Citrus Sinensis ID: 027451
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 223 | ||||||
| 225444283 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 1.0 | 0.784 | 2e-96 | |
| 255554819 | 218 | bcr-associated protein, bap, putative [R | 0.977 | 1.0 | 0.757 | 3e-90 | |
| 356532066 | 222 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.995 | 0.743 | 6e-90 | |
| 118487230 | 219 | unknown [Populus trichocarpa] | 0.982 | 1.0 | 0.753 | 2e-89 | |
| 351724959 | 222 | uncharacterized protein LOC100526943 [Gl | 0.991 | 0.995 | 0.734 | 3e-88 | |
| 255628483 | 225 | unknown [Glycine max] | 0.986 | 0.977 | 0.733 | 2e-87 | |
| 388518573 | 222 | unknown [Lotus japonicus] | 0.991 | 0.995 | 0.720 | 3e-87 | |
| 449433978 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 1.0 | 0.713 | 2e-86 | |
| 224117940 | 219 | predicted protein [Populus trichocarpa] | 0.982 | 1.0 | 0.713 | 7e-85 | |
| 224113707 | 207 | predicted protein [Populus trichocarpa] | 0.928 | 1.0 | 0.748 | 1e-83 |
| >gi|225444283|ref|XP_002262807.1| PREDICTED: uncharacterized protein LOC100265893 [Vitis vinifera] gi|302144107|emb|CBI23212.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 357 bits (916), Expect = 2e-96, Method: Compositional matrix adjust.
Identities = 175/223 (78%), Positives = 199/223 (89%), Gaps = 2/223 (0%)
Query: 1 MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV 60
M QLLFTV+F+EMA+IMVLLFKTPLRKL+IM LDRVKRGRGP++VKTVA TVLV+LISSV
Sbjct: 1 MIQLLFTVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSV 60
Query: 61 YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR 120
Y++M I+KR IDD+ VVNPTDQVL+A HLLE +LMG +LFLA MIDRLHHYIRELR+RR
Sbjct: 61 YSMMKIRKRGIDDD--VVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRR 118
Query: 121 KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV 180
K+MEAIK Q+RGFEDGK S EIKA+E++M L KLK LESE+ETK+KEA AAETNAV
Sbjct: 119 KSMEAIKKQNRGFEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAV 178
Query: 181 ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS 223
ALRKQSEGFL EYDRLLEENQNLRNQLQSLD RLSHSGSKK++
Sbjct: 179 ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRRLSHSGSKKNT 221
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255554819|ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis] gi|223542292|gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356532066|ref|XP_003534595.1| PREDICTED: uncharacterized protein LOC100500010 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118487230|gb|ABK95443.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351724959|ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max] gi|255631201|gb|ACU15966.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255628483|gb|ACU14586.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388518573|gb|AFK47348.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449433978|ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus] gi|449526061|ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224117940|ref|XP_002331516.1| predicted protein [Populus trichocarpa] gi|222873740|gb|EEF10871.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224113707|ref|XP_002316548.1| predicted protein [Populus trichocarpa] gi|222859613|gb|EEE97160.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 223 | ||||||
| TAIR|locus:1005716776 | 221 | AT1G11905 "AT1G11905" [Arabido | 0.991 | 1.0 | 0.457 | 3.1e-44 | |
| TAIR|locus:2152691 | 218 | AT5G42570 "AT5G42570" [Arabido | 0.860 | 0.880 | 0.494 | 3.1e-44 | |
| TAIR|locus:2152501 | 219 | AT5G48660 "AT5G48660" [Arabido | 0.860 | 0.876 | 0.336 | 1.3e-22 | |
| TAIR|locus:2098520 | 220 | AT3G07190 "AT3G07190" [Arabido | 0.860 | 0.872 | 0.326 | 3e-21 | |
| TAIR|locus:2092364 | 137 | AT3G20450 "AT3G20450" [Arabido | 0.587 | 0.956 | 0.398 | 1.2e-19 |
| TAIR|locus:1005716776 AT1G11905 "AT1G11905" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 466 (169.1 bits), Expect = 3.1e-44, P = 3.1e-44
Identities = 102/223 (45%), Positives = 132/223 (59%)
Query: 1 MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDXXXXXXXXXXXXXXXXXXXXMLISSV 60
MQQLLF V+ E+ +IM L FKTP+RKLLIMSLD +L++SV
Sbjct: 1 MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV 60
Query: 61 YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR 120
YN+M IQKRWI+D VVNPTD+V++A HLLE+TLMG LFL MIDRLHHY+RELRIRR
Sbjct: 61 YNMMGIQKRWIED--GVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR 118
Query: 121 KTMEAIKNQSRGFEDGKAASSEEIKALEDQMXXXXXXXXXXXXXXXXXXXXANAAETNAV 180
K ME IK + E KA +E+K L +++ +T+AV
Sbjct: 119 KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAV 178
Query: 181 ALRKQSEGFLFEYDXXXXXXXXXXXXXXSLDWRLSHSGSKKDS 223
AL+KQSEGFL E++ ++D +LS S SKK++
Sbjct: 179 ALQKQSEGFLIEFNRLLEENQVLRDQLHTVDSKLSRSSSKKNT 221
|
|
| TAIR|locus:2152691 AT5G42570 "AT5G42570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152501 AT5G48660 "AT5G48660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098520 AT3G07190 "AT3G07190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092364 AT3G20450 "AT3G20450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00012113001 | SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence (Chromosome undetermined scaffold_2984, whole genome shotgun sequence); (218 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 223 | |||
| pfam05529 | 149 | pfam05529, Bap31, B-cell receptor-associated prote | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-04 | |
| pfam11336 | 514 | pfam11336, DUF3138, Protein of unknown function (D | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 |
| >gnl|CDD|218624 pfam05529, Bap31, B-cell receptor-associated protein 31-like | Back alignment and domain information |
|---|
Score = 42.2 bits (100), Expect = 3e-05
Identities = 32/144 (22%), Positives = 67/144 (46%), Gaps = 16/144 (11%)
Query: 3 QLLFTVMFSEMA--LIMVLLFKTPLRKLLIMSLDRVKRGR-GPVVVKTVAGTVLVMLISS 59
L+F ++++EMA L++VL +P+R+ + S+ +++ + K + +LV+ I S
Sbjct: 6 TLVFGLLYAEMAVFLLLVLPLPSPIRRKIFKSVSKLQLSQQFQTGFKILLIFLLVLFIDS 65
Query: 60 VYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLM---------GASLFLAFMIDRLH 110
V + +G+ + + A L G +LFL +I R+
Sbjct: 66 VRRVYKYSGE---LQGSGNASLGGGERSEYQTLARLFYAQRNLYLSGFTLFLTLVIRRVV 122
Query: 111 HYIRELRIRRKTMEAIKNQSRGFE 134
+ EL ++ + +EA+K Q+ +
Sbjct: 123 TLVEEL-VKLEELEALKKQAENLQ 145
|
Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8. Bap31 is cleaved within its cytosolic domain, generating pro-apoptotic p20 Bap31. Length = 149 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|221084 pfam11336, DUF3138, Protein of unknown function (DUF3138) | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 100.0 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 100.0 | |
| COG5374 | 192 | Uncharacterized conserved protein [Function unknow | 100.0 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 98.8 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.67 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.48 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.3 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 96.28 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.32 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.24 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.01 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.56 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.55 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.43 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.24 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 93.37 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.24 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 92.85 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.85 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.68 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 92.65 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 92.64 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.96 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.64 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 91.62 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.34 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.24 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 91.05 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 91.0 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 90.89 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.75 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 90.74 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 90.72 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.49 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 90.4 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 89.92 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 89.84 | |
| COG3879 | 247 | Uncharacterized protein conserved in bacteria [Fun | 89.82 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 89.78 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 89.64 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 89.52 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 89.24 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 89.21 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 89.19 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.92 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.9 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.51 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 88.39 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 88.37 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 88.05 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 87.93 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 87.86 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 87.78 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 87.67 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 87.61 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 87.56 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 87.54 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 87.48 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 87.27 | |
| PF07407 | 420 | Seadorna_VP6: Seadornavirus VP6 protein; InterPro: | 87.14 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 86.94 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 86.86 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 86.85 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 86.79 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 86.68 | |
| PF03954 | 138 | Lectin_N: Hepatic lectin, N-terminal domain; Inter | 86.62 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 86.3 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 86.23 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 85.67 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 85.62 | |
| PF14584 | 151 | DUF4446: Protein of unknown function (DUF4446) | 85.54 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.51 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 85.35 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 85.3 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.84 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 84.63 | |
| PF07061 | 83 | Swi5: Swi5; InterPro: IPR010760 This entry represe | 84.62 | |
| PF04136 | 157 | Sec34: Sec34-like family ; InterPro: IPR007265 Sec | 84.49 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 84.47 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 84.26 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 84.12 | |
| PF15188 | 85 | CCDC-167: Coiled-coil domain-containing protein 16 | 84.05 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 83.81 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 83.78 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 83.63 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 83.58 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 83.57 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 83.55 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 83.44 | |
| PRK09039 | 343 | hypothetical protein; Validated | 83.07 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 82.86 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 82.76 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 82.48 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 82.48 | |
| PF13094 | 160 | CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub | 82.41 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 82.05 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 81.82 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 81.58 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 81.13 | |
| PF05615 | 139 | THOC7: Tho complex subunit 7; InterPro: IPR008501 | 81.12 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 81.08 | |
| PF11544 | 76 | Spc42p: Spindle pole body component Spc42p; InterP | 80.91 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 80.75 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 80.6 | |
| PF09403 | 126 | FadA: Adhesion protein FadA; InterPro: IPR018543 F | 80.39 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 80.39 | |
| PF04420 | 161 | CHD5: CHD5-like protein; InterPro: IPR007514 Membe | 80.16 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 80.04 |
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-47 Score=322.86 Aligned_cols=207 Identities=31% Similarity=0.421 Sum_probs=166.2
Q ss_pred ChHHHHHHHHHHHHHHHHHhcchh-HHHH-HHHHHHHHhhcc-hhHHHHHHHHHHHHHHHHhHHHHHHhhhhcccccCCC
Q 027451 1 MQQLLFTVMFSEMALIMVLLFKTP-LRKL-LIMSLDRVKRGR-GPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAV 77 (223)
Q Consensus 1 ~~~lvf~~L~~Em~~~llLvlPlP-~R~~-~~~~l~~~~~~r-~~~~~~~~~~~l~vlF~Dai~~~~k~~~~~~~~~~~~ 77 (223)
||++||++||+||+++++||+|+| .||. ++....+...++ +.+++.+++++++++|+|||+++++|...+.....++
T Consensus 1 ~~tlvf~iL~~Eial~~iL~Lpip~r~~~~~~~~~~~~~~~~~~~~~i~~~~~villlfiDsvr~i~~~~~~~~~~~n~~ 80 (216)
T KOG1962|consen 1 YWTLVFTILYAEIALFLILLLPIPPRRRRKIFKDRLKSGLAPQVLKTIATTMIVILLLFIDSVRRIQKYVSEYGSMANPT 80 (216)
T ss_pred CHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccCCc
Confidence 799999999999999999999997 4444 334444555555 8899999999999999999999999988753321233
Q ss_pred CCch--hHHHHHHHHHH--HHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccchHHHHHhHHHhHH
Q 027451 78 VNPT--DQVLLANHLLE--ATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMTT 153 (223)
Q Consensus 78 ~~~~--~~~~~r~~~~q--~YIsGF~LFL~lvI~R~~~li~~l~~~~~~~~al~kQa~~~~~~~~~~~~~~~~~~~~~~~ 153 (223)
++|. .+.++..|+.| .|||||+|||||||+|+|+++++++.++++ +.++++++.+.+..+..+ .+.+++++
T Consensus 81 ~~~~a~~~~~~~l~raqrn~YisGf~LFL~lvI~R~~~ll~~l~~l~~~-~~~~~~~~~lk~~~~~~~----~~~~~~~~ 155 (216)
T KOG1962|consen 81 DQPLARTHLLEALFRAQRNLYISGFVLFLSLVIRRLHTLLRELATLRAN-EKAMKENEALKKQLENSS----KLEEENDK 155 (216)
T ss_pred cchHHHHHHHHHHHHHHhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhh-HHHHHHHHHHHHhhhccc----chhhhHHH
Confidence 4443 56777766665 599999999999999999999999999996 555554444333211111 14556667
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHhhHHHHHHHHHHHHHHHHHhHhhhcc
Q 027451 154 LKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDW 212 (223)
Q Consensus 154 l~~e~~~Lk~el~~~~~el~~~~~d~~aLKkQae~l~~EYDrL~~e~~~l~~~l~~~~~ 212 (223)
..++.++|+.+++++++++++++++.++|+||++++++|||||++||++||++++.+..
T Consensus 156 ~~~~~~kL~~el~~~~~~Le~~~~~~~al~Kq~e~~~~EydrLlee~~~Lq~~i~~~~~ 214 (216)
T KOG1962|consen 156 LKADLEKLETELEKKQKKLEKAQKKVDALKKQSEGLQDEYDRLLEEYSKLQEQIESGGK 214 (216)
T ss_pred HHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHhccCC
Confidence 78899999999999999999999999999999999999999999999999999987653
|
|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >COG5374 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >COG3879 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF03954 Lectin_N: Hepatic lectin, N-terminal domain; InterPro: IPR005640 Animal lectins display a wide variety of architectures | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF14584 DUF4446: Protein of unknown function (DUF4446) | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07061 Swi5: Swi5; InterPro: IPR010760 This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [] | Back alignment and domain information |
|---|
| >PF04136 Sec34: Sec34-like family ; InterPro: IPR007265 Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF15188 CCDC-167: Coiled-coil domain-containing protein 167 | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 95.64 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 95.39 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.2 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.84 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.84 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.67 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 94.37 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.64 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 93.28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.53 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 92.34 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 92.27 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 92.2 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 92.09 | |
| 3cl3_D | 130 | NF-kappa-B essential modulator; death effector dom | 92.05 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 91.59 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.59 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 89.57 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 89.54 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 89.42 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 87.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 87.28 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 86.99 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 86.45 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 85.86 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 85.53 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 83.61 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 83.38 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 83.36 | |
| 3viq_B | 85 | Mating-type switching protein SWI5; recombination | 81.81 |
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
Probab=95.64 E-value=0.19 Score=35.53 Aligned_cols=59 Identities=20% Similarity=0.246 Sum_probs=50.4
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHhhHHHHHHHHHHHHHHHHHhHhhhccc
Q 027451 155 KLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWR 213 (223)
Q Consensus 155 ~~e~~~Lk~el~~~~~el~~~~~d~~aLKkQae~l~~EYDrL~~e~~~l~~~l~~~~~~ 213 (223)
....+.++.+++..++....++.++.+|++...+++.++|+..+.....+.+|...+.+
T Consensus 19 ~~~~~~~e~~l~~~e~~~~~~E~ev~~L~kKiq~lE~eld~~ee~l~~a~~kLeeaek~ 77 (81)
T 1ic2_A 19 LDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKYSESLKDAQEKLELADKK 77 (81)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGG
T ss_pred HHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34566777788888888888899999999999999999999999999999988876654
|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 223 | |||
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 80.32 |
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: tRNA-binding arm family: Seryl-tRNA synthetase (SerRS) domain: Seryl-tRNA synthetase (SerRS) species: Thermus thermophilus, strain hb27 [TaxId: 274]
Probab=80.32 E-value=6.8 Score=26.79 Aligned_cols=22 Identities=18% Similarity=0.329 Sum_probs=9.3
Q ss_pred HHHHHHHHHHHHHHHHHHHHHh
Q 027451 107 DRLHHYIRELRIRRKTMEAIKN 128 (223)
Q Consensus 107 ~R~~~li~~l~~~~~~~~al~k 128 (223)
..+..+-.+...++..++.++.
T Consensus 28 d~i~~ld~~rr~l~~~~e~l~~ 49 (110)
T d1seta1 28 EALLALDREVQELKKRLQEVQT 49 (110)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHH
Confidence 4444444444444444444433
|