaxId: 562]	96.8
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	96.79
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	96.77
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	96.71
d1yxma1		297	Peroxisomal trans 2-enoyl CoA reductase {Human (Ho	96.68
d1n7ha_		339	GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop	96.49
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	96.42
d2o23a1		248	Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho	96.4
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	96.39
d2h7ma1		268	Enoyl-ACP reductase {Mycobacterium tuberculosis, T	96.38
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	96.25
d1wmaa1		275	Carbonyl reductase/20beta-hydroxysteroid dehydroge	96.19
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	96.1
d1xu9a_		269	11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom	96.04
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	95.85
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	95.79
d1ooea_		235	Dihydropteridin reductase (pteridine reductase) {N	95.77
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	95.67
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	95.59
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	95.45
d2bd0a1		240	Bacterial sepiapterin reductase {Chlorobium tepidu	95.36
d1d7oa_		297	Enoyl-ACP reductase {Oil seed rape (Brassica napus	95.35
d1ek6a_		346	Uridine diphosphogalactose-4-epimerase (UDP-galact	95.29
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	95.25
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	95.14
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	95.12
d1dhra_		236	Dihydropteridin reductase (pteridine reductase) {R	95.03
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	95.02
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	94.99
d1kewa_		361	dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus	94.83
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	94.78
d1uaya_		241	Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t	94.76
d1y1pa1		342	Aldehyde reductase II {Sporobolomyces salmonicolor	94.44
d1gy8a_		383	Uridine diphosphogalactose-4-epimerase (UDP-galact	94.4
d1i24a_		393	Sulfolipid biosynthesis protein SQD1 {Thale cress	94.31
d1z45a2		347	Uridine diphosphogalactose-4-epimerase (UDP-galact	94.11
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	93.91
d1t2aa_		347	GDP-mannose 4,6-dehydratase {Human (Homo sapiens)	93.89
d2fr1a1		259	Erythromycin synthase, eryAI, 1st ketoreductase mo	93.8
d1snya_		248	Carbonyl reductase sniffer {Fruit fly (Drosophila	93.66
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	93.65
d1oaaa_		259	Sepiapterin reductase {Mouse (Mus musculus) [TaxId	93.34
d1n2sa_		298	dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S	93.2
d1db3a_		357	GDP-mannose 4,6-dehydratase {Escherichia coli [Tax	93.12
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	92.76
d1uh5a_		329	Enoyl-ACP reductase {Malaria parasite (Plasmodium	92.75
d1f0ka_		351	Peptidoglycan biosynthesis glycosyltransferase Mur	92.66
d1iira_		401	UDP-glucosyltransferase GtfB {Amycolatopsis orient	92.59
d1pn3a_		391	TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi	92.52
d1e6ua_		315	GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (	92.32
d1sb8a_		341	UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo	92.04
d1orra_		338	CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId:	91.99
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	91.34
d1vl0a_		281	DTDP-4-dehydrorhamnose reductase RfbD {Clostridium	90.86
d1rrva_		401	TDP-vancosaminyltransferase GftD {Amycolatopsis or	90.63
d1e7wa_		284	Dihydropteridin reductase (pteridine reductase) {L	90.33
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	89.86
d1zmta1		252	Halohydrin dehalogenase HheC {Agrobacterium tumefa	89.83
d2blla1		342	Polymyxin resistance protein ArnA (PrmI) {Escheric	88.89
d1jtva_		285	Human estrogenic 17beta-hydroxysteroid dehydrogena	88.49
d1oc2a_		346	dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus	88.42
d1mxha_		266	Dihydropteridin reductase (pteridine reductase) {T	88.37
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	88.27
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	87.46
d1wdka3		186	Fatty oxidation complex alpha subunit, middle doma	87.24
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	87.1
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	86.6
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	86.05
d1f0ya2		192	Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum	84.9
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	84.65
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	83.68
d1bg6a2		184	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A	83.3
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	82.55
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	81.86
d1ks9a2		167	Ketopantoate reductase PanE {Escherichia coli [Tax	81.66
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	81.64
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	81.23
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	80.48
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	80.4
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	80.34
d3cuma2		162	Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru	80.14
d1i36a2		152	Conserved hypothetical protein MTH1747 {Archaeon M	80.02

>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.3e-50  Score=357.51  Aligned_cols=195  Identities=37%  Similarity=0.555  Sum_probs=158.0

Q ss_pred             HHHHHHHHHhhCCCCCCCCc-eEEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCCCEEEEEeecCCCCCCccC
Q 027330           25 ISQKLKEFIALNSSESGTRR-VACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSS  103 (225)
Q Consensus        25 i~~~l~~f~~~~~~~~~~~~-~vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G~~Vi~l~r~~s~~P~~~~  103 (225)
                      |.+.++.|+.+..   ..|+ +||||||||.||||+||||||+|+|||+||++||++|+.+||.|+||||++|+.||.++
T Consensus         2 ~~e~~~~f~~~~~---~~g~k~VLITaG~T~epID~~pVR~ItN~SSGk~G~alA~~~~~~Ga~V~li~g~~s~~P~~~~   78 (290)
T d1p9oa_           2 WAEVMARFAARLG---AQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHR   78 (290)
T ss_dssp             HHHHHHHHHHHHH---HTTCCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTTCEEEEEEETTSCCTTGGG
T ss_pred             HHHHHHHHHhhcc---ccCCcEEEEccCCcCcccCCCCceEeCCCCchHHHHHHHHHHHHcCCEEEEEecCCccCccccc
Confidence            6677888887653   2454 58999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCcccchhhhcc---cCCc--eEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHHHHHHHHHHhhccCCcceE
Q 027330          104 LPDDAFLECFEVT---EESA--VQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMF  178 (225)
Q Consensus       104 l~~~~~~~~l~~~---~~~~--i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~~L~~i~~~l~~~~~~~~~  178 (225)
                      ++...+++.+...   ..+.  +...++....+.+.++.|+++...+++++++|+|+.||+..|+.+++.++..+.+|++
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~T~~e~~~~l~~~~~~~~~~~~~d~~  158 (290)
T d1p9oa_          79 FPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMF  158 (290)
T ss_dssp             SCHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHHHHHHHHHHHGGGGGGEEE
T ss_pred             ccccchhhhccccccccccceeecchhhHHHHHHHHHHHhhhhcccCCceEEEEeeHHHHHHHHHHHHhhccccccchHH
Confidence            8755566655542   1222  3445556778899999999999999999999999999999999999999999999999


Q ss_pred             EEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhcccc
Q 027330          179 YLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRS  222 (225)
Q Consensus       179 ~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~~  222 (225)
                      |||||||||++|....+++||++.++.++|+|++|||||++++.
T Consensus       159 i~aAAVsDf~~~~~~~~k~Ki~s~~~~l~l~L~~~PdIL~~l~~  202 (290)
T d1p9oa_         159 YLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVK  202 (290)
T ss_dssp             EECSBCCSEECC--------------CEEEECEECGGGGSCCGG
T ss_pred             HHHhccchhhccchhhhhhcccccccchhhhhccChHHHHHHHH
Confidence            99999999999888888999998888899999999999998753

PyMOL of d1p9oa_

>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}	Back information, alignment and structure

>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}	Back information, alignment and structure

>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}	Back information, alignment and structure

>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure