Citrus Sinensis ID: 027330


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS
ccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccEEEEEccccccccHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccccccEEEHHHHHcccccccccccHHHHHccccccccEEEccHHHHHccccccc
cccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccHHHHccccccccEEEcHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHcccccHEEEEEHHHccccccHHHcccEEEEEccccccHHHHHHHHHHHccccccc
mdsplnseiesffdsapplndrAAISQKLKEFIALNSSESGTRRVACVtsggttvpleqRCVRYidnfssghrgaasTEHLIKMGYAVIFLYRrgtcepycsslpddafLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSsrslgpcsMFYLAAAVsdfyvpwksMVTIHESILHTCSSFVLLRLHFMLgkgrsfrs
MDSPLNSEIEsffdsapplNDRAAISQKLKEFIalnssesgtrrvacvtsggttvpleqrCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLgkgrsfrs
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS
*******************************FIAL******TRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLG*******
******S**ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYV**********************RLHFMLGKGRSF**
*********ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS
******SEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRSFRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q9LZM3309 Phosphopantothenate--cyst yes no 0.848 0.618 0.680 1e-75
Q8GXR5317 Phosphopantothenate--cyst yes no 0.844 0.599 0.675 6e-73
Q9HAB8311 Phosphopantothenate--cyst yes no 0.675 0.488 0.452 4e-31
Q9USK7316 Uncharacterized protein C yes no 0.8 0.569 0.4 7e-30
Q8VDG5311 Phosphopantothenate--cyst yes no 0.795 0.575 0.404 1e-26
P40506 365 Phosphopantothenate--cyst yes no 0.8 0.493 0.393 1e-25
>sp|Q9LZM3|PPCS2_ARATH Phosphopantothenate--cysteine ligase 2 OS=Arabidopsis thaliana GN=PPCS2 PE=2 SV=2 Back     alignment and function desciption
 Score =  283 bits (723), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (80%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRY 64
           +  EI SFF+S+PP  +   I + L EFI LNSS  G RR+ CVTSGGTTVPLEQRCVRY
Sbjct: 1   MEDEISSFFESSPPQKNMEEILENLNEFIKLNSSSQGGRRIVCVTSGGTTVPLEQRCVRY 60

Query: 65  IDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVC 124
           IDNFSSG+RGAASTE+ +K GYAVIFLYRRGTC+PYC SLPDD FLECFE ++++ +QV 
Sbjct: 61  IDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRSLPDDPFLECFEFSDKTNIQVH 120

Query: 125 QPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAV 184
             + EAVK A+ D   AVA G LLKLPF+TI+EYLQML++IA + + +GPCSMFYLAAAV
Sbjct: 121 TSHLEAVKMAVMDQQTAVAEGSLLKLPFSTIYEYLQMLRLIAEALKDVGPCSMFYLAAAV 180

Query: 185 SDFYVPWKSMV 195
           SDFYVPWKSM 
Sbjct: 181 SDFYVPWKSMT 191




Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 5
>sp|Q8GXR5|PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana GN=PPCS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens GN=PPCS PE=1 SV=2 Back     alignment and function description
>sp|Q9USK7|YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.18 PE=3 SV=1 Back     alignment and function description
>sp|Q8VDG5|PPCS_MOUSE Phosphopantothenate--cysteine ligase OS=Mus musculus GN=Ppcs PE=2 SV=1 Back     alignment and function description
>sp|P40506|PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
224063167 327 predicted protein [Populus trichocarpa] 0.915 0.629 0.679 5e-79
449458083 332 PREDICTED: phosphopantothenate--cysteine 0.844 0.572 0.704 3e-78
358248488320 uncharacterized protein LOC100777777 [Gl 0.888 0.625 0.665 9e-76
356515833 326 PREDICTED: phosphopantothenate--cysteine 0.848 0.585 0.685 2e-75
308191544309 RecName: Full=Phosphopantothenate--cyste 0.848 0.618 0.680 5e-74
302141894 363 unnamed protein product [Vitis vinifera] 0.857 0.531 0.683 2e-73
147766524 329 hypothetical protein VITISV_039485 [Viti 0.928 0.635 0.641 3e-73
357477655321 Phosphopantothenate-cysteine ligase [Med 0.848 0.595 0.670 3e-73
297844096317 predicted protein [Arabidopsis lyrata su 0.844 0.599 0.691 4e-73
359492425 329 PREDICTED: phosphopantothenate--cysteine 0.857 0.586 0.683 4e-73
>gi|224063167|ref|XP_002301023.1| predicted protein [Populus trichocarpa] gi|222842749|gb|EEE80296.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 146/215 (67%), Positives = 171/215 (79%), Gaps = 9/215 (4%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSS------ESGTRRVACVTSGGTTVPLE 58
           L++EIESFFDSAPPL DRA I +KLKEFI  NS+      +   RRV CVTSGGTTVPLE
Sbjct: 13  LDAEIESFFDSAPPLKDRAGIIKKLKEFIEYNSTPPVNAGKGSPRRVVCVTSGGTTVPLE 72

Query: 59  QRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEE 118
           QRCVRYIDNFSSGHRGA STE+ IK GYAVIFLYRRGT +PYC SLP+D  LECFE +++
Sbjct: 73  QRCVRYIDNFSSGHRGATSTEYFIKAGYAVIFLYRRGTFQPYCQSLPEDPLLECFECSDD 132

Query: 119 SAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMF 178
           S +QV QP++EAVKRA+ DHHAA+AGG LLKL FTTIFEYLQ+LQ IA+S + LG  ++F
Sbjct: 133 STIQVRQPHTEAVKRAVSDHHAAIAGGHLLKLSFTTIFEYLQILQSIAMSMKDLGSLAVF 192

Query: 179 YLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRL 213
           YLAAAVSDFYVPWKSM    E  + + S  + +RL
Sbjct: 193 YLAAAVSDFYVPWKSMA---EHKIQSASGPLDMRL 224




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449458083|ref|XP_004146777.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus] gi|449511568|ref|XP_004163992.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358248488|ref|NP_001239890.1| uncharacterized protein LOC100777777 [Glycine max] gi|255642574|gb|ACU21550.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356515833|ref|XP_003526602.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|308191544|sp|Q9LZM3.2|PPCS2_ARATH RecName: Full=Phosphopantothenate--cysteine ligase 2; AltName: Full=Phosphopantothenoylcysteine synthetase 2; Short=PPC synthetase 2 Back     alignment and taxonomy information
>gi|302141894|emb|CBI19097.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766524|emb|CAN76608.1| hypothetical protein VITISV_039485 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357477655|ref|XP_003609113.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] gi|355510168|gb|AES91310.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297844096|ref|XP_002889929.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335771|gb|EFH66188.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359492425|ref|XP_002284301.2| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2034690317 COAB "AT1G12350" [Arabidopsis 0.862 0.611 0.668 2.2e-66
UNIPROTKB|G5EH02 439 MGCH7_ch7g472 "Phosphopantothe 0.804 0.412 0.446 2e-33
MGI|MGI:1915237311 Ppcs "phosphopantothenoylcyste 0.737 0.533 0.436 2.7e-29
UNIPROTKB|Q9HAB8311 PPCS "Phosphopantothenate--cys 0.675 0.488 0.458 5.6e-29
POMBASE|SPCC4B3.18316 SPCC4B3.18 "phosphopantothenat 0.835 0.594 0.388 1.9e-28
ZFIN|ZDB-GENE-060512-104320 ppcs "phosphopantothenoylcyste 0.742 0.521 0.406 1.3e-27
SGD|S000001345 365 CAB2 "Probable phosphopantothe 0.813 0.501 0.394 1.2e-24
FB|FBgn0261285313 Ppcs "Phosphopantothenoylcyste 0.831 0.597 0.326 2.3e-23
DICTYBASE|DDB_G0282611 389 DDB_G0282611 "phosphopantothen 0.413 0.239 0.368 1.1e-19
GENEDB_PFALCIPARUM|PF11_0036 660 PF11_0036 "hypothetical protei 0.377 0.128 0.404 4.1e-10
TAIR|locus:2034690 COAB "AT1G12350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 675 (242.7 bits), Expect = 2.2e-66, P = 2.2e-66
 Identities = 131/196 (66%), Positives = 154/196 (78%)

Query:     5 LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSS-ESGTRRVACVTSGGTTVPLEQRCVR 63
             +  EI SFF+S+PPL ++  I   L +FI LNSS + G RR+ CVTSGGTTVPLEQRCVR
Sbjct:     8 VEDEISSFFESSPPLKNKEEIVANLNQFIELNSSCQGGMRRIVCVTSGGTTVPLEQRCVR 67

Query:    64 YIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQV 123
             YIDNFSSG+RGAASTE+ +K GYAVIFLYRRGTC+PYC  LPDD FLECFE  +   +QV
Sbjct:    68 YIDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRYLPDDPFLECFEFPDAKNIQV 127

Query:   124 CQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAA 183
                +S AVK A+ D  AAVA G LLKLPF+TI+EYLQML++IA   + +GPCSMFYLAAA
Sbjct:   128 HGSHSGAVKMAVMDQQAAVAEGRLLKLPFSTIYEYLQMLRLIATILKDVGPCSMFYLAAA 187

Query:   184 VSDFYVPWKSMVTIHE 199
             VSDFYVPW SM T H+
Sbjct:   188 VSDFYVPWLSM-TEHK 202




GO:0003824 "catalytic activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016020 "membrane" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0004632 "phosphopantothenate--cysteine ligase activity" evidence=IDA
GO:0015937 "coenzyme A biosynthetic process" evidence=IDA
UNIPROTKB|G5EH02 MGCH7_ch7g472 "Phosphopantothenate-cysteine ligase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:1915237 Ppcs "phosphopantothenoylcysteine synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HAB8 PPCS "Phosphopantothenate--cysteine ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPCC4B3.18 SPCC4B3.18 "phosphopantothenate-cysteine ligase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060512-104 ppcs "phosphopantothenoylcysteine synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000001345 CAB2 "Probable phosphopantothenoylcysteine synthetase (PPCS)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
FB|FBgn0261285 Ppcs "Phosphopantothenoylcysteine synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282611 DDB_G0282611 "phosphopantothenatecysteine ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0036 PF11_0036 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LZM3PPCS2_ARATH6, ., 3, ., 2, ., 50.68060.84880.6181yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.921
3rd Layer6.3.2.50.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam04127184 pfam04127, DFP, DNA / pantothenate metabolism flav 1e-06
PRK05579399 PRK05579, PRK05579, bifunctional phosphopantotheno 1e-06
PRK06732229 PRK06732, PRK06732, phosphopantothenate--cysteine 2e-05
TIGR02114227 TIGR02114, coaB_strep, phosphopantothenate--cystei 1e-04
>gnl|CDD|217913 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein Back     alignment and domain information
 Score = 47.0 bits (113), Expect = 1e-06
 Identities = 40/113 (35%), Positives = 49/113 (43%), Gaps = 35/113 (30%)

Query: 43  RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAV-IFLYRRGTCE--- 98
           ++V  +T+G T  P++   VRYI N SSG           KMGYA+     RRG  E   
Sbjct: 4   KKV-LITAGPTREPIDP--VRYITNRSSG-----------KMGYALAEAAARRG-AEVTL 48

Query: 99  ---PYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHH-----AAVA 143
              P   SLP    +E   V  ESA +      EAV  A  D       AAVA
Sbjct: 49  VSGP--VSLPPPPGVEVIRV--ESAEE----MLEAVLEAFPDADIIIMAAAVA 93


The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism. Length = 184

>gnl|CDD|235513 PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>gnl|CDD|235856 PRK06732, PRK06732, phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>gnl|CDD|131169 TIGR02114, coaB_strep, phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG2728302 consensus Uncharacterized conserved protein with s 100.0
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 100.0
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 100.0
PRK09620229 hypothetical protein; Provisional 100.0
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 99.97
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 99.97
PRK06732229 phosphopantothenate--cysteine ligase; Validated 99.96
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 99.95
COG0452392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 99.93
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 96.8
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 96.67
PRK06114254 short chain dehydrogenase; Provisional 96.67
PRK08589 272 short chain dehydrogenase; Validated 96.62
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.61
PRK07478254 short chain dehydrogenase; Provisional 96.61
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 96.6
PRK06841255 short chain dehydrogenase; Provisional 96.57
PRK07856252 short chain dehydrogenase; Provisional 96.56
PRK08936261 glucose-1-dehydrogenase; Provisional 96.54
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.52
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.5
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 96.48
PRK07791 286 short chain dehydrogenase; Provisional 96.47
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 96.47
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 96.45
PRK06523260 short chain dehydrogenase; Provisional 96.44
PRK06128300 oxidoreductase; Provisional 96.41
PRK07035252 short chain dehydrogenase; Provisional 96.4
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.37
PRK08628258 short chain dehydrogenase; Provisional 96.37
PRK07062265 short chain dehydrogenase; Provisional 96.36
PRK06179 270 short chain dehydrogenase; Provisional 96.35
PRK07097265 gluconate 5-dehydrogenase; Provisional 96.32
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.28
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 96.28
PRK12937245 short chain dehydrogenase; Provisional 96.27
PRK05867253 short chain dehydrogenase; Provisional 96.27
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 96.22
PRK06398258 aldose dehydrogenase; Validated 96.21
PRK07985294 oxidoreductase; Provisional 96.2
PRK07109 334 short chain dehydrogenase; Provisional 96.18
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.17
PRK06138252 short chain dehydrogenase; Provisional 96.16
PRK08226263 short chain dehydrogenase; Provisional 96.15
PRK05717255 oxidoreductase; Validated 96.14
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.12
PRK07774250 short chain dehydrogenase; Provisional 96.12
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 96.11
PRK07063260 short chain dehydrogenase; Provisional 96.11
PRK06196 315 oxidoreductase; Provisional 96.09
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 96.09
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.06
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 96.06
PRK08265261 short chain dehydrogenase; Provisional 96.04
PRK07814263 short chain dehydrogenase; Provisional 96.04
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 96.03
PRK08277 278 D-mannonate oxidoreductase; Provisional 96.02
PRK12744257 short chain dehydrogenase; Provisional 95.99
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.99
PRK12938246 acetyacetyl-CoA reductase; Provisional 95.97
PRK08643256 acetoin reductase; Validated 95.96
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.94
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 95.93
PLN02253280 xanthoxin dehydrogenase 95.9
PRK05876 275 short chain dehydrogenase; Provisional 95.88
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.88
PRK05866293 short chain dehydrogenase; Provisional 95.88
PRK08278 273 short chain dehydrogenase; Provisional 95.88
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.88
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 95.87
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.86
PRK05854 313 short chain dehydrogenase; Provisional 95.86
PRK06194 287 hypothetical protein; Provisional 95.85
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 95.84
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.82
PRK06500249 short chain dehydrogenase; Provisional 95.81
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.81
PRK12743256 oxidoreductase; Provisional 95.8
PRK12939250 short chain dehydrogenase; Provisional 95.76
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 95.75
PRK06197 306 short chain dehydrogenase; Provisional 95.74
PRK12746254 short chain dehydrogenase; Provisional 95.7
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.67
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.66
PRK12829264 short chain dehydrogenase; Provisional 95.66
PRK08303 305 short chain dehydrogenase; Provisional 95.64
PRK12827249 short chain dehydrogenase; Provisional 95.64
PRK05875 276 short chain dehydrogenase; Provisional 95.64
PRK07825 273 short chain dehydrogenase; Provisional 95.64
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.61
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.6
PRK06701290 short chain dehydrogenase; Provisional 95.6
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.53
PRK08862227 short chain dehydrogenase; Provisional 95.52
PRK07067257 sorbitol dehydrogenase; Provisional 95.51
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 95.5
PRK06139 330 short chain dehydrogenase; Provisional 95.48
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.47
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.46
PRK07806248 short chain dehydrogenase; Provisional 95.46
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.45
PRK09242257 tropinone reductase; Provisional 95.44
PRK09134258 short chain dehydrogenase; Provisional 95.38
PRK06484520 short chain dehydrogenase; Validated 95.34
PRK12747252 short chain dehydrogenase; Provisional 95.34
PRK07074257 short chain dehydrogenase; Provisional 95.29
PRK06484 520 short chain dehydrogenase; Validated 95.2
PRK09135249 pteridine reductase; Provisional 95.18
PRK07577234 short chain dehydrogenase; Provisional 95.15
PRK05872 296 short chain dehydrogenase; Provisional 95.14
PRK06172253 short chain dehydrogenase; Provisional 95.13
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 95.13
PRK06720169 hypothetical protein; Provisional 95.12
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.11
PRK06182 273 short chain dehydrogenase; Validated 95.1
PRK08251248 short chain dehydrogenase; Provisional 95.1
PRK06949258 short chain dehydrogenase; Provisional 95.09
PRK07890258 short chain dehydrogenase; Provisional 95.07
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.05
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.05
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.03
PRK07576264 short chain dehydrogenase; Provisional 94.93
PRK08264238 short chain dehydrogenase; Validated 94.87
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 94.77
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 94.74
PRK07024257 short chain dehydrogenase; Provisional 94.73
PRK06180 277 short chain dehydrogenase; Provisional 94.71
PRK07454241 short chain dehydrogenase; Provisional 94.7
PRK07453 322 protochlorophyllide oxidoreductase; Validated 94.69
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.66
PRK06123248 short chain dehydrogenase; Provisional 94.65
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.64
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.6
PRK07677252 short chain dehydrogenase; Provisional 94.57
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.48
PRK07326237 short chain dehydrogenase; Provisional 94.45
PRK06198260 short chain dehydrogenase; Provisional 94.44
PRK06181263 short chain dehydrogenase; Provisional 94.4
PRK06947248 glucose-1-dehydrogenase; Provisional 94.33
PRK07201 657 short chain dehydrogenase; Provisional 94.31
PRK06482 276 short chain dehydrogenase; Provisional 94.28
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 93.97
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.91
PRK05693 274 short chain dehydrogenase; Provisional 93.86
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 93.77
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.73
PRK06914 280 short chain dehydrogenase; Provisional 93.71
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.46
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 93.41
PRK09186256 flagellin modification protein A; Provisional 93.21
PRK05855 582 short chain dehydrogenase; Validated 92.95
PRK08339263 short chain dehydrogenase; Provisional 92.87
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 92.58
PRK07775274 short chain dehydrogenase; Provisional 92.52
PRK08340259 glucose-1-dehydrogenase; Provisional 92.5
PRK07102243 short chain dehydrogenase; Provisional 92.46
PRK12367245 short chain dehydrogenase; Provisional 92.45
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 92.41
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 92.41
PLN02583 297 cinnamoyl-CoA reductase 92.37
PRK09072263 short chain dehydrogenase; Provisional 92.22
PRK08703239 short chain dehydrogenase; Provisional 92.14
PRK12828239 short chain dehydrogenase; Provisional 92.13
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 92.13
PLN02653 340 GDP-mannose 4,6-dehydratase 92.08
PRK06483236 dihydromonapterin reductase; Provisional 92.02
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 91.97
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 91.84
PRK06057255 short chain dehydrogenase; Provisional 91.79
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 91.71
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 91.7
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.62
PLN02780 320 ketoreductase/ oxidoreductase 91.59
PRK07069251 short chain dehydrogenase; Validated 91.4
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.38
PRK06125259 short chain dehydrogenase; Provisional 91.35
PRK12742237 oxidoreductase; Provisional 91.17
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 91.12
PRK05993 277 short chain dehydrogenase; Provisional 91.0
PRK07831262 short chain dehydrogenase; Provisional 90.91
PRK08324681 short chain dehydrogenase; Validated 90.88
COG1028251 FabG Dehydrogenases with different specificities ( 90.86
PLN02686 367 cinnamoyl-CoA reductase 90.84
PRK07904253 short chain dehydrogenase; Provisional 90.82
PLN00198 338 anthocyanidin reductase; Provisional 90.8
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 90.68
COG0300265 DltE Short-chain dehydrogenases of various substra 90.63
KOG1205 282 consensus Predicted dehydrogenase [Secondary metab 90.45
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 90.34
PRK08177225 short chain dehydrogenase; Provisional 90.2
PLN00016 378 RNA-binding protein; Provisional 90.07
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 89.72
PRK05599246 hypothetical protein; Provisional 89.68
PLN02572 442 UDP-sulfoquinovose synthase 89.64
PRK05650 270 short chain dehydrogenase; Provisional 89.6
PRK08263 275 short chain dehydrogenase; Provisional 89.57
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 89.52
PRK09291257 short chain dehydrogenase; Provisional 89.5
PLN02896 353 cinnamyl-alcohol dehydrogenase 89.48
TIGR02415254 23BDH acetoin reductases. One member of this famil 89.37
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 89.32
PLN02240 352 UDP-glucose 4-epimerase 89.3
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 89.29
PRK07832 272 short chain dehydrogenase; Provisional 89.28
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 89.18
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 89.15
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 89.11
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 89.04
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 89.03
smart00822180 PKS_KR This enzymatic domain is part of bacterial 89.02
PLN02650 351 dihydroflavonol-4-reductase 88.91
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 88.83
PLN02214 342 cinnamoyl-CoA reductase 88.66
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 88.65
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 88.61
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 88.6
PLN03209 576 translocon at the inner envelope of chloroplast su 88.47
PRK07424406 bifunctional sterol desaturase/short chain dehydro 88.42
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 87.79
PLN02695 370 GDP-D-mannose-3',5'-epimerase 87.36
PRK07060245 short chain dehydrogenase; Provisional 87.35
PRK12824245 acetoacetyl-CoA reductase; Provisional 87.26
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 87.1
PLN02206 442 UDP-glucuronate decarboxylase 86.72
COG2910211 Putative NADH-flavin reductase [General function p 86.25
PRK08267260 short chain dehydrogenase; Provisional 86.23
KOG0725270 consensus Reductases with broad range of substrate 86.0
PLN02778 298 3,5-epimerase/4-reductase 85.95
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 84.53
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 84.34
PRK06924251 short chain dehydrogenase; Provisional 84.12
PLN00015 308 protochlorophyllide reductase 83.72
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 83.51
PLN02166 436 dTDP-glucose 4,6-dehydratase 83.0
PLN02427 386 UDP-apiose/xylose synthase 82.78
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 82.77
PRK07041230 short chain dehydrogenase; Provisional 82.65
PRK06101240 short chain dehydrogenase; Provisional 82.65
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 82.61
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 82.57
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 82.31
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 81.31
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 80.86
>KOG2728 consensus Uncharacterized conserved protein with similarity to phosphopantothenoylcysteine synthetase/decarboxylase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=3.6e-60  Score=414.04  Aligned_cols=209  Identities=39%  Similarity=0.553  Sum_probs=186.9

Q ss_pred             hhccCCCCCCHHHHHHHHHHHHhhCCCCCCCCceEEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCCCEEEEE
Q 027330           12 FFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFL   91 (225)
Q Consensus        12 ff~~~~~~~~~~~i~~~l~~f~~~~~~~~~~~~~vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G~~Vi~l   91 (225)
                      ||+.+|+|+++++....+++|+.++... +.+++|+||||||+||||+|+||||||||+|+||+++||+|++.||+|||+
T Consensus         1 ~~~~~p~p~~~~d~~s~~~eFi~~q~s~-~~rrIVlVTSGGTtVPLE~ntVRFiDNFSaGtRGAaSAE~Fl~agYaVIFl   79 (302)
T KOG2728|consen    1 FFEMNPVPESLDDPGSLIEEFIKLQASL-QGRRIVLVTSGGTTVPLEQNTVRFIDNFSAGTRGAASAEYFLAAGYAVIFL   79 (302)
T ss_pred             CCCcCCCcccccchhHHHHHHHHHHhhc-cCceEEEEecCCeEeecccCceEeeeccCcCCccchhHHHHHhCCceEEEE
Confidence            7999999999999999999999987542 356699999999999999999999999999999999999999999999999


Q ss_pred             eecCCCCCCccCCCCcccchhhhcccCCc---eEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHHHHHHHHHH
Q 027330           92 YRRGTCEPYCSSLPDDAFLECFEVTEESA---VQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVS  168 (225)
Q Consensus        92 ~r~~s~~P~~~~l~~~~~~~~l~~~~~~~---i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~~L~~i~~~  168 (225)
                      ||..|+.||+|++|.+.+..+++..+...   |...+...+.+.++++.|+..-..++|+.+||||+.|||++|++||++
T Consensus        80 ~R~~Sl~Py~R~f~~~~~~~~l~~~g~~~~~~i~~~e~~~~vf~~~~~~~k~~~k~~~lL~vpFtT~~~Yl~~L~aiae~  159 (302)
T KOG2728|consen   80 YRERSLFPYTRHFPGQTWFLFLRPSGSALSGLIEKEENALPVFAEALEKYKYAEKAGTLLYVPFTTLADYLWLLRAIAEA  159 (302)
T ss_pred             eeccccccccccCCCchhhhhhccCCcccccceecCchhhHHHHHHHHHHHHHHhhCcEEEEecchHHHHHHHHHHHHHH
Confidence            99999999999999888888888765321   333333344466677777776678999999999999999999999999


Q ss_pred             hhccCCcceEEEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhccc
Q 027330          169 SRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGR  221 (225)
Q Consensus       169 l~~~~~~~~~~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~  221 (225)
                      |++++++.|+|+||||||||||++.|++|||.|+++.+.|+|...||+|..+.
T Consensus       160 Ln~~~sramfYLAAAVSDFyVP~~~mpeHKIqSg~~~l~i~l~~VPK~L~~Lv  212 (302)
T KOG2728|consen  160 LNPLGSRAMFYLAAAVSDFYVPESEMPEHKIQSGSGPLQITLKPVPKMLSPLV  212 (302)
T ss_pred             hccccchHHHHHHHHhcccccChhhcchhhcccCCCCceEEeccchHHHHHHH
Confidence            99999999999999999999999999999999998999999999999998654



>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1p9o_A313 Crystal Structure Of Phosphopantothenoylcysteine Sy 5e-32
>pdb|1P9O|A Chain A, Crystal Structure Of Phosphopantothenoylcysteine Synthetase Length = 313 Back     alignment and structure

Iteration: 1

Score = 134 bits (336), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 71/157 (45%), Positives = 89/157 (56%), Gaps = 5/157 (3%) Query: 43 RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCS 102 RRV VTSGGT VPLE R VR++DNFSSG RGA S E + GY V+FLYR + PY Sbjct: 37 RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAH 96 Query: 103 SLPDDAFLECFEVTEESAVQVCQPYSE-----AVKRAIRDHHAAVAGGLLLKLPFTTIFE 157 P +L + + + +E A+R + A A G L + FTT+ + Sbjct: 97 RFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLAD 156 Query: 158 YLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSM 194 YL +LQ A + LGP +MFYLAAAVSDFYVP M Sbjct: 157 YLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEM 193

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 5e-51
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 7e-06
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 2e-04
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Length = 313 Back     alignment and structure
 Score =  166 bits (422), Expect = 5e-51
 Identities = 74/194 (38%), Positives = 98/194 (50%), Gaps = 7/194 (3%)

Query: 10  ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFS 69
                  P     A  ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFS
Sbjct: 6   MDPVAEFPQPPGAARWAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFS 63

Query: 70  SGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESA-----VQVC 124
           SG RGA S E  +  GY V+FLYR  +  PY    P   +L     +  +      ++  
Sbjct: 64  SGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAE 123

Query: 125 QPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAV 184
           +        A+R +  A A G  L + FTT+ +YL +LQ  A +   LGP +MFYLAAAV
Sbjct: 124 ENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAV 183

Query: 185 SDFYVPWKSMVTIH 198
           SDFYVP   M    
Sbjct: 184 SDFYVPVSEMPEHK 197


>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Length = 232 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Length = 226 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 100.0
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 100.0
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 99.97
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.69
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.6
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 97.52
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 97.51
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.47
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 97.46
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.41
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.41
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.33
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.29
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.25
3edm_A259 Short chain dehydrogenase; structural genomics, ox 97.22
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.22
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.19
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.19
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.19
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.17
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.14
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.14
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 97.13
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.13
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.12
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.11
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 97.1
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.1
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.09
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.09
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.08
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.08
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 97.07
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 97.07
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.06
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.05
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.05
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 97.04
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.04
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.02
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.02
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.01
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.01
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 97.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.99
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.99
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 96.99
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.99
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.98
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.97
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.97
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.96
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.96
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.96
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.95
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.95
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.94
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 96.94
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.93
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.92
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.92
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.91
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.91
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.91
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 96.91
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.91
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.9
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.9
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.89
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.89
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 96.88
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.88
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.87
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.86
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 96.86
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.86
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 96.86
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.85
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 96.85
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 96.84
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.84
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 96.84
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 96.83
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.81
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.81
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.8
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.79
3cxt_A291 Dehydrogenase with different specificities; rossma 96.77
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.77
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.76
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.76
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.76
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.75
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.75
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.75
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.74
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.74
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 96.74
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.74
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.73
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.73
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.73
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.72
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.7
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.7
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 96.7
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.68
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.67
1xkq_A 280 Short-chain reductase family member (5D234); parra 96.66
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.66
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.65
3rih_A293 Short chain dehydrogenase or reductase; structural 96.65
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.65
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.64
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.64
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.64
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.64
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 96.63
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 96.63
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 96.62
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.61
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.61
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 96.59
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 96.59
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.59
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.58
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.58
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.57
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.57
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.57
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.56
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.55
4eso_A255 Putative oxidoreductase; NADP, structural genomics 96.55
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.53
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.53
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.52
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.51
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.51
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.5
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.49
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.49
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 96.48
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.48
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.47
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.44
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.44
1xhl_A 297 Short-chain dehydrogenase/reductase family member 96.44
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.43
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.43
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.43
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.42
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.42
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.41
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.41
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.41
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 96.4
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.38
1spx_A 278 Short-chain reductase family member (5L265); paral 96.36
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 96.36
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.35
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.35
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.34
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.33
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.31
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.28
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.28
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 96.26
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 96.21
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 96.17
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.15
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.14
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 96.13
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.11
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.1
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 96.09
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.07
1ooe_A236 Dihydropteridine reductase; structural genomics, P 96.03
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 96.01
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.93
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.9
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 95.84
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.81
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 95.77
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.74
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.6
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.48
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.38
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.29
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.28
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 95.26
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 95.12
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.04
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 95.02
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 94.96
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 94.95
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 94.91
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.9
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 94.85
4e4y_A244 Short chain dehydrogenase family protein; structur 94.84
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 94.83
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 94.81
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.81
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 94.79
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 94.76
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 94.74
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.67
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 94.58
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 94.54
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 94.48
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 94.43
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 94.32
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 94.3
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 94.26
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 94.23
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.2
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 93.91
1xq6_A253 Unknown protein; structural genomics, protein stru 93.82
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 93.82
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 93.82
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.81
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.74
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 93.73
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 93.71
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 93.69
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 93.68
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.67
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 93.66
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 93.56
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 93.47
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 93.47
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 93.41
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 93.41
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 93.39
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 93.37
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.25
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 93.24
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.23
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.16
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 93.03
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 92.91
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 92.81
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 92.65
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 92.65
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 92.6
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 92.53
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 92.51
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 92.48
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 92.38
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 92.37
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 92.31
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 92.27
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 92.27
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 92.04
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 92.02
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 92.02
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 91.96
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 91.96
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 91.89
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 91.84
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 91.69
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 91.57
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 91.57
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 91.4
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 91.23
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 91.21
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 91.18
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 91.06
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 91.04
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.96
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 90.91
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 90.86
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 90.64
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 90.47
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 90.4
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 90.37
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 90.35
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 90.32
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 90.23
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 90.1
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 90.06
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 89.86
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 89.8
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 89.73
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 89.66
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 89.54
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 89.5
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 89.5
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 89.47
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 89.38
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 89.33
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 89.26
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 88.3
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 88.25
4f6c_A 427 AUSA reductase domain protein; thioester reductase 88.08
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 87.82
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 87.81
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 87.78
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 87.18
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 86.93
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 86.92
3slk_A795 Polyketide synthase extender module 2; rossmann fo 86.91
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 86.82
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 85.64
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 85.03
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 84.03
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 82.57
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 82.51
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 82.36
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 80.38
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
Probab=100.00  E-value=3.8e-59  Score=422.53  Aligned_cols=212  Identities=35%  Similarity=0.520  Sum_probs=163.6

Q ss_pred             hhHHhhhccCCCCCCHHHHHHHHHHHHhhCCCCCCCCce-EEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCC
Q 027330            7 SEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRV-ACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMG   85 (225)
Q Consensus         7 ~~~~~ff~~~~~~~~~~~i~~~l~~f~~~~~~~~~~~~~-vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G   85 (225)
                      ..| +||++.|+|+++++|.+.+++|+.++.   +.|++ ||||||||+||||++|||||||||||+||++|||+|+++|
T Consensus         4 ~~~-~ff~~~p~p~~~~~i~~~i~~~~~~~~---l~gk~~VLITaGgT~EpID~DpVRfItN~SSGkmG~aiAe~~~~~G   79 (313)
T 1p9o_A            4 AEM-DPVAEFPQPPGAARWAEVMARFAARLG---AQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAG   79 (313)
T ss_dssp             -----------------CHHHHHHHHHHHHH---HTTCCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTT
T ss_pred             hHH-HHHhcCCCcccHHHHHHHHHHHhhhhh---hcCCeEEEEeCCCcccccCCCceeEecCCCCcHHHHHHHHHHHHCC
Confidence            466 999999999999999999999997652   36777 9999999999998889999999999999999999999999


Q ss_pred             CEEEEEeecCCCCCCccCCCCcccchhhhccc---CC--ceEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHH
Q 027330           86 YAVIFLYRRGTCEPYCSSLPDDAFLECFEVTE---ES--AVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQ  160 (225)
Q Consensus        86 ~~Vi~l~r~~s~~P~~~~l~~~~~~~~l~~~~---~~--~i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~  160 (225)
                      |+|+||||++++.||.|+++..++++.|+..+   ++  .+.+...++++|.++++.|++++++++|+.++|+|+.||++
T Consensus        80 a~V~lv~g~~sl~p~~r~~~~~~~~~~~~~~~~~~~~~~~i~v~v~sa~~m~~av~~~~~~~~~~~l~~i~f~tv~eyl~  159 (313)
T 1p9o_A           80 YGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLH  159 (313)
T ss_dssp             CEEEEEEETTSCCTTGGGSCHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHH
T ss_pred             CEEEEEecCCCcCcchhccCccchhhhhccccccccccceeeeccccHHHHHHHHHHHhhhhccccceeeccccHHHHHH
Confidence            99999999999999998887555566665532   22  35666678999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhccCCcceEEEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhcccc
Q 027330          161 MLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRS  222 (225)
Q Consensus       161 ~L~~i~~~l~~~~~~~~~~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~~  222 (225)
                      .|+.++..++.++++|++|+||||||||+|++.+++|||||+++.++|+|++|||||+.++.
T Consensus       160 ~L~~~~~~l~~~~~~di~i~aAAVsDf~~p~~~~~~~KIkk~~~~l~L~L~~~PdIL~~l~~  221 (313)
T 1p9o_A          160 LLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVK  221 (313)
T ss_dssp             HHHHHHHHHGGGGGGEEEEECSBCCSEECC--------------CEEEECEECGGGGSCCGG
T ss_pred             HHHHhhHHhhccCCCCEEEECCchhhccCCcccccccccccCCCCceEEeecCchHHHHHHh
Confidence            99999999999999999999999999999988999999999766799999999999997753



>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1p9oa_290 c.72.3.1 (A:) Phosphopantothenoylcysteine syntheta 2e-38
d1u7za_223 c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional 3e-09
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  133 bits (334), Expect = 2e-38
 Identities = 72/178 (40%), Positives = 97/178 (54%), Gaps = 7/178 (3%)

Query: 25  ISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKM 84
            ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFSSG RGA S E  +  
Sbjct: 2   WAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAA 59

