Citrus Sinensis ID: 027404


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MLLRSASSPILRSCSFRSSPEPDLGMRIHTPRSISMSFSSSSIKRIPRTLSDGDLQQLHITKTKTLFNNPLIPRDLLVEEEEGGGGEDGQGEFSTYNETTPRLSGGLLLDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSAPDDW
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccc
mllrsasspilrscsfrsspepdlgmrihtprsismsfssssikriprtlsdgdlqqlHITKtktlfnnpliprdllveeeeggggedgqgefstynettprlsggllldhgcgggargnggflggggdgdsgkeseSMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRailakpgdgnvlsmygdliwinhkdapraksyfdravhsapddw
mllrsasspilrscsfrsspepdlgmrihtprsismsfssssIKRIPRTLSDGDLQQLHItktktlfnnpliPRDLLVEEEEGGGGEDGQGEFSTYNETTPRLSGGLLLDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRailakpgdgnvLSMYGDLIWINHKDAPRAKSYFdravhsapddw
MLLRSASSPILRSCSFRSSPEPDLGMRIHTPRsismsfssssiKRIPRTLSDGDLQQLHITKTKTLFNNPLIPRDLLVeeeeggggedgqgeFSTYNETTPRlsggllldhgcgggargnggflggggdgdsgKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSAPDDW
*********************************************************LHITKTKTLFNNPLI*********************************GLLLDHGCGGGAR*********************DVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDA******************
MLLRSASSP***************************************************************************************************LDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSAP*D*
***********RSCSFRSSPEPDLGMRIHTPRSISMSFSSSSIKRIPRTLSDGDLQQLHITKTKTLFNNPLIPRDLLVEE***********EFSTYNETTPRLSGGLLLDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSAPDDW
*****************************************************************************************************RLSGGLL*DHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRSASSPILRSCSFRSSPEPDLGMRIHTPRSISMSFSSSSIKRIPRTLSDGDLQQLHITKTKTLFNNPLIPRDLLVEEEEGGGGEDGQGEFSTYNETTPRLSGGLLLDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYFDRAVHSAPDDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
118486453304 unknown [Populus trichocarpa] 0.986 0.726 0.462 2e-41
449464638293 PREDICTED: uncharacterized protein LOC10 0.964 0.737 0.434 2e-37
449523397297 PREDICTED: uncharacterized protein LOC10 0.964 0.727 0.434 3e-37
255572539292 conserved hypothetical protein [Ricinus 0.950 0.729 0.407 2e-35
217073634292 unknown [Medicago truncatula] 0.964 0.739 0.434 4e-35
224089264251 predicted protein [Populus trichocarpa] 0.870 0.776 0.433 1e-34
225445531288 PREDICTED: uncharacterized protein LOC10 0.973 0.756 0.439 2e-34
357478127292 hypothetical protein MTR_4g114690 [Medic 0.964 0.739 0.430 2e-34
388492190292 unknown [Medicago truncatula] 0.964 0.739 0.430 3e-34
225442971306 PREDICTED: uncharacterized protein LOC10 0.995 0.728 0.444 9e-34
>gi|118486453|gb|ABK95066.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 143/253 (56%), Gaps = 32/253 (12%)

Query: 1   MLLRSASSPILRSC----SFRSSPEPDLGMRIHTPRSISMSFSSS------------SIK 44
           MLLRS+S+P L S     S   SPEP+   +I   R IS++ SSS            SIK
Sbjct: 1   MLLRSSSTPFLNSWIPPHSKEPSPEPESVHQIQKTRPISLTASSSSPFSSISSQDHDSIK 60

Query: 45  RIPRTLSDGDLQQLHITKTKT---LFNNPLIPRDLLVEEE----EGG-------GGEDGQ 90
           R+ R  S+ DL+ L + K K    + N   IP D  VEE+    EGG        GE G+
Sbjct: 61  RMTRAFSEADLRDLSVPKRKPSNGILNG--IPVDEEVEEKVSFWEGGLFFEGCEAGEKGE 118

Query: 91  GEFSTYNETTPRLSGGLLLDHGCGGGARGNGGFLGGGGDGDSGKESESMDVYYQEMIKAY 150
           G+            G       CGG  R + G  GG G  +S +  E+ D YYQ MI+A 
Sbjct: 119 GDNGVLEVLVTGGGGDGGGRKFCGGRGRSDFGDDGGSGSRESNEGIETTDAYYQTMIEAN 178

Query: 151 PEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAK 210
           P + L L NYA+FLKE+R DFVKAEEYCGRAILA P D +VLSMY DLIW +HKDA RA+
Sbjct: 179 PGNPLFLRNYARFLKEVRLDFVKAEEYCGRAILANPNDADVLSMYADLIWQSHKDASRAE 238

Query: 211 SYFDRAVHSAPDD 223
           SYF RAV +APDD
Sbjct: 239 SYFLRAVKAAPDD 251




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449464638|ref|XP_004150036.1| PREDICTED: uncharacterized protein LOC101218093 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449523397|ref|XP_004168710.1| PREDICTED: uncharacterized protein LOC101231631 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255572539|ref|XP_002527204.1| conserved hypothetical protein [Ricinus communis] gi|223533469|gb|EEF35217.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|217073634|gb|ACJ85177.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224089264|ref|XP_002308666.1| predicted protein [Populus trichocarpa] gi|222854642|gb|EEE92189.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445531|ref|XP_002285275.1| PREDICTED: uncharacterized protein LOC100257716 [Vitis vinifera] gi|297738966|emb|CBI28211.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478127|ref|XP_003609349.1| hypothetical protein MTR_4g114690 [Medicago truncatula] gi|355510404|gb|AES91546.1| hypothetical protein MTR_4g114690 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388492190|gb|AFK34161.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225442971|ref|XP_002267739.1| PREDICTED: uncharacterized protein LOC100243938 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
TAIR|locus:2149314290 AT5G20190 "AT5G20190" [Arabido 0.388 0.3 0.586 1.3e-34
TAIR|locus:2127781238 AT4G32340 "AT4G32340" [Arabido 0.383 0.361 0.643 1.4e-31
TAIR|locus:2016229305 AT1G80130 [Arabidopsis thalian 0.401 0.295 0.544 1.6e-28
TAIR|locus:2141030274 AT4G17940 "AT4G17940" [Arabido 0.366 0.299 0.548 1.3e-20
TAIR|locus:2197768 310 TPR4 "tetratricopeptide repeat 0.361 0.261 0.475 2.2e-15
TAIR|locus:2025067552 AT1G07280 "AT1G07280" [Arabido 0.379 0.153 0.366 3.1e-08
TAIR|locus:2060669536 AT2G29670 [Arabidopsis thalian 0.366 0.152 0.341 1.7e-07
TAIR|locus:2149314 AT5G20190 "AT5G20190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 1.3e-34, Sum P(3) = 1.3e-34
 Identities = 51/87 (58%), Positives = 73/87 (83%)

Query:   137 ESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYG 196
             ++ DV+Y++MI+A P + + L+NYAKFLKE+R D++KAEEYCGRAIL  P DGNVL+MY 
Sbjct:   154 DNTDVHYRKMIEANPGNGIFLSNYAKFLKEVRKDYLKAEEYCGRAILVSPNDGNVLAMYA 213

Query:   197 DLIWINHKDAPRAKSYFDRAVHSAPDD 223
             +L+W  HKD+ RA++YF++AV +AP+D
Sbjct:   214 ELVWKIHKDSSRAENYFNQAVAAAPED 240


GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2127781 AT4G32340 "AT4G32340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016229 AT1G80130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141030 AT4G17940 "AT4G17940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197768 TPR4 "tetratricopeptide repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025067 AT1G07280 "AT1G07280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060669 AT2G29670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00016915001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (274 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-04
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 46.2 bits (110), Expect = 5e-07
 Identities = 16/81 (19%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 142 YYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWI 201
           YY++ ++  P++A    N A    +  G + +A E   +A+   P +       G   + 
Sbjct: 22  YYEKALELDPDNADAYYNLAAAYYK-LGKYEEALEDYEKALELDPDNAKAYYNLGLAYYK 80

Query: 202 NHKDAPRAKSYFDRAVHSAPD 222
             K    A   +++A+   P+
Sbjct: 81  LGKY-EEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
PRK15359144 type III secretion system chaperone protein SscB; 99.54
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.37
PRK11189 296 lipoprotein NlpI; Provisional 99.36
KOG0553 304 consensus TPR repeat-containing protein [General f 99.36
PRK10370198 formate-dependent nitrite reductase complex subuni 99.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.33
PRK10370198 formate-dependent nitrite reductase complex subuni 99.32
PRK12370 553 invasion protein regulator; Provisional 99.29
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.28
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.27
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.24
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.23
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.23
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.21
PRK15359144 type III secretion system chaperone protein SscB; 99.2
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.15
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.14
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.13
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.12
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.09
KOG1126 638 consensus DNA-binding cell division cycle control 99.09
PRK12370 553 invasion protein regulator; Provisional 99.08
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 99.06
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.05
KOG1126638 consensus DNA-binding cell division cycle control 99.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.03
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.01
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.99
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.97
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.96
PRK11189296 lipoprotein NlpI; Provisional 98.94
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.94
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.93
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.92
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.92
KOG1125579 consensus TPR repeat-containing protein [General f 98.92
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.87
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.86
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.86
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 98.86
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.8
PRK11906458 transcriptional regulator; Provisional 98.8
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.79
PF1337173 TPR_9: Tetratricopeptide repeat 98.78
PRK10803263 tol-pal system protein YbgF; Provisional 98.77
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.76
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.76
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.76
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.72
KOG1125579 consensus TPR repeat-containing protein [General f 98.69
PF1337173 TPR_9: Tetratricopeptide repeat 98.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.68
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.66
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.66
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.64
PRK15331165 chaperone protein SicA; Provisional 98.63
KOG0547 606 consensus Translocase of outer mitochondrial membr 98.61
PLN02789 320 farnesyltranstransferase 98.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.6
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
PRK11906458 transcriptional regulator; Provisional 98.59
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.58
PLN02789 320 farnesyltranstransferase 98.57
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.56
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.52
KOG2076 895 consensus RNA polymerase III transcription factor 98.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.52
PF12688120 TPR_5: Tetratrico peptide repeat 98.51
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.51
KOG0547606 consensus Translocase of outer mitochondrial membr 98.5
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.44
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.43
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.41
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.41
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.39
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.37
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.37
PRK14574 822 hmsH outer membrane protein; Provisional 98.36
PF1343134 TPR_17: Tetratricopeptide repeat 98.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.33
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.33
PF1342844 TPR_14: Tetratricopeptide repeat 98.31
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.23
KOG0553304 consensus TPR repeat-containing protein [General f 98.22
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.18
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.16
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.13
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.13
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.1
PRK14574 822 hmsH outer membrane protein; Provisional 98.1
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.1
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.09
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.08
KOG2003 840 consensus TPR repeat-containing protein [General f 98.07
PF1343134 TPR_17: Tetratricopeptide repeat 98.06
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.05
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.05
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.05
KOG1129478 consensus TPR repeat-containing protein [General f 98.04
KOG4234271 consensus TPR repeat-containing protein [General f 98.0
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.98
KOG3060 289 consensus Uncharacterized conserved protein [Funct 97.98
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.98
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.95
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.93
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.91
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.91
PF12688120 TPR_5: Tetratrico peptide repeat 97.9
PF13512142 TPR_18: Tetratricopeptide repeat 97.9
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.9
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.88
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.88
KOG4555175 consensus TPR repeat-containing protein [Function 97.86
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.85
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 97.85
PRK15331165 chaperone protein SicA; Provisional 97.83
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.82
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.82
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.82
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.78
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.78
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 97.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.77
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.77
PRK10803263 tol-pal system protein YbgF; Provisional 97.75
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.73
KOG1129478 consensus TPR repeat-containing protein [General f 97.72
KOG2076 895 consensus RNA polymerase III transcription factor 97.71
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.65
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.63
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.61
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.58
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.51
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 97.51
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.49
COG4700251 Uncharacterized protein conserved in bacteria cont 97.46
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.44
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.42
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.41
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.4
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.39
KOG2003 840 consensus TPR repeat-containing protein [General f 97.37
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.32
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.32
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.29
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.18
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.16
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.15
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.15
PF1342844 TPR_14: Tetratricopeptide repeat 97.14
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.11
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.11
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.08
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.0
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.98
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.98
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.98
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.98
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.91
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.9
PF13512142 TPR_18: Tetratricopeptide repeat 96.82
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.8
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.79
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.69
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.63
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 96.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.58
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 96.58
KOG4555175 consensus TPR repeat-containing protein [Function 96.5
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.5
COG4105 254 ComL DNA uptake lipoprotein [General function pred 96.5
PRK04841 903 transcriptional regulator MalT; Provisional 96.48
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.41
KOG4648 536 consensus Uncharacterized conserved protein, conta 96.36
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.27
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.25
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.22
KOG1310 758 consensus WD40 repeat protein [General function pr 96.2
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.18
KOG0495 913 consensus HAT repeat protein [RNA processing and m 96.18
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.14
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.1
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.09
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.07
PRK10941269 hypothetical protein; Provisional 96.05
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.05
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.03
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.0
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.97
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.93
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.9
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.88
PLN03077 857 Protein ECB2; Provisional 95.87
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.86
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.86
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.82
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.8
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.77
PRK04841 903 transcriptional regulator MalT; Provisional 95.64
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.63
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.58
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.56
PLN03077 857 Protein ECB2; Provisional 95.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.56
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.53
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.46
PLN03218 1060 maturation of RBCL 1; Provisional 95.38
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.26
COG4105 254 ComL DNA uptake lipoprotein [General function pred 95.22
PLN03218 1060 maturation of RBCL 1; Provisional 95.2
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.12
COG4700251 Uncharacterized protein conserved in bacteria cont 95.05
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.01
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.98
KOG4340 459 consensus Uncharacterized conserved protein [Funct 94.96
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.8
KOG3785 557 consensus Uncharacterized conserved protein [Funct 94.76
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.74
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.56
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 94.53
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.5
KOG4234271 consensus TPR repeat-containing protein [General f 94.33
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.32
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 94.29
KOG1585 308 consensus Protein required for fusion of vesicles 94.26
KOG1550 552 consensus Extracellular protein SEL-1 and related 94.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.22
PRK10941269 hypothetical protein; Provisional 94.17
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.13
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.11
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 94.03
KOG2047 835 consensus mRNA splicing factor [RNA processing and 93.99
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.98
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.92
KOG3785 557 consensus Uncharacterized conserved protein [Funct 93.86
KOG3364149 consensus Membrane protein involved in organellar 93.72
COG0790 292 FOG: TPR repeat, SEL1 subfamily [General function 93.63
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.58
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 93.5
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 93.17
COG4455 273 ImpE Protein of avirulence locus involved in tempe 93.12
KOG4340 459 consensus Uncharacterized conserved protein [Funct 93.06
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.98
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.74
KOG3364149 consensus Membrane protein involved in organellar 92.73
KOG1550 552 consensus Extracellular protein SEL-1 and related 92.7
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 92.49
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.39
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.38
KOG1586 288 consensus Protein required for fusion of vesicles 92.18
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.13
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.0
KOG1586288 consensus Protein required for fusion of vesicles 91.83
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.76
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.32
COG5191 435 Uncharacterized conserved protein, contains HAT (H 91.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 91.07
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.65
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 90.62
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.61
COG2912269 Uncharacterized conserved protein [Function unknow 90.52
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.38
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.38
KOG1258 577 consensus mRNA processing protein [RNA processing 90.16
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 89.98
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.64
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.54
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.52
KOG4014248 consensus Uncharacterized conserved protein (conta 89.32
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 88.89
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 88.78
KOG4507 886 consensus Uncharacterized conserved protein, conta 88.43
COG3898 531 Uncharacterized membrane-bound protein [Function u 88.36
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 88.2
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 87.26
KOG0529 421 consensus Protein geranylgeranyltransferase type I 87.2
KOG2471 696 consensus TPR repeat-containing protein [General f 86.98
COG3629280 DnrI DNA-binding transcriptional activator of the 86.88
KOG2047 835 consensus mRNA splicing factor [RNA processing and 86.52
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.95
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 85.94
KOG1258 577 consensus mRNA processing protein [RNA processing 85.89
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 85.65
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.91
TIGR0299642 rpt_mate_G_obs repeat-companion domain TIGR02996. 84.65
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.3
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.28
COG3118304 Thioredoxin domain-containing protein [Posttransla 84.03
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 83.73
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.3
COG2912269 Uncharacterized conserved protein [Function unknow 83.26
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 82.43
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 82.26
KOG2300 629 consensus Uncharacterized conserved protein [Funct 82.02
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.8
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 81.52
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 80.91
KOG4014 248 consensus Uncharacterized conserved protein (conta 80.73
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.36
COG3898 531 Uncharacterized membrane-bound protein [Function u 80.26
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
Probab=99.54  E-value=7.3e-14  Score=112.93  Aligned_cols=89  Identities=12%  Similarity=0.133  Sum_probs=84.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCChHHHHHH
Q 027404          133 GKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSY  212 (224)
Q Consensus       133 ~~d~e~A~~~yerALe~dP~na~~l~nlA~~l~e~~Gd~eeAe~~~erAL~ldP~da~al~~lG~ll~~~~gd~eeA~~~  212 (224)
                      .+++++|..+|++++..+|.++.+++++|.++. ..|++++|+.+|++|++++|+++.+++++|.++.. .|++++|+..
T Consensus        37 ~g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~-~~g~~~~A~~~y~~Al~l~p~~~~a~~~lg~~l~~-~g~~~eAi~~  114 (144)
T PRK15359         37 EGDYSRAVIDFSWLVMAQPWSWRAHIALAGTWM-MLKEYTTAINFYGHALMLDASHPEPVYQTGVCLKM-MGEPGLAREA  114 (144)
T ss_pred             cCCHHHHHHHHHHHHHcCCCcHHHHHHHHHHHH-HHhhHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHH-cCCHHHHHHH
Confidence            378999999999999999999999999999987 69999999999999999999999999999998865 6899999999


Q ss_pred             HHHHHHhCCCC
Q 027404          213 FDRAVHSAPDD  223 (224)
Q Consensus       213 ferAL~l~P~d  223 (224)
                      |++|++++|++
T Consensus       115 ~~~Al~~~p~~  125 (144)
T PRK15359        115 FQTAIKMSYAD  125 (144)
T ss_pred             HHHHHHhCCCC
Confidence            99999999986



>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02996 rpt_mate_G_obs repeat-companion domain TIGR02996 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 8e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 6e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-04
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 8e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-05
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-05
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 3e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-05
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-04
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
 Score = 51.3 bits (122), Expect = 5e-08
 Identities = 15/82 (18%), Positives = 22/82 (26%), Gaps = 1/82 (1%)

Query: 142 YYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWI 201
            +QEM        L+L   A      +G +  AE     A+    G    L     L   
Sbjct: 188 IFQEMADKCSPTLLLLNGQAACHMA-QGRWEAAEGVLQEALDKDSGHPETLINLVVLSQH 246

Query: 202 NHKDAPRAKSYFDRAVHSAPDD 223
             K       Y  +   +    
Sbjct: 247 LGKPPEVTNRYLSQLKDAHRSH 268


>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.62
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.62
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.61
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.61
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.59
3k9i_A117 BH0479 protein; putative protein binding protein, 99.56
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.55
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.54
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.53
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.5
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.49
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.49
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.49
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.48
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.47
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.46
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.44
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.44
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 99.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.42
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.42
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.4
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.39
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.39
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.38
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.37
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.37
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.35
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.35
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.31
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.31
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.29
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.28
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.28
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.28
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.28
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.27
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.27
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 99.26
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.25
3u4t_A272 TPR repeat-containing protein; structural genomics 99.24
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.24
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.23
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.23
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.22
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.22
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.22
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.22
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.21
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.21
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.2
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.2
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.2
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.2
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.2
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 99.2
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.2
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.19
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.19
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.18
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.18
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.17
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.16
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.16
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.15
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.15
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.14
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.13
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.12
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.12
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.1
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.09
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.07
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.07
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.99
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.98
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.97
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.94
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.92
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.92
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.92
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.9
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.87
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.86
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.86
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.86
3k9i_A117 BH0479 protein; putative protein binding protein, 98.85
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.85
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.85
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.84
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.84
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.82
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.82
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.82
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.81
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.8
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.8
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.78
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.78
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.78
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.77
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.77
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.77
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.76
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.74
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.73
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.72
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.71
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.7
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.68
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.67
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.67
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.66
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.63
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.61
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.58
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.51
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.51
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.5
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.49
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.48
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.48
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.47
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.4
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.39
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.36
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.32
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.3
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.22
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.12
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.09
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.09
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.08
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.91
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.9
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.76
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.73
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.65
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.59
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 97.56
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.52
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.41
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.4
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 97.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.25
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 97.23
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.18
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.09
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.05
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.94
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.79
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.76
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.74
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.73
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 96.57
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 96.14
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.95
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.83
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 94.92
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.44
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.22
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.91
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.68
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 93.2
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.87
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 92.28
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 89.74
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 89.38
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 88.99
2npm_A260 14-3-3 domain containing protein; cell regulator p 88.83
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 88.43
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 88.25
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 87.73
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.43
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 87.37
2o8p_A227 14-3-3 domain containing protein; signaling protei 85.53
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 85.39
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.6
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.31
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.71  E-value=1.7e-16  Score=121.81  Aligned_cols=89  Identities=18%  Similarity=0.218  Sum_probs=84.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCChHHHHHH
Q 027404          133 GKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSY  212 (224)
Q Consensus       133 ~~d~e~A~~~yerALe~dP~na~~l~nlA~~l~e~~Gd~eeAe~~~erAL~ldP~da~al~~lG~ll~~~~gd~eeA~~~  212 (224)
                      .+++++|+.+|++||+++|.++.+++++|.++. .+|++++|+.+|++||+++|+++.+|.++|.++.. .+++++|+.+
T Consensus        26 ~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~-~~~~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~-~~~~~~A~~~  103 (126)
T 4gco_A           26 KGDYPTAMRHYNEAVKRDPENAILYSNRAACLT-KLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVA-MREWSKAQRA  103 (126)
T ss_dssp             TTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH-HTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-TTCHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHH-hhccHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHH-CCCHHHHHHH
Confidence            379999999999999999999999999999987 69999999999999999999999999999998876 5799999999


Q ss_pred             HHHHHHhCCCC
Q 027404          213 FDRAVHSAPDD  223 (224)
Q Consensus       213 ferAL~l~P~d  223 (224)
                      |++|++++|++
T Consensus       104 ~~~al~l~P~~  114 (126)
T 4gco_A          104 YEDALQVDPSN  114 (126)
T ss_dssp             HHHHHHHCTTC
T ss_pred             HHHHHHHCcCC
Confidence            99999999986



>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.002
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: ImpE-like
superfamily: ImpE-like
family: ImpE-like
domain: Hypothetical protein VPA1032
species: Vibrio parahaemolyticus [TaxId: 670]
 Score = 46.6 bits (110), Expect = 6e-07
 Identities = 20/92 (21%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 133 GKESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVL 192
           G+  ++++    E IKA P+DA + +++ + L    GDF +A+E   ++I   P      
Sbjct: 10  GQLQQALE-LLIEAIKASPKDASLRSSFIELLCI-DGDFERADEQLMQSIKLFPEYLPGA 67

Query: 193 SMYGDLIWINHKDAPRAKSYFDRAVHSAPDDW 224
           S    L+         A+      V    ++ 
Sbjct: 68  SQLRHLVKAAQARKDFAQGAATAKVLGENEEL 99


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.65
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.63
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.57
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.56
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.55
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.39
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.39
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.38
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.37
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.35
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.33
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.3
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.29
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.24
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.11
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.05
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.05
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.05
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.04
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.0
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.99
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.82
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.77
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.76
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.73
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.61
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.54
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.53
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.51
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.5
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.34
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.32
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.31
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.22
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.1
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.09
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.0
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.93
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.79
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.66
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 91.68
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 90.62
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 90.11
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 84.3
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=7.1e-16  Score=115.90  Aligned_cols=88  Identities=19%  Similarity=0.233  Sum_probs=83.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCChHHHHHHH
Q 027404          134 KESESMDVYYQEMIKAYPEDALVLANYAKFLKEIRGDFVKAEEYCGRAILAKPGDGNVLSMYGDLIWINHKDAPRAKSYF  213 (224)
Q Consensus       134 ~d~e~A~~~yerALe~dP~na~~l~nlA~~l~e~~Gd~eeAe~~~erAL~ldP~da~al~~lG~ll~~~~gd~eeA~~~f  213 (224)
                      +++++|+.+|++||+.+|.++.+|.++|.++. .+|++++|+.+|++||.++|+++.+|.++|.++.. .+++++|+.+|
T Consensus        17 g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~-~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~~~-~~~~~~A~~~~   94 (117)
T d1elwa_          17 GNIDDALQCYSEAIKLDPHNHVLYSNRSAAYA-KKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEF-LNRFEEAKRTY   94 (117)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH-HHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-TTCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHhcCCcchhhhhccccccc-ccccccccchhhhhHHHhccchhhHHHHHHHHHHH-ccCHHHHHHHH
Confidence            79999999999999999999999999999987 69999999999999999999999999999998765 57999999999


Q ss_pred             HHHHHhCCCC
Q 027404          214 DRAVHSAPDD  223 (224)
Q Consensus       214 erAL~l~P~d  223 (224)
                      ++|++++|++
T Consensus        95 ~~a~~~~p~~  104 (117)
T d1elwa_          95 EEGLKHEANN  104 (117)
T ss_dssp             HHHHTTCTTC
T ss_pred             HHHHHhCCCC
Confidence            9999999986



>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure