Citrus Sinensis ID: 027451


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS
cHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLdrvkrgrgpvVVKTVAGTVLVMLISSVYNIMMIQKRwiddegavvnptDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNqsrgfedgkaaSSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWrlshsgskkds
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMsldrvkrgrgpvvvktvagTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEaiknqsrgfedgkaasSEEIKALEDQMTTLKLKLKDLESELETkskeanaaetnavALRKQSEGFLFEYDRLLEENQNLRNQlqsldwrlshsgskkds
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDrvkrgrgpvvvktvagtvlvMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMttlklklkdleseletkskeANAAETNAVALRKQSEGFLFEYDrlleenqnlrnqlqSLDWRLSHSGSKKDS
***LLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRK******************************************************************GFLFEYDRLLE*************************
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMM******************VLLANHLLEATLMGASLFLAFMIDRLHHYIRE*************************************************************************FLFEYDRLLEENQN*********************
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWR**********
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSL*************
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSEGFLFExxxxxxxxxxxxxxxxxxxxxLSHSGSKKDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
P51572246 B-cell receptor-associate no no 0.273 0.247 0.451 7e-05
Q5R8H3246 B-cell receptor-associate yes no 0.273 0.247 0.451 7e-05
Q61335245 B-cell receptor-associate yes no 0.233 0.212 0.480 0.0004
>sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens GN=BCAP31 PE=1 SV=3 Back     alignment and function desciption
 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (1%)

Query: 143 EIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQN 202
           E+K LE++  +LK  L+ L+ EL +  ++   AE   +A+RKQSEG   EYDRLLEE+  
Sbjct: 174 EVK-LEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAK 232

Query: 203 LR 204
           L+
Sbjct: 233 LQ 234




May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.
Homo sapiens (taxid: 9606)
>sp|Q5R8H3|BAP31_PONAB B-cell receptor-associated protein 31 OS=Pongo abelii GN=BCAP31 PE=2 SV=3 Back     alignment and function description
>sp|Q61335|BAP31_MOUSE B-cell receptor-associated protein 31 OS=Mus musculus GN=Bcap31 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
225444283221 PREDICTED: uncharacterized protein LOC10 0.991 1.0 0.784 2e-96
255554819218 bcr-associated protein, bap, putative [R 0.977 1.0 0.757 3e-90
356532066222 PREDICTED: uncharacterized protein LOC10 0.991 0.995 0.743 6e-90
118487230219 unknown [Populus trichocarpa] 0.982 1.0 0.753 2e-89
351724959222 uncharacterized protein LOC100526943 [Gl 0.991 0.995 0.734 3e-88
255628483225 unknown [Glycine max] 0.986 0.977 0.733 2e-87
388518573222 unknown [Lotus japonicus] 0.991 0.995 0.720 3e-87
449433978221 PREDICTED: uncharacterized protein LOC10 0.991 1.0 0.713 2e-86
224117940219 predicted protein [Populus trichocarpa] 0.982 1.0 0.713 7e-85
224113707207 predicted protein [Populus trichocarpa] 0.928 1.0 0.748 1e-83
>gi|225444283|ref|XP_002262807.1| PREDICTED: uncharacterized protein LOC100265893 [Vitis vinifera] gi|302144107|emb|CBI23212.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 199/223 (89%), Gaps = 2/223 (0%)

Query: 1   MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSV 60
           M QLLFTV+F+EMA+IMVLLFKTPLRKL+IM LDRVKRGRGP++VKTVA TVLV+LISSV
Sbjct: 1   MIQLLFTVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSV 60

Query: 61  YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR 120
           Y++M I+KR IDD+  VVNPTDQVL+A HLLE +LMG +LFLA MIDRLHHYIRELR+RR
Sbjct: 61  YSMMKIRKRGIDDD--VVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRR 118

Query: 121 KTMEAIKNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAV 180
           K+MEAIK Q+RGFEDGK   S EIKA+E++M  L  KLK LESE+ETK+KEA AAETNAV
Sbjct: 119 KSMEAIKKQNRGFEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAV 178

Query: 181 ALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKKDS 223
           ALRKQSEGFL EYDRLLEENQNLRNQLQSLD RLSHSGSKK++
Sbjct: 179 ALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRRLSHSGSKKNT 221




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255554819|ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis] gi|223542292|gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356532066|ref|XP_003534595.1| PREDICTED: uncharacterized protein LOC100500010 [Glycine max] Back     alignment and taxonomy information
>gi|118487230|gb|ABK95443.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351724959|ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max] gi|255631201|gb|ACU15966.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255628483|gb|ACU14586.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388518573|gb|AFK47348.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449433978|ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus] gi|449526061|ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224117940|ref|XP_002331516.1| predicted protein [Populus trichocarpa] gi|222873740|gb|EEF10871.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113707|ref|XP_002316548.1| predicted protein [Populus trichocarpa] gi|222859613|gb|EEE97160.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
TAIR|locus:1005716776221 AT1G11905 "AT1G11905" [Arabido 0.991 1.0 0.457 3.1e-44
TAIR|locus:2152691218 AT5G42570 "AT5G42570" [Arabido 0.860 0.880 0.494 3.1e-44
TAIR|locus:2152501219 AT5G48660 "AT5G48660" [Arabido 0.860 0.876 0.336 1.3e-22
TAIR|locus:2098520220 AT3G07190 "AT3G07190" [Arabido 0.860 0.872 0.326 3e-21
TAIR|locus:2092364137 AT3G20450 "AT3G20450" [Arabido 0.587 0.956 0.398 1.2e-19
TAIR|locus:1005716776 AT1G11905 "AT1G11905" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 466 (169.1 bits), Expect = 3.1e-44, P = 3.1e-44
 Identities = 102/223 (45%), Positives = 132/223 (59%)

Query:     1 MQQLLFTVMFSEMALIMVLLFKTPLRKLLIMSLDXXXXXXXXXXXXXXXXXXXXMLISSV 60
             MQQLLF V+  E+ +IM L FKTP+RKLLIMSLD                    +L++SV
Sbjct:     1 MQQLLFAVVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSV 60

Query:    61 YNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRR 120
             YN+M IQKRWI+D   VVNPTD+V++A HLLE+TLMG  LFL  MIDRLHHY+RELRIRR
Sbjct:    61 YNMMGIQKRWIED--GVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRR 118

Query:   121 KTMEAIKNQSRGFEDGKAASSEEIKALEDQMXXXXXXXXXXXXXXXXXXXXANAAETNAV 180
             K ME IK +    E  KA   +E+K L +++                        +T+AV
Sbjct:   119 KNMEVIKKEGALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAV 178

Query:   181 ALRKQSEGFLFEYDXXXXXXXXXXXXXXSLDWRLSHSGSKKDS 223
             AL+KQSEGFL E++              ++D +LS S SKK++
Sbjct:   179 ALQKQSEGFLIEFNRLLEENQVLRDQLHTVDSKLSRSSSKKNT 221




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0005783 "endoplasmic reticulum" evidence=IEA;IDA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
TAIR|locus:2152691 AT5G42570 "AT5G42570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152501 AT5G48660 "AT5G48660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098520 AT3G07190 "AT3G07190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092364 AT3G20450 "AT3G20450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00012113001
SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence (Chromosome undetermined scaffold_2984, whole genome shotgun sequence); (218 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam05529149 pfam05529, Bap31, B-cell receptor-associated prote 3e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-04
pfam11336 514 pfam11336, DUF3138, Protein of unknown function (D 0.002
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.002
>gnl|CDD|218624 pfam05529, Bap31, B-cell receptor-associated protein 31-like Back     alignment and domain information
 Score = 42.2 bits (100), Expect = 3e-05
 Identities = 32/144 (22%), Positives = 67/144 (46%), Gaps = 16/144 (11%)

Query: 3   QLLFTVMFSEMA--LIMVLLFKTPLRKLLIMSLDRVKRGR-GPVVVKTVAGTVLVMLISS 59
            L+F ++++EMA  L++VL   +P+R+ +  S+ +++  +      K +   +LV+ I S
Sbjct: 6   TLVFGLLYAEMAVFLLLVLPLPSPIRRKIFKSVSKLQLSQQFQTGFKILLIFLLVLFIDS 65

Query: 60  VYNIMMIQKRWIDDEGAVVNPTDQVLLANHLLEATLM---------GASLFLAFMIDRLH 110
           V  +          +G+          + +   A L          G +LFL  +I R+ 
Sbjct: 66  VRRVYKYSGE---LQGSGNASLGGGERSEYQTLARLFYAQRNLYLSGFTLFLTLVIRRVV 122

Query: 111 HYIRELRIRRKTMEAIKNQSRGFE 134
             + EL ++ + +EA+K Q+   +
Sbjct: 123 TLVEEL-VKLEELEALKKQAENLQ 145


Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8. Bap31 is cleaved within its cytosolic domain, generating pro-apoptotic p20 Bap31. Length = 149

>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|221084 pfam11336, DUF3138, Protein of unknown function (DUF3138) Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
KOG1962216 consensus B-cell receptor-associated protein and r 100.0
PF05529192 Bap31: B-cell receptor-associated protein 31-like 100.0
COG5374192 Uncharacterized conserved protein [Function unknow 100.0
KOG1962216 consensus B-cell receptor-associated protein and r 98.8
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.67
COG4372 499 Uncharacterized protein conserved in bacteria with 96.48
PRK11637 428 AmiB activator; Provisional 96.3
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 96.28
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 95.32
PF00038 312 Filament: Intermediate filament protein; InterPro: 95.24
PRK09039 343 hypothetical protein; Validated 95.01
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.56
COG5185 622 HEC1 Protein involved in chromosome segregation, i 94.55
PRK11637 428 AmiB activator; Provisional 94.43
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.24
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 93.37
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.24
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 92.85
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.85
PRK10884206 SH3 domain-containing protein; Provisional 92.68
COG4942 420 Membrane-bound metallopeptidase [Cell division and 92.65
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 92.64
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.96
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.64
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.62
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 91.34
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.24
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 91.05
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.0
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 90.89
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 90.75
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 90.74
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 90.72
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.49
PF14662193 CCDC155: Coiled-coil region of CCDC155 90.4
PF00038 312 Filament: Intermediate filament protein; InterPro: 89.92
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 89.84
COG3879 247 Uncharacterized protein conserved in bacteria [Fun 89.82
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 89.78
PRK12704 520 phosphodiesterase; Provisional 89.64
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 89.52
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.24
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 89.21
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.19
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 88.92
PRK10884206 SH3 domain-containing protein; Provisional 88.9
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 88.51
PF10186 302 Atg14: UV radiation resistance protein and autopha 88.39
PHA02562 562 46 endonuclease subunit; Provisional 88.37
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 88.05
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.93
PF13870177 DUF4201: Domain of unknown function (DUF4201) 87.86
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 87.78
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 87.67
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 87.61
COG2433 652 Uncharacterized conserved protein [Function unknow 87.56
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 87.54
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 87.48
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.27
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 87.14
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.94
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 86.86
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 86.85
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 86.79
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 86.68
PF03954138 Lectin_N: Hepatic lectin, N-terminal domain; Inter 86.62
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 86.3
PF05529192 Bap31: B-cell receptor-associated protein 31-like 86.23
KOG0963 629 consensus Transcription factor/CCAAT displacement 85.67
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 85.62
PF14584151 DUF4446: Protein of unknown function (DUF4446) 85.54
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 85.51
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 85.35
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 85.3
PF10186 302 Atg14: UV radiation resistance protein and autopha 84.84
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.63
PF0706183 Swi5: Swi5; InterPro: IPR010760 This entry represe 84.62
PF04136157 Sec34: Sec34-like family ; InterPro: IPR007265 Sec 84.49
PRK03918 880 chromosome segregation protein; Provisional 84.47
COG4026290 Uncharacterized protein containing TOPRIM domain, 84.26
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 84.12
PF1518885 CCDC-167: Coiled-coil domain-containing protein 16 84.05
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 83.81
KOG0933 1174 consensus Structural maintenance of chromosome pro 83.78
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 83.63
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 83.58
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 83.57
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 83.55
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 83.44
PRK09039 343 hypothetical protein; Validated 83.07
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.86
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 82.76
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 82.48
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 82.48
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 82.41
PRK1542279 septal ring assembly protein ZapB; Provisional 82.05
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 81.82
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 81.58
KOG0996 1293 consensus Structural maintenance of chromosome pro 81.13
PF05615139 THOC7: Tho complex subunit 7; InterPro: IPR008501 81.12
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 81.08
PF1154476 Spc42p: Spindle pole body component Spc42p; InterP 80.91
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 80.75
PF06008 264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 80.6
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 80.39
PRK13169110 DNA replication intiation control protein YabA; Re 80.39
PF04420161 CHD5: CHD5-like protein; InterPro: IPR007514 Membe 80.16
PRK11281 1113 hypothetical protein; Provisional 80.04
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3e-47  Score=322.86  Aligned_cols=207  Identities=31%  Similarity=0.421  Sum_probs=166.2

Q ss_pred             ChHHHHHHHHHHHHHHHHHhcchh-HHHH-HHHHHHHHhhcc-hhHHHHHHHHHHHHHHHHhHHHHHHhhhhcccccCCC
Q 027451            1 MQQLLFTVMFSEMALIMVLLFKTP-LRKL-LIMSLDRVKRGR-GPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAV   77 (223)
Q Consensus         1 ~~~lvf~~L~~Em~~~llLvlPlP-~R~~-~~~~l~~~~~~r-~~~~~~~~~~~l~vlF~Dai~~~~k~~~~~~~~~~~~   77 (223)
                      ||++||++||+||+++++||+|+| .||. ++....+...++ +.+++.+++++++++|+|||+++++|...+.....++
T Consensus         1 ~~tlvf~iL~~Eial~~iL~Lpip~r~~~~~~~~~~~~~~~~~~~~~i~~~~~villlfiDsvr~i~~~~~~~~~~~n~~   80 (216)
T KOG1962|consen    1 YWTLVFTILYAEIALFLILLLPIPPRRRRKIFKDRLKSGLAPQVLKTIATTMIVILLLFIDSVRRIQKYVSEYGSMANPT   80 (216)
T ss_pred             CHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccCCc
Confidence            799999999999999999999997 4444 334444555555 8899999999999999999999999988753321233


Q ss_pred             CCch--hHHHHHHHHHH--HHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccchHHHHHhHHHhHH
Q 027451           78 VNPT--DQVLLANHLLE--ATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAASSEEIKALEDQMTT  153 (223)
Q Consensus        78 ~~~~--~~~~~r~~~~q--~YIsGF~LFL~lvI~R~~~li~~l~~~~~~~~al~kQa~~~~~~~~~~~~~~~~~~~~~~~  153 (223)
                      ++|.  .+.++..|+.|  .|||||+|||||||+|+|+++++++.++++ +.++++++.+.+..+..+    .+.+++++
T Consensus        81 ~~~~a~~~~~~~l~raqrn~YisGf~LFL~lvI~R~~~ll~~l~~l~~~-~~~~~~~~~lk~~~~~~~----~~~~~~~~  155 (216)
T KOG1962|consen   81 DQPLARTHLLEALFRAQRNLYISGFVLFLSLVIRRLHTLLRELATLRAN-EKAMKENEALKKQLENSS----KLEEENDK  155 (216)
T ss_pred             cchHHHHHHHHHHHHHHhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhh-HHHHHHHHHHHHhhhccc----chhhhHHH
Confidence            4443  56777766665  599999999999999999999999999996 555554444333211111    14556667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHhhHHHHHHHHHHHHHHHHHhHhhhcc
Q 027451          154 LKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDW  212 (223)
Q Consensus       154 l~~e~~~Lk~el~~~~~el~~~~~d~~aLKkQae~l~~EYDrL~~e~~~l~~~l~~~~~  212 (223)
                      ..++.++|+.+++++++++++++++.++|+||++++++|||||++||++||++++.+..
T Consensus       156 ~~~~~~kL~~el~~~~~~Le~~~~~~~al~Kq~e~~~~EydrLlee~~~Lq~~i~~~~~  214 (216)
T KOG1962|consen  156 LKADLEKLETELEKKQKKLEKAQKKVDALKKQSEGLQDEYDRLLEEYSKLQEQIESGGK  214 (216)
T ss_pred             HHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHhccCC
Confidence            78899999999999999999999999999999999999999999999999999987653



>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>COG5374 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>COG3879 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF03954 Lectin_N: Hepatic lectin, N-terminal domain; InterPro: IPR005640 Animal lectins display a wide variety of architectures Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF14584 DUF4446: Protein of unknown function (DUF4446) Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07061 Swi5: Swi5; InterPro: IPR010760 This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [] Back     alignment and domain information
>PF04136 Sec34: Sec34-like family ; InterPro: IPR007265 Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1 Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15188 CCDC-167: Coiled-coil domain-containing protein 167 Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 95.64
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 95.39
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.2
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.84
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.84
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.67
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.37
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 93.64
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.53
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 92.34
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 92.27
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 92.2
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 92.09
3cl3_D130 NF-kappa-B essential modulator; death effector dom 92.05
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 91.59
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.59
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 89.57
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 89.54
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 89.42
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 87.33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.28
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 86.99
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 86.45
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 85.86
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 85.53
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 83.61
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 83.38
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 83.36
3viq_B85 Mating-type switching protein SWI5; recombination 81.81
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
Probab=95.64  E-value=0.19  Score=35.53  Aligned_cols=59  Identities=20%  Similarity=0.246  Sum_probs=50.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHhhHHHHHHHHHHHHHHHHHhHhhhccc
Q 027451          155 KLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWR  213 (223)
Q Consensus       155 ~~e~~~Lk~el~~~~~el~~~~~d~~aLKkQae~l~~EYDrL~~e~~~l~~~l~~~~~~  213 (223)
                      ....+.++.+++..++....++.++.+|++...+++.++|+..+.....+.+|...+.+
T Consensus        19 ~~~~~~~e~~l~~~e~~~~~~E~ev~~L~kKiq~lE~eld~~ee~l~~a~~kLeeaek~   77 (81)
T 1ic2_A           19 LDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKYSESLKDAQEKLELADKK   77 (81)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGG
T ss_pred             HHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566777788888888888899999999999999999999999999999988876654



>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 80.32
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]
Probab=80.32  E-value=6.8  Score=26.79  Aligned_cols=22  Identities=18%  Similarity=0.329  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Q 027451          107 DRLHHYIRELRIRRKTMEAIKN  128 (223)
Q Consensus       107 ~R~~~li~~l~~~~~~~~al~k  128 (223)
                      ..+..+-.+...++..++.++.
T Consensus        28 d~i~~ld~~rr~l~~~~e~l~~   49 (110)
T d1seta1          28 EALLALDREVQELKKRLQEVQT   49 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4444444444444444444433