Query: 85  GYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEES-----AVQVCQPYSEAVKRAIRDHH 139
           GY V+FLYR  +  PY    P   +L     +  +     +++  +        A+R + 
Sbjct: 60  GYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQ 119

Query: 140 AAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMVTI 197
            A A G  L + FTT+ +YL +LQ  A +   LGP +MFYLAAAVSDFYVP   M   
Sbjct: 120 EAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEH 177


>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 100.0
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.5
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.45
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.44
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.37
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.32
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.32
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.32
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.31
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.29
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.29
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.29
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.26
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.25
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.24
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.23
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.21
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.2
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.19
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.17
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.13
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.12
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.12
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.1
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.07
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.06
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.06
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.05
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.04
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.03
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 97.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.99
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.98
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.98
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.98
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.94
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.85
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.84
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.82
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.8
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.79
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.77
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.71
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.68
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 96.49
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.42
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.4
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.39
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.38
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.25
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.19
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.1
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.04
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 95.85
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.79
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 95.77
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.67
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.59
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 95.45
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.36
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 95.35
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.29
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 95.25
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 95.14
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 95.12
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 95.03
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.02
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.99
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.83
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.78
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.76
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.44
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.4
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.31
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.11
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.91
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.89
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 93.8
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 93.66
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.65
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.34
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 93.2
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 93.12
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 92.76
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 92.75
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 92.66
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 92.59
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 92.52
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 92.32
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.04
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 91.99
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 91.34
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 90.86
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 90.63
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 90.33
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 89.86
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 89.83
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 88.89
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 88.49
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 88.42
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 88.37
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 88.27
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 87.46
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.24
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.1
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 86.6
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.05
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 84.9
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 83.68
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 83.3
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 82.55
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 81.86
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 81.66
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.64
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.23
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.48
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 80.4
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 80.34
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 80.14
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 80.02
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.3e-50  Score=357.51  Aligned_cols=195  Identities=37%  Similarity=0.555  Sum_probs=158.0

Q ss_pred             HHHHHHHHHhhCCCCCCCCc-eEEEecCceeeecCCCCeeEEecCccchhHHHHHHHHHHCCCEEEEEeecCCCCCCccC
Q 027330           25 ISQKLKEFIALNSSESGTRR-VACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSS  103 (225)
Q Consensus        25 i~~~l~~f~~~~~~~~~~~~-~vlITSGgT~epID~~~VRfI~NfSSG~~Ga~iAe~fl~~G~~Vi~l~r~~s~~P~~~~  103 (225)
                      |.+.++.|+.+..   ..|+ +||||||||.||||+||||||+|+|||+||++||++|+.+||.|+||||++|+.||.++
T Consensus         2 ~~e~~~~f~~~~~---~~g~k~VLITaG~T~epID~~pVR~ItN~SSGk~G~alA~~~~~~Ga~V~li~g~~s~~P~~~~   78 (290)
T d1p9oa_           2 WAEVMARFAARLG---AQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHR   78 (290)
T ss_dssp             HHHHHHHHHHHHH---HTTCCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTTCEEEEEEETTSCCTTGGG
T ss_pred             HHHHHHHHHhhcc---ccCCcEEEEccCCcCcccCCCCceEeCCCCchHHHHHHHHHHHHcCCEEEEEecCCccCccccc
Confidence            6677888887653   2454 58999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCcccchhhhcc---cCCc--eEeeCcchHHHHHHHHHHHHHhhcCcccccccccHHHHHHHHHHHHHHhhccCCcceE
Q 027330          104 LPDDAFLECFEVT---EESA--VQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMF  178 (225)
Q Consensus       104 l~~~~~~~~l~~~---~~~~--i~v~~~~~~~~~~a~~~~~~~~~~~~ll~i~F~t~~eYl~~L~~i~~~l~~~~~~~~~  178 (225)
                      ++...+++.+...   ..+.  +...++....+.+.++.|+++...+++++++|+|+.||+..|+.+++.++..+.+|++
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~T~~e~~~~l~~~~~~~~~~~~~d~~  158 (290)
T d1p9oa_          79 FPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMF  158 (290)
T ss_dssp             SCHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHHHHHHHHHHHGGGGGGEEE
T ss_pred             ccccchhhhccccccccccceeecchhhHHHHHHHHHHHhhhhcccCCceEEEEeeHHHHHHHHHHHHhhccccccchHH
Confidence            8755566655542   1222  3445556778899999999999999999999999999999999999999999999999


Q ss_pred             EEeecccCccCCCCCcCCCccccCCCceeEEEeeChhHhhcccc
Q 027330          179 YLAAAVSDFYVPWKSMVTIHESILHTCSSFVLLRLHFMLGKGRS  222 (225)
Q Consensus       179 ~lAAAVSDf~vp~~~~~e~KI~s~~~~~~l~L~~~p~il~~~~~  222 (225)
                      |||||||||++|....+++||++.++.++|+|++|||||++++.
T Consensus       159 i~aAAVsDf~~~~~~~~k~Ki~s~~~~l~l~L~~~PdIL~~l~~  202 (290)
T d1p9oa_         159 YLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVK  202 (290)
T ss_dssp             EECSBCCSEECC--------------CEEEECEECGGGGSCCGG
T ss_pred             HHHhccchhhccchhhhhhcccccccchhhhhccChHHHHHHHH
Confidence            99999999999888888999998888899999999999998753



>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure