Citrus Sinensis ID: 027511
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 255577116 | 449 | glycosyltransferase, putative [Ricinus c | 0.936 | 0.463 | 0.850 | 1e-100 | |
| 449462593 | 447 | PREDICTED: phosphatidylinositol N-acetyl | 0.990 | 0.492 | 0.790 | 1e-98 | |
| 449502225 | 445 | PREDICTED: phosphatidylinositol N-acetyl | 0.990 | 0.494 | 0.790 | 2e-98 | |
| 242048156 | 448 | hypothetical protein SORBIDRAFT_02g00880 | 0.968 | 0.479 | 0.805 | 1e-95 | |
| 356546247 | 444 | PREDICTED: phosphatidylinositol N-acetyl | 0.945 | 0.472 | 0.8 | 2e-95 | |
| 356575054 | 446 | PREDICTED: phosphatidylinositol N-acetyl | 0.959 | 0.477 | 0.835 | 2e-95 | |
| 326503280 | 448 | predicted protein [Hordeum vulgare subsp | 0.968 | 0.479 | 0.805 | 2e-95 | |
| 225434648 | 447 | PREDICTED: phosphatidylinositol N-acetyl | 0.959 | 0.476 | 0.854 | 1e-94 | |
| 215769000 | 471 | unnamed protein product [Oryza sativa Ja | 0.968 | 0.456 | 0.810 | 3e-94 | |
| 293332789 | 386 | hypothetical protein [Zea mays] gi|22402 | 0.891 | 0.512 | 0.848 | 5e-94 |
| >gi|255577116|ref|XP_002529442.1| glycosyltransferase, putative [Ricinus communis] gi|223531119|gb|EEF32968.1| glycosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 368 bits (945), Expect = e-100, Method: Compositional matrix adjust.
Identities = 177/208 (85%), Positives = 188/208 (90%)
Query: 4 KVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEAFC 63
V FIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPH+ VR VLI GHIFLNSSLTEAFC
Sbjct: 230 NVHFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHSCVRCVLIRGHIFLNSSLTEAFC 289
Query: 64 IAILEAASCGLLTVSTRVGGVPEVLPDDMVVLAEPDPGDMVLAIRKAISLLPKIDPQVMH 123
IAILEAASCGLLTVSTRVGGVPEVLPDDM+VLAEPDP DMV AI KAI LLPKIDP+VMH
Sbjct: 290 IAILEAASCGLLTVSTRVGGVPEVLPDDMIVLAEPDPSDMVQAINKAICLLPKIDPKVMH 349
Query: 124 ERMKKLYNWHDVAKRTEIVYDRALECPNQNLVERLSRYLSCGAWAGKLFCLVMIIDYLLW 183
+RMKKLYNWHDVAKRTEIVYDRAL+CPNQN +ERLSRYLSCGAWAGKLFCLVMIID LL
Sbjct: 350 DRMKKLYNWHDVAKRTEIVYDRALKCPNQNFLERLSRYLSCGAWAGKLFCLVMIIDSLLL 409
Query: 184 RFLELWKPAEDIEEVPDIVLPCQSDGES 211
R ++LW+PAEDIEEVP+ +P D E
Sbjct: 410 RLVQLWQPAEDIEEVPEFTIPNHQDREG 437
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449462593|ref|XP_004149025.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449502225|ref|XP_004161580.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit A-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|242048156|ref|XP_002461824.1| hypothetical protein SORBIDRAFT_02g008800 [Sorghum bicolor] gi|241925201|gb|EER98345.1| hypothetical protein SORBIDRAFT_02g008800 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|356546247|ref|XP_003541541.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356575054|ref|XP_003555657.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|326503280|dbj|BAJ99265.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|225434648|ref|XP_002279568.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit A [Vitis vinifera] gi|297745930|emb|CBI15986.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|215769000|dbj|BAH01229.1| unnamed protein product [Oryza sativa Japonica Group] gi|218199415|gb|EEC81842.1| hypothetical protein OsI_25603 [Oryza sativa Indica Group] gi|222636809|gb|EEE66941.1| hypothetical protein OsJ_23803 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|293332789|ref|NP_001169463.1| hypothetical protein [Zea mays] gi|224029517|gb|ACN33834.1| unknown [Zea mays] gi|414589229|tpg|DAA39800.1| TPA: hypothetical protein ZEAMMB73_364962 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| TAIR|locus:2096875 | 447 | SETH2 [Arabidopsis thaliana (t | 0.941 | 0.467 | 0.8 | 2e-88 | |
| DICTYBASE|DDB_G0283965 | 523 | pigA "phosphatidylinositol gly | 0.869 | 0.369 | 0.582 | 7.5e-57 | |
| ASPGD|ASPL0000056162 | 488 | AN0636 [Emericella nidulans (t | 0.626 | 0.284 | 0.560 | 2.9e-52 | |
| POMBASE|SPBC3D6.07 | 456 | gpi3 "pig-A, phosphatidylinosi | 0.891 | 0.434 | 0.534 | 3.5e-52 | |
| UNIPROTKB|G4NH54 | 499 | MGG_03933 "Phosphatidylinosito | 0.626 | 0.278 | 0.553 | 6.1e-52 | |
| UNIPROTKB|F1NHQ4 | 477 | PIGA "Uncharacterized protein" | 0.873 | 0.406 | 0.482 | 1e-45 | |
| GENEDB_PFALCIPARUM|PF10_0316 | 461 | PF10_0316 "phosphatidyl inosit | 0.873 | 0.420 | 0.463 | 2.1e-45 | |
| UNIPROTKB|Q8IJ83 | 461 | PF10_0316 "N-acetylglucosaminy | 0.873 | 0.420 | 0.463 | 2.1e-45 | |
| CGD|CAL0005841 | 452 | SPT14 [Candida albicans (taxid | 0.887 | 0.435 | 0.46 | 2.7e-45 | |
| UNIPROTKB|Q5A6R7 | 452 | SPT14 "Putative uncharacterize | 0.887 | 0.435 | 0.46 | 2.7e-45 |
| TAIR|locus:2096875 SETH2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 883 (315.9 bits), Expect = 2.0e-88, P = 2.0e-88
Identities = 168/210 (80%), Positives = 188/210 (89%)
Query: 5 VRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEAFCI 64
VRF+VGGDGPK VRLEEMREKHSLQDRVEMLGAVPH++VRSVL++GHIFLNSSLTEAFCI
Sbjct: 232 VRFVVGGDGPKHVRLEEMREKHSLQDRVEMLGAVPHSRVRSVLVTGHIFLNSSLTEAFCI 291
Query: 65 AILEAASCGLLTVSTRVGGVPEVLPDDMVVLAEPDPGDMVLAIRKAISLLPKIDPQVMHE 124
AILEAASCGLLTVSTRVGGVPEVLPDDMVVLAEPDP DMV AI KAIS+LP I+P+ MH
Sbjct: 292 AILEAASCGLLTVSTRVGGVPEVLPDDMVVLAEPDPDDMVRAIEKAISILPTINPEEMHN 351
Query: 125 RMKKLYNWHDVAKRTEIVYDRALECPNQNLVERLSRYLSCGAWAGKLFCLVMIIDYLLWR 184
RMKKLY+W DVAKRTEIVYDRAL+C N++L+ERL R+LSCGAWAGKLFC+VMI+DYLLWR
Sbjct: 352 RMKKLYSWQDVAKRTEIVYDRALKCSNRSLLERLMRFLSCGAWAGKLFCMVMILDYLLWR 411
Query: 185 FLELWKPAEDIEEVPDIVLPCQSDGESLKD 214
L+L +P EDIEE PDI L C G + +
Sbjct: 412 LLQLLQPDEDIEEAPDICL-CHHRGVEVSE 440
|
|
| DICTYBASE|DDB_G0283965 pigA "phosphatidylinositol glycan, class A" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000056162 AN0636 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC3D6.07 gpi3 "pig-A, phosphatidylinositol N-acetylglucosaminyltransferase subunit Gpi3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NH54 MGG_03933 "Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHQ4 PIGA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF10_0316 PF10_0316 "phosphatidyl inositol glycan, class A, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJ83 PF10_0316 "N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005841 SPT14 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A6R7 SPT14 "Putative uncharacterized protein SPT14" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| Sb02g008800.1 | hypothetical protein (448 aa) | ||||||||||
(Sorghum bicolor) | |||||||||||
| Sb06g033040.1 | • | • | • | 0.934 | |||||||
| Sb06g020130.1 | • | • | 0.932 | ||||||||
| Sb10g026840.1 | • | 0.800 | |||||||||
| Sb06g014820.1 | • | 0.800 | |||||||||
| Sb04g026410.1 | • | • | 0.786 | ||||||||
| Sb09g028160.1 | • | • | • | 0.697 | |||||||
| Sb01g021120.1 | • | • | 0.562 | ||||||||
| Sb01g002910.1 | • | • | • | 0.517 | |||||||
| Sb06g033020.1 | • | • | • | 0.454 | |||||||
| Sb06g016470.1 | • | • | • | 0.454 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| cd03796 | 398 | cd03796, GT1_PIG-A_like, This family is most close | 1e-102 | |
| cd03801 | 374 | cd03801, GT1_YqgM_like, This family is most closel | 5e-28 | |
| cd03798 | 377 | cd03798, GT1_wlbH_like, This family is most closel | 2e-27 | |
| COG0438 | 381 | COG0438, RfaG, Glycosyltransferase [Cell envelope | 1e-21 | |
| pfam00534 | 158 | pfam00534, Glycos_transf_1, Glycosyl transferases | 9e-21 | |
| cd03800 | 398 | cd03800, GT1_Sucrose_synthase, This family is most | 1e-18 | |
| cd04962 | 371 | cd04962, GT1_like_5, This family is most closely r | 1e-18 | |
| cd03799 | 355 | cd03799, GT1_amsK_like, This is a family of GT1 gl | 1e-18 | |
| cd01635 | 229 | cd01635, Glycosyltransferase_GTB_type, Glycosyltra | 1e-17 | |
| cd03807 | 365 | cd03807, GT1_WbnK_like, This family is most closel | 2e-17 | |
| TIGR03999 | 374 | TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosamin | 1e-15 | |
| cd03811 | 353 | cd03811, GT1_WabH_like, This family is most closel | 1e-15 | |
| cd03817 | 374 | cd03817, GT1_UGDG_like, This family is most closel | 1e-14 | |
| cd05844 | 367 | cd05844, GT1_like_7, Glycosyltransferases catalyze | 1e-14 | |
| cd03814 | 364 | cd03814, GT1_like_2, This family is most closely r | 2e-14 | |
| cd03809 | 365 | cd03809, GT1_mtfB_like, This family is most closel | 2e-13 | |
| cd04951 | 360 | cd04951, GT1_WbdM_like, This family is most closel | 6e-13 | |
| cd04946 | 407 | cd04946, GT1_AmsK_like, This family is most closel | 5e-11 | |
| cd03808 | 359 | cd03808, GT1_cap1E_like, This family is most close | 5e-11 | |
| cd03821 | 375 | cd03821, GT1_Bme6_like, This family is most closel | 6e-11 | |
| PRK15427 | 406 | PRK15427, PRK15427, colanic acid biosynthesis glyc | 2e-09 | |
| cd03820 | 348 | cd03820, GT1_amsD_like, This family is most closel | 3e-09 | |
| TIGR02149 | 388 | TIGR02149, glgA_Coryne, glycogen synthase, Coryneb | 4e-09 | |
| TIGR03088 | 374 | TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH | 4e-09 | |
| cd03813 | 475 | cd03813, GT1_like_3, This family is most closely r | 5e-09 | |
| TIGR04005 | 406 | TIGR04005, wcaL, colanic acid biosynthesis glycosy | 2e-08 | |
| cd03795 | 357 | cd03795, GT1_like_4, This family is most closely r | 2e-08 | |
| cd03794 | 394 | cd03794, GT1_wbuB_like, This family is most closel | 2e-07 | |
| pfam13692 | 134 | pfam13692, Glyco_trans_1_4, Glycosyl transferases | 1e-06 | |
| TIGR04047 | 373 | TIGR04047, MSMEG_0565_glyc, glycosyltransferase, M | 2e-06 | |
| PLN02871 | 465 | PLN02871, PLN02871, UDP-sulfoquinovose:DAG sulfoqu | 2e-05 | |
| cd03818 | 396 | cd03818, GT1_ExpC_like, This family is most closel | 3e-05 | |
| TIGR02472 | 439 | TIGR02472, sucr_P_syn_N, sucrose-phosphate synthas | 4e-05 | |
| cd03802 | 335 | cd03802, GT1_AviGT4_like, This family is most clos | 5e-05 | |
| cd03812 | 358 | cd03812, GT1_CapH_like, This family is most closel | 9e-05 | |
| cd03819 | 355 | cd03819, GT1_WavL_like, This family is most closel | 1e-04 | |
| pfam13524 | 92 | pfam13524, Glyco_trans_1_2, Glycosyl transferases | 3e-04 | |
| TIGR02470 | 784 | TIGR02470, sucr_synth, sucrose synthase | 0.001 | |
| cd03823 | 359 | cd03823, GT1_ExpE7_like, This family is most close | 0.001 | |
| TIGR04063 | 397 | TIGR04063, stp3, PEP-CTERM/exosortase A-associated | 0.002 | |
| TIGR03449 | 405 | TIGR03449, mycothiol_MshA, D-inositol-3-phosphate | 0.003 | |
| cd03804 | 351 | cd03804, GT1_wbaZ_like, This family is most closel | 0.004 |
| >gnl|CDD|99970 cd03796, GT1_PIG-A_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
Score = 301 bits (772), Expect = e-102
Identities = 120/175 (68%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
Query: 4 KVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEAFC 63
VRFI+GGDGPKR+ LEEMREK++LQDRVE+LGAVPH +VR VL+ GHIFLN+SLTEAFC
Sbjct: 224 NVRFIIGGDGPKRILLEEMREKYNLQDRVELLGAVPHERVRDVLVQGHIFLNTSLTEAFC 283
Query: 64 IAILEAASCGLLTVSTRVGGVPEVLPDDMVVLAEPDPGDMVLAIRKAISLLP--KIDPQV 121
IAI+EAASCGLL VSTRVGG+PEVLP DM++LAEPD +V + +AIS+L K DP
Sbjct: 284 IAIVEAASCGLLVVSTRVGGIPEVLPPDMILLAEPDVESIVRKLEEAISILRTGKHDPWS 343
Query: 122 MHERMKKLYNWHDVAKRTEIVYDRALECPNQNLVERLSRYLSCGAWAGKLFCLVM 176
H R+KK+Y+W DVAKRTE VYDR L+ PN +L+ERL RY SCG AGK+FCL+
Sbjct: 344 FHNRVKKMYSWEDVAKRTEKVYDRILQTPNLSLLERLKRYYSCGPIAGKIFCLLA 398
|
Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder. Length = 398 |
| >gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|223515 COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215979 pfam00534, Glycos_transf_1, Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >gnl|CDD|99973 cd03800, GT1_Sucrose_synthase, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|100002 cd04962, GT1_like_5, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|99959 cd01635, Glycosyltransferase_GTB_type, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >gnl|CDD|99979 cd03807, GT1_WbnK_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|234438 TIGR03999, thiol_BshA, N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA | Back alignment and domain information |
|---|
| >gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|100003 cd05844, GT1_like_7, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >gnl|CDD|99985 cd03814, GT1_like_2, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99981 cd03809, GT1_mtfB_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|100000 cd04951, GT1_WbdM_like, This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >gnl|CDD|99997 cd04946, GT1_AmsK_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99980 cd03808, GT1_cap1E_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99991 cd03821, GT1_Bme6_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|185325 PRK15427, PRK15427, colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|233748 TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >gnl|CDD|132132 TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >gnl|CDD|99984 cd03813, GT1_like_3, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|188520 TIGR04005, wcaL, colanic acid biosynthesis glycosyltransferase WcaL | Back alignment and domain information |
|---|
| >gnl|CDD|99969 cd03795, GT1_like_4, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|222322 pfam13692, Glyco_trans_1_4, Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >gnl|CDD|234448 TIGR04047, MSMEG_0565_glyc, glycosyltransferase, MSMEG_0565 family | Back alignment and domain information |
|---|
| >gnl|CDD|215469 PLN02871, PLN02871, UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|99988 cd03818, GT1_ExpC_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|131525 TIGR02472, sucr_P_syn_N, sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|99975 cd03802, GT1_AviGT4_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99983 cd03812, GT1_CapH_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|222197 pfam13524, Glyco_trans_1_2, Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >gnl|CDD|233881 TIGR02470, sucr_synth, sucrose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|234452 TIGR04063, stp3, PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family | Back alignment and domain information |
|---|
| >gnl|CDD|132490 TIGR03449, mycothiol_MshA, D-inositol-3-phosphate glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG1111 | 426 | consensus N-acetylglucosaminyltransferase complex, | 100.0 | |
| cd03796 | 398 | GT1_PIG-A_like This family is most closely related | 100.0 | |
| PRK15427 | 406 | colanic acid biosynthesis glycosyltransferase WcaL | 99.95 | |
| TIGR03088 | 374 | stp2 sugar transferase, PEP-CTERM/EpsH1 system ass | 99.93 | |
| PLN02949 | 463 | transferase, transferring glycosyl groups | 99.93 | |
| PRK15490 | 578 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.93 | |
| PRK15484 | 380 | lipopolysaccharide 1,2-N-acetylglucosaminetransfer | 99.93 | |
| TIGR03449 | 405 | mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino | 99.92 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 99.92 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.92 | |
| TIGR02472 | 439 | sucr_P_syn_N sucrose-phosphate synthase, putative, | 99.92 | |
| TIGR02918 | 500 | accessory Sec system glycosylation protein GtfA. M | 99.92 | |
| cd05844 | 367 | GT1_like_7 Glycosyltransferases catalyze the trans | 99.92 | |
| cd03805 | 392 | GT1_ALG2_like This family is most closely related | 99.91 | |
| PRK09922 | 359 | UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D | 99.91 | |
| cd03792 | 372 | GT1_Trehalose_phosphorylase Trehalose phosphorylas | 99.91 | |
| cd03802 | 335 | GT1_AviGT4_like This family is most closely relate | 99.91 | |
| PRK10307 | 412 | putative glycosyl transferase; Provisional | 99.91 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 99.91 | |
| cd03818 | 396 | GT1_ExpC_like This family is most closely related | 99.91 | |
| cd03813 | 475 | GT1_like_3 This family is most closely related to | 99.91 | |
| cd04962 | 371 | GT1_like_5 This family is most closely related to | 99.91 | |
| cd03806 | 419 | GT1_ALG11_like This family is most closely related | 99.91 | |
| cd04946 | 407 | GT1_AmsK_like This family is most closely related | 99.9 | |
| cd04951 | 360 | GT1_WbdM_like This family is most closely related | 99.9 | |
| TIGR02470 | 784 | sucr_synth sucrose synthase. This model represents | 99.9 | |
| PLN00142 | 815 | sucrose synthase | 99.9 | |
| cd04955 | 363 | GT1_like_6 This family is most closely related to | 99.9 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 99.89 | |
| PLN02846 | 462 | digalactosyldiacylglycerol synthase | 99.89 | |
| cd03821 | 375 | GT1_Bme6_like This family is most closely related | 99.89 | |
| PRK14098 | 489 | glycogen synthase; Provisional | 99.89 | |
| TIGR02149 | 388 | glgA_Coryne glycogen synthase, Corynebacterium fam | 99.89 | |
| PLN02316 | 1036 | synthase/transferase | 99.89 | |
| cd03800 | 398 | GT1_Sucrose_synthase This family is most closely r | 99.89 | |
| cd03799 | 355 | GT1_amsK_like This is a family of GT1 glycosyltran | 99.88 | |
| cd03807 | 365 | GT1_WbnK_like This family is most closely related | 99.88 | |
| cd03801 | 374 | GT1_YqgM_like This family is most closely related | 99.88 | |
| PRK00654 | 466 | glgA glycogen synthase; Provisional | 99.88 | |
| PHA01630 | 331 | putative group 1 glycosyl transferase | 99.88 | |
| cd04949 | 372 | GT1_gtfA_like This family is most closely related | 99.88 | |
| cd03798 | 377 | GT1_wlbH_like This family is most closely related | 99.88 | |
| cd03816 | 415 | GT1_ALG1_like This family is most closely related | 99.88 | |
| cd03825 | 365 | GT1_wcfI_like This family is most closely related | 99.87 | |
| cd03795 | 357 | GT1_like_4 This family is most closely related to | 99.87 | |
| PRK14099 | 485 | glycogen synthase; Provisional | 99.87 | |
| cd03822 | 366 | GT1_ecORF704_like This family is most closely rela | 99.87 | |
| PRK10125 | 405 | putative glycosyl transferase; Provisional | 99.87 | |
| cd03812 | 358 | GT1_CapH_like This family is most closely related | 99.87 | |
| PLN02501 | 794 | digalactosyldiacylglycerol synthase | 99.87 | |
| cd03804 | 351 | GT1_wbaZ_like This family is most closely related | 99.87 | |
| cd03814 | 364 | GT1_like_2 This family is most closely related to | 99.87 | |
| TIGR03087 | 397 | stp1 sugar transferase, PEP-CTERM/EpsH1 system ass | 99.87 | |
| TIGR02095 | 473 | glgA glycogen/starch synthases, ADP-glucose type. | 99.87 | |
| cd03817 | 374 | GT1_UGDG_like This family is most closely related | 99.86 | |
| cd03808 | 359 | GT1_cap1E_like This family is most closely related | 99.86 | |
| cd03820 | 348 | GT1_amsD_like This family is most closely related | 99.86 | |
| PF00534 | 172 | Glycos_transf_1: Glycosyl transferases group 1; In | 99.85 | |
| PLN02275 | 371 | transferase, transferring glycosyl groups | 99.85 | |
| PHA01633 | 335 | putative glycosyl transferase group 1 | 99.85 | |
| cd03791 | 476 | GT1_Glycogen_synthase_DULL1_like This family is mo | 99.85 | |
| cd03819 | 355 | GT1_WavL_like This family is most closely related | 99.84 | |
| KOG0853 | 495 | consensus Glycosyltransferase [Cell wall/membrane/ | 99.84 | |
| cd03809 | 365 | GT1_mtfB_like This family is most closely related | 99.83 | |
| cd03794 | 394 | GT1_wbuB_like This family is most closely related | 99.83 | |
| cd03823 | 359 | GT1_ExpE7_like This family is most closely related | 99.83 | |
| cd03811 | 353 | GT1_WabH_like This family is most closely related | 99.8 | |
| cd04950 | 373 | GT1_like_1 Glycosyltransferases catalyze the trans | 99.74 | |
| TIGR02400 | 456 | trehalose_OtsA alpha,alpha-trehalose-phosphate syn | 99.72 | |
| COG0438 | 381 | RfaG Glycosyltransferase [Cell envelope biogenesis | 99.72 | |
| PRK05749 | 425 | 3-deoxy-D-manno-octulosonic-acid transferase; Revi | 99.71 | |
| cd03788 | 460 | GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a | 99.69 | |
| KOG1387 | 465 | consensus Glycosyltransferase [Cell wall/membrane/ | 99.62 | |
| cd01635 | 229 | Glycosyltransferase_GTB_type Glycosyltransferases | 99.61 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.61 | |
| PF13692 | 135 | Glyco_trans_1_4: Glycosyl transferases group 1; PD | 99.6 | |
| cd03793 | 590 | GT1_Glycogen_synthase_GSY2_like Glycogen synthase, | 99.59 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 99.58 | |
| TIGR03713 | 519 | acc_sec_asp1 accessory Sec system protein Asp1. Th | 99.53 | |
| PRK13609 | 380 | diacylglycerol glucosyltransferase; Provisional | 99.52 | |
| PRK09814 | 333 | beta-1,6-galactofuranosyltransferase; Provisional | 99.51 | |
| COG0297 | 487 | GlgA Glycogen synthase [Carbohydrate transport and | 99.51 | |
| PF13524 | 92 | Glyco_trans_1_2: Glycosyl transferases group 1 | 99.5 | |
| PRK13608 | 391 | diacylglycerol glucosyltransferase; Provisional | 99.49 | |
| TIGR00236 | 365 | wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras | 99.45 | |
| PLN02605 | 382 | monogalactosyldiacylglycerol synthase | 99.44 | |
| cd03785 | 350 | GT1_MurG MurG is an N-acetylglucosaminyltransferas | 99.39 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.34 | |
| TIGR02398 | 487 | gluc_glyc_Psyn glucosylglycerol-phosphate synthase | 99.34 | |
| KOG2941 | 444 | consensus Beta-1,4-mannosyltransferase [Posttransl | 99.3 | |
| TIGR01133 | 348 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.28 | |
| PRK00025 | 380 | lpxB lipid-A-disaccharide synthase; Reviewed | 99.24 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 99.22 | |
| TIGR02919 | 438 | accessory Sec system glycosyltransferase GtfB. Mem | 99.2 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.13 | |
| TIGR02094 | 601 | more_P_ylases alpha-glucan phosphorylases. This fa | 98.99 | |
| PF05693 | 633 | Glycogen_syn: Glycogen synthase; InterPro: IPR0086 | 98.81 | |
| TIGR00215 | 385 | lpxB lipid-A-disaccharide synthase. Lipid-A precur | 98.75 | |
| cd04299 | 778 | GT1_Glycogen_Phosphorylase_like This family is mos | 98.57 | |
| PF13844 | 468 | Glyco_transf_41: Glycosyl transferase family 41; P | 98.56 | |
| PF00982 | 474 | Glyco_transf_20: Glycosyltransferase family 20; In | 98.33 | |
| TIGR03568 | 365 | NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, | 98.11 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 98.1 | |
| TIGR01426 | 392 | MGT glycosyltransferase, MGT family. This model de | 98.07 | |
| COG1519 | 419 | KdtA 3-deoxy-D-manno-octulosonic-acid transferase | 98.05 | |
| PRK10117 | 474 | trehalose-6-phosphate synthase; Provisional | 98.05 | |
| COG4641 | 373 | Uncharacterized protein conserved in bacteria [Fun | 97.87 | |
| TIGR03492 | 396 | conserved hypothetical protein. This protein famil | 97.82 | |
| cd03784 | 401 | GT1_Gtf_like This family includes the Gtfs, a grou | 97.67 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 97.66 | |
| PF02350 | 346 | Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; | 97.62 | |
| KOG3742 | 692 | consensus Glycogen synthase [Carbohydrate transpor | 97.61 | |
| TIGR03590 | 279 | PseG pseudaminic acid biosynthesis-associated prot | 97.53 | |
| COG0707 | 357 | MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami | 97.52 | |
| COG0380 | 486 | OtsA Trehalose-6-phosphate synthase [Carbohydrate | 97.47 | |
| COG1819 | 406 | Glycosyl transferases, related to UDP-glucuronosyl | 97.25 | |
| TIGR00661 | 321 | MJ1255 conserved hypothetical protein. This model | 96.99 | |
| PF13528 | 318 | Glyco_trans_1_3: Glycosyl transferase family 1 | 96.95 | |
| PF04101 | 167 | Glyco_tran_28_C: Glycosyltransferase family 28 C-t | 96.95 | |
| PHA03392 | 507 | egt ecdysteroid UDP-glucosyltransferase; Provision | 96.79 | |
| PRK02797 | 322 | 4-alpha-L-fucosyltransferase; Provisional | 96.79 | |
| COG0058 | 750 | GlgP Glucan phosphorylase [Carbohydrate transport | 96.78 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 96.7 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 96.32 | |
| COG0381 | 383 | WecB UDP-N-acetylglucosamine 2-epimerase [Cell env | 96.3 | |
| PF02684 | 373 | LpxB: Lipid-A-disaccharide synthetase; InterPro: I | 96.17 | |
| PF15024 | 559 | Glyco_transf_18: Glycosyltransferase family 18 | 96.02 | |
| PF00201 | 500 | UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera | 95.86 | |
| PF07429 | 360 | Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc | 95.68 | |
| cd03789 | 279 | GT1_LPS_heptosyltransferase Lipopolysaccharide hep | 95.52 | |
| COG0763 | 381 | LpxB Lipid A disaccharide synthetase [Cell envelop | 95.36 | |
| PLN02670 | 472 | transferase, transferring glycosyl groups | 95.36 | |
| TIGR02093 | 794 | P_ylase glycogen/starch/alpha-glucan phosphorylase | 95.35 | |
| PLN03004 | 451 | UDP-glycosyltransferase | 95.33 | |
| PLN02410 | 451 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 95.3 | |
| PLN02562 | 448 | UDP-glycosyltransferase | 95.2 | |
| PRK14986 | 815 | glycogen phosphorylase; Provisional | 95.16 | |
| PF00343 | 713 | Phosphorylase: Carbohydrate phosphorylase; InterPr | 94.79 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 94.57 | |
| cd04300 | 797 | GT1_Glycogen_Phosphorylase This is a family of oli | 94.33 | |
| PRK14985 | 798 | maltodextrin phosphorylase; Provisional | 94.19 | |
| PLN02173 | 449 | UDP-glucosyl transferase family protein | 94.1 | |
| PLN03007 | 482 | UDP-glucosyltransferase family protein | 94.03 | |
| TIGR02193 | 319 | heptsyl_trn_I lipopolysaccharide heptosyltransfera | 93.72 | |
| PLN02555 | 480 | limonoid glucosyltransferase | 93.65 | |
| PLN02448 | 459 | UDP-glycosyltransferase family protein | 93.45 | |
| PLN02764 | 453 | glycosyltransferase family protein | 93.41 | |
| PLN02554 | 481 | UDP-glycosyltransferase family protein | 93.21 | |
| PLN02208 | 442 | glycosyltransferase family protein | 93.19 | |
| PRK10916 | 348 | ADP-heptose:LPS heptosyltransferase II; Provisiona | 92.93 | |
| TIGR02201 | 344 | heptsyl_trn_III lipopolysaccharide heptosyltransfe | 92.88 | |
| PRK10422 | 352 | lipopolysaccharide core biosynthesis protein; Prov | 92.75 | |
| TIGR02195 | 334 | heptsyl_trn_II lipopolysaccharide heptosyltransfer | 92.75 | |
| PLN02210 | 456 | UDP-glucosyl transferase | 92.62 | |
| PLN02863 | 477 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 92.6 | |
| PLN02207 | 468 | UDP-glycosyltransferase | 92.59 | |
| PLN00414 | 446 | glycosyltransferase family protein | 92.51 | |
| PLN02152 | 455 | indole-3-acetate beta-glucosyltransferase | 92.48 | |
| PF04464 | 369 | Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate | 92.42 | |
| PF04007 | 335 | DUF354: Protein of unknown function (DUF354); Inte | 91.92 | |
| PLN02992 | 481 | coniferyl-alcohol glucosyltransferase | 91.85 | |
| PRK10964 | 322 | ADP-heptose:LPS heptosyl transferase I; Provisiona | 91.46 | |
| COG4671 | 400 | Predicted glycosyl transferase [General function p | 91.16 | |
| PRK10017 | 426 | colanic acid biosynthesis protein; Provisional | 90.95 | |
| PLN02167 | 475 | UDP-glycosyltransferase family protein | 90.79 | |
| PRK01021 | 608 | lpxB lipid-A-disaccharide synthase; Reviewed | 90.07 | |
| COG3980 | 318 | spsG Spore coat polysaccharide biosynthesis protei | 89.88 | |
| COG0859 | 334 | RfaF ADP-heptose:LPS heptosyltransferase [Cell env | 89.67 | |
| PF01075 | 247 | Glyco_transf_9: Glycosyltransferase family 9 (hept | 89.42 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 89.35 | |
| PF03016 | 302 | Exostosin: Exostosin family; InterPro: IPR004263 H | 87.67 | |
| PLN02534 | 491 | UDP-glycosyltransferase | 87.51 | |
| KOG1021 | 464 | consensus Acetylglucosaminyltransferase EXT1/exost | 86.79 | |
| PLN00164 | 480 | glucosyltransferase; Provisional | 86.54 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 81.22 | |
| PF11071 | 141 | DUF2872: Protein of unknown function (DUF2872); In | 80.87 | |
| PF06258 | 311 | Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP | 80.72 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 80.64 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 80.03 |
| >KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-42 Score=283.92 Aligned_cols=200 Identities=58% Similarity=0.912 Sum_probs=189.6
Q ss_pred CCCceEEEEEcCCccHHHHHHHHHHcCCCCcEEEeCCCChhHHHHHHHhccEEEEcCCCccccHHHHHHHHhCCcEEEeC
Q 027511 1 MRVKVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEAFCIAILEAASCGLLTVSTR 80 (222)
Q Consensus 1 ~~p~~~lvi~G~g~~~~~l~~~~~~~~l~~~V~~~g~v~~~~~~~ll~~adv~v~~s~~E~~g~~ilEAma~G~PvVa~~ 80 (222)
++|+++|+|+||||++..++++.+++.++++|.++|.+++++++++|.+.|+|++||.+|+||++++|||+||+|||+|+
T Consensus 223 ~~p~vrfii~GDGPk~i~lee~lEk~~l~~rV~~lG~v~h~~Vr~vl~~G~IFlntSlTEafc~~ivEAaScGL~VVsTr 302 (426)
T KOG1111|consen 223 KHPEVRFIIIGDGPKRIDLEEMLEKLFLQDRVVMLGTVPHDRVRDVLVRGDIFLNTSLTEAFCMVIVEAASCGLPVVSTR 302 (426)
T ss_pred cCCCeeEEEecCCcccchHHHHHHHhhccCceEEecccchHHHHHHHhcCcEEeccHHHHHHHHHHHHHHhCCCEEEEee
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCccccccCCceEEeCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHhcCCHHHHHHHHHHHHHHHhcCCCccHHHHHHh
Q 027511 81 VGGVPEVLPDDMVVLAEPDPGDMVLAIRKAISLLPKIDPQVMHERMKKLYNWHDVAKRTEIVYDRALECPNQNLVERLSR 160 (222)
Q Consensus 81 ~gg~~e~i~~~~~g~~~~~~~~la~~i~~ll~~~~~~~~~~~~~~~~~~fs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (222)
+||++|+++++...+..++++++++++++++...+.. ..+.++++++.|+|++++++++++|.++......+..+++..
T Consensus 303 VGGIpeVLP~d~i~~~~~~~~dl~~~v~~ai~~~~~~-p~~~h~~v~~~y~w~dVa~rTekvy~r~~~t~~~~~~~r~~~ 381 (426)
T KOG1111|consen 303 VGGIPEVLPEDMITLGEPGPDDLVGAVEKAITKLRTL-PLEFHDRVKKMYSWKDVAERTEKVYDRAATTSIRNEQDRLKI 381 (426)
T ss_pred cCCccccCCccceeccCCChHHHHHHHHHHHHHhccC-chhHHHHHHHhccHHHHHHHHHHHHHHHhhccCcCHHHHHHH
Confidence 9999999999966678889999999999999886522 578899999999999999999999999999999999999998
Q ss_pred HhhcCchHHHHHHHHHHHHHHHHHHHHHhcCCCCcccCCCCC
Q 027511 161 YLSCGAWAGKLFCLVMIIDYLLWRFLELWKPAEDIEEVPDIV 202 (222)
Q Consensus 161 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~ 202 (222)
++..|.+ |+++.++..+.|++++.++|++|+.+++++||+.
T Consensus 382 ~~~~g~~-g~~~~v~~~i~~ll~~Ll~l~~p~~~v~~a~~~~ 422 (426)
T KOG1111|consen 382 WLYRGVG-GKLFHVLGPINYLLKRLLELPEPRGNVEIAPDVQ 422 (426)
T ss_pred HhhccCC-ceEEEEehHHHHHHHHHhcccCcccccccCcccc
Confidence 8888776 8899999999999999999999999999999993
|
|
| >cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >PLN02949 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >TIGR02918 accessory Sec system glycosylation protein GtfA | Back alignment and domain information |
|---|
| >cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose | Back alignment and domain information |
|---|
| >cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10307 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >TIGR02470 sucr_synth sucrose synthase | Back alignment and domain information |
|---|
| >PLN00142 sucrose synthase | Back alignment and domain information |
|---|
| >cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PLN02846 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK14098 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
| >cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >PRK00654 glgA glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PHA01630 putative group 1 glycosyl transferase | Back alignment and domain information |
|---|
| >cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding | Back alignment and domain information |
|---|
| >cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK14099 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10125 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02501 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >TIGR02095 glgA glycogen/starch synthases, ADP-glucose type | Back alignment and domain information |
|---|
| >cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02275 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PHA01633 putative glycosyl transferase group 1 | Back alignment and domain information |
|---|
| >cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed | Back alignment and domain information |
|---|
| >cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor | Back alignment and domain information |
|---|
| >KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A | Back alignment and domain information |
|---|
| >cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 | Back alignment and domain information |
|---|
| >PRK13609 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09814 beta-1,6-galactofuranosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >PRK13608 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase | Back alignment and domain information |
|---|
| >PLN02605 monogalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase | Back alignment and domain information |
|---|
| >KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >TIGR02919 accessory Sec system glycosyltransferase GtfB | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR02094 more_P_ylases alpha-glucan phosphorylases | Back alignment and domain information |
|---|
| >PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 | Back alignment and domain information |
|---|
| >TIGR00215 lpxB lipid-A-disaccharide synthase | Back alignment and domain information |
|---|
| >cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences | Back alignment and domain information |
|---|
| >PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A | Back alignment and domain information |
|---|
| >PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01426 MGT glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10117 trehalose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >COG4641 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03492 conserved hypothetical protein | Back alignment and domain information |
|---|
| >cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 | Back alignment and domain information |
|---|
| >KOG3742 consensus Glycogen synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG | Back alignment and domain information |
|---|
| >COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00661 MJ1255 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 | Back alignment and domain information |
|---|
| >PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02797 4-alpha-L-fucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0058 GlgP Glucan phosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PF15024 Glyco_transf_18: Glycosyltransferase family 18 | Back alignment and domain information |
|---|
| >PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule | Back alignment and domain information |
|---|
| >PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) | Back alignment and domain information |
|---|
| >cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) | Back alignment and domain information |
|---|
| >COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02670 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR02093 P_ylase glycogen/starch/alpha-glucan phosphorylases | Back alignment and domain information |
|---|
| >PLN03004 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02562 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PRK14986 glycogen phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PF00343 Phosphorylase: Carbohydrate phosphorylase; InterPro: IPR000811 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >cd04300 GT1_Glycogen_Phosphorylase This is a family of oligosaccharide phosphorylases | Back alignment and domain information |
|---|
| >PRK14985 maltodextrin phosphorylase; Provisional | Back alignment and domain information |
|---|
| >PLN02173 UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN03007 UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
| >TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I | Back alignment and domain information |
|---|
| >PLN02555 limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02448 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02764 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02554 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02208 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional | Back alignment and domain information |
|---|
| >TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative | Back alignment and domain information |
|---|
| >PRK10422 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II | Back alignment and domain information |
|---|
| >PLN02210 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02207 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN00414 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02152 indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria | Back alignment and domain information |
|---|
| >PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length | Back alignment and domain information |
|---|
| >PLN02992 coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional | Back alignment and domain information |
|---|
| >COG4671 Predicted glycosyl transferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10017 colanic acid biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >PLN02167 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03016 Exostosin: Exostosin family; InterPro: IPR004263 Hereditary multiple exostoses (EXT) is an autosomal dominant disorder that is characterised by the appearance of multiple outgrowths of the long bones (exostoses) at their epiphyses [] | Back alignment and domain information |
|---|
| >PLN02534 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >KOG1021 consensus Acetylglucosaminyltransferase EXT1/exostosin 1 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PLN00164 glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PF11071 DUF2872: Protein of unknown function (DUF2872); InterPro: IPR019884 This entry represents a family of uncharacterised proteins, including YtoQ from Bacillus subtilis | Back alignment and domain information |
|---|
| >PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 2jjm_A | 394 | Crystal Structure Of A Family Gt4 Glycosyltransfera | 3e-07 | ||
| 3mbo_A | 414 | Crystal Structure Of The Glycosyltransferase Babsha | 4e-07 | ||
| 3fro_A | 439 | Crystal Structure Of Pyrococcus Abyssi Glycogen Syn | 6e-05 | ||
| 2bis_A | 440 | Structure Of Glycogen Synthase From Pyrococcus Abys | 6e-05 | ||
| 3l01_A | 428 | Crystal Structure Of Monomeric Glycogen Synthase Fr | 2e-04 |
| >pdb|2JJM|A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558. Length = 394 | Back alignment and structure |
|
| >pdb|3MBO|A Chain A, Crystal Structure Of The Glycosyltransferase Babsha Bound With Udp And L-Malate Length = 414 | Back alignment and structure |
| >pdb|3FRO|A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations Length = 439 | Back alignment and structure |
| >pdb|2BIS|A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi Length = 440 | Back alignment and structure |
| >pdb|3L01|A Chain A, Crystal Structure Of Monomeric Glycogen Synthase From Pyrococcus Abyssi Length = 428 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 6e-29 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 5e-22 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 1e-21 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 1e-20 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 2e-20 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 6e-20 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 8e-20 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 2e-19 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 3e-19 | |
| 2iuy_A | 342 | Avigt4, glycosyltransferase; antibiotics, family G | 3e-18 | |
| 3s28_A | 816 | Sucrose synthase 1; glycosyltransferase, sucrose m | 3e-16 | |
| 2x0d_A | 413 | WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge | 7e-16 | |
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 3e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 3nb0_A | 725 | Glycogen [starch] synthase isoform 2; glycogen syn | 7e-07 | |
| 2hy7_A | 406 | Glucuronosyltransferase GUMK; glycosyltransferases | 3e-04 |
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Length = 394 | Back alignment and structure |
|---|
Score = 110 bits (278), Expect = 6e-29
Identities = 37/156 (23%), Positives = 69/156 (44%), Gaps = 16/156 (10%)
Query: 2 RVKVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEA 61
V + ++ GDGP+ + ++ + ++DRV LG + V +L + L S E+
Sbjct: 239 EVDAKLLLVGDGPEFCTILQLVKNLHIEDRVLFLGKQDN--VAELLAMSDLMLLLSEKES 296
Query: 62 FCIAILEAASCGLLTVSTRVGGVPEVLPDDMV-VLAEP-DPGDMVLAIRKAISLLPKIDP 119
F + +LEA +CG+ + TRVGG+PEV+ L E D + + + D
Sbjct: 297 FGLVLLEAMACGVPCIGTRVGGIPEVIQHGDTGYLCEVGDTTGVADQAIQLLK-----DE 351
Query: 120 QVMH-------ERMKKLYNWHDVAKRTEIVYDRALE 148
++ E + + + + + E +Y L
Sbjct: 352 ELHRNMGERARESVYEQFRSEKIVSQYETIYYDVLR 387
|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394 | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Length = 438 | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Length = 374 | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406 | Back alignment and structure |
|---|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Length = 166 | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Length = 499 | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Length = 177 | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Length = 416 | Back alignment and structure |
|---|
| >2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Length = 342 | Back alignment and structure |
|---|
| >3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Length = 816 | Back alignment and structure |
|---|
| >2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Length = 413 | Back alignment and structure |
|---|
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Length = 413 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Length = 725 | Back alignment and structure |
|---|
| >2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Length = 406 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 99.94 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 99.93 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 99.93 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 99.93 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 99.93 | |
| 3fro_A | 439 | GLGA glycogen synthase; glycosyltransferase family | 99.93 | |
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 99.92 | |
| 2iuy_A | 342 | Avigt4, glycosyltransferase; antibiotics, family G | 99.92 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 99.92 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 99.91 | |
| 3s28_A | 816 | Sucrose synthase 1; glycosyltransferase, sucrose m | 99.91 | |
| 3vue_A | 536 | GBSS-I, granule-bound starch synthase 1, chloropla | 99.9 | |
| 1rzu_A | 485 | Glycogen synthase 1; glycosyl-transferase, GT-B fo | 99.9 | |
| 2qzs_A | 485 | Glycogen synthase; glycosyl-transferase, GT-B fold | 99.9 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.9 | |
| 2bfw_A | 200 | GLGA glycogen synthase; glycosyltransferase family | 99.89 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 99.89 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 99.88 | |
| 2x0d_A | 413 | WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge | 99.87 | |
| 2hy7_A | 406 | Glucuronosyltransferase GUMK; glycosyltransferases | 99.83 | |
| 1uqt_A | 482 | Alpha, alpha-trehalose-phosphate synthase; glycosy | 99.79 | |
| 2xci_A | 374 | KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci | 99.76 | |
| 3nb0_A | 725 | Glycogen [starch] synthase isoform 2; glycogen syn | 99.74 | |
| 3beo_A | 375 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a | 99.74 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 99.73 | |
| 1vgv_A | 384 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 99.72 | |
| 3t5t_A | 496 | Putative glycosyltransferase; GTB fold, pseudoglyc | 99.68 | |
| 1v4v_A | 376 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t | 99.6 | |
| 3rhz_A | 339 | GTF3, nucleotide sugar synthetase-like protein; gl | 99.59 | |
| 3ot5_A | 403 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 99.31 | |
| 3dzc_A | 396 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 99.27 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 99.24 | |
| 3q3e_A | 631 | HMW1C-like glycosyltransferase; N-glycosylation; 2 | 99.21 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 99.21 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 99.18 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 99.17 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 98.98 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 98.95 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 98.93 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 98.89 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 98.88 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 98.86 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 98.85 | |
| 4hwg_A | 385 | UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc | 98.84 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 98.66 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.54 | |
| 4amg_A | 400 | Snogd; transferase, polyketide biosynthesis, GT1 f | 98.26 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 98.18 | |
| 1l5w_A | 796 | Maltodextrin phosphorylase; enzymatic catalysis, s | 98.06 | |
| 2c4m_A | 796 | Glycogen phosphorylase; allosteric control, phosph | 97.97 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 97.91 | |
| 2gj4_A | 824 | Glycogen phosphorylase, muscle form; transferase; | 97.91 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 97.86 | |
| 3hbm_A | 282 | UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je | 96.96 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 96.4 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 96.25 | |
| 1psw_A | 348 | ADP-heptose LPS heptosyltransferase II; structural | 96.21 | |
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 96.11 | |
| 3tov_A | 349 | Glycosyl transferase family 9; structural genomics | 95.63 | |
| 2gt1_A | 326 | Lipopolysaccharide heptosyltransferase-1; GT-B fol | 95.16 | |
| 1ygp_A | 879 | Yeast glycogen phosphorylase; phosphorylated form, | 95.09 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 94.61 | |
| 2jzc_A | 224 | UDP-N-acetylglucosamine transferase subunit ALG13; | 93.69 | |
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 93.57 | |
| 4fyk_A | 152 | Deoxyribonucleoside 5'-monophosphate N-glycosidas; | 90.83 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 90.2 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 87.64 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 86.96 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 82.84 | |
| 1rcu_A | 195 | Conserved hypothetical protein VT76; structural ge | 81.73 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 80.35 |
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=5.7e-27 Score=203.12 Aligned_cols=149 Identities=15% Similarity=0.136 Sum_probs=134.4
Q ss_pred CCceEEEEEcCCccH------HHHHHHHHHcCCCCc-------EEEeCCCChhHHHHHHHhccEEEEcCCCccccHHHHH
Q 027511 2 RVKVRFIVGGDGPKR------VRLEEMREKHSLQDR-------VEMLGAVPHAQVRSVLISGHIFLNSSLTEAFCIAILE 68 (222)
Q Consensus 2 ~p~~~lvi~G~g~~~------~~l~~~~~~~~l~~~-------V~~~g~v~~~~~~~ll~~adv~v~~s~~E~~g~~ilE 68 (222)
+|+++|+|+|+|+.. +.++++++++++.++ |.+.|+++++++..+|++||++|+||..|+||++++|
T Consensus 213 ~~~~~l~ivG~g~~~~~~~l~~~~~~~~~~~~l~~~v~~l~~vv~~~g~~~~~~~~~~~~~adv~v~pS~~E~~~~~~lE 292 (413)
T 3oy2_A 213 YPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAE 292 (413)
T ss_dssp CTTCCEEEEEECCTTCSCCHHHHHHHHHHHHTCSCHHHHHTTEEEECSCCCHHHHHHHHHHCSEEEECCSCCSSCHHHHH
T ss_pred CCCcEEEEEeCCcccchhhHHHHHHHHHHHcCcccccccccceeeccCcCCHHHHHHHHHhCCEEEeCCCcCCCCcHHHH
Confidence 589999999999865 899999999999987 8888999999999999999999999999999999999
Q ss_pred HHHhCCcEEEeCCCCccccccCCce-------------------EEeCCCHHHHHHHHHHHHhcCC--CCCHHHHHHHHH
Q 027511 69 AASCGLLTVSTRVGGVPEVLPDDMV-------------------VLAEPDPGDMVLAIRKAISLLP--KIDPQVMHERMK 127 (222)
Q Consensus 69 Ama~G~PvVa~~~gg~~e~i~~~~~-------------------g~~~~~~~~la~~i~~ll~~~~--~~~~~~~~~~~~ 127 (222)
||+||+|||+++.||.+|++.++.+ .+...|+++++++| +++++++ ..++.++++.+.
T Consensus 293 Ama~G~PvI~s~~~g~~e~v~~~~~~~i~~~~~~~~~~~~G~~gl~~~~d~~~la~~i-~l~~~~~~~~~~~~~a~~~~~ 371 (413)
T 3oy2_A 293 GAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAF-TFFKDEKNRKEYGKRVQDFVK 371 (413)
T ss_dssp HHTTTCCEEEECCHHHHHHSCTTTSEEECCCEEEECTTTCSSCCEEEECCHHHHHHHH-HHTTSHHHHHHHHHHHHHHHT
T ss_pred HHHcCCCEEEcCCCChHHHHccCcccccccccccccccccCcceeeCCCCHHHHHHHH-HHhcCHHHHHHHHHHHHHHHH
Confidence 9999999999999999999998765 34445999999999 9999876 677888999998
Q ss_pred hcCCHHHHHHHHHHHHHHHhcCCC
Q 027511 128 KLYNWHDVAKRTEIVYDRALECPN 151 (222)
Q Consensus 128 ~~fs~~~~~~~~~~~~~~~~~~~~ 151 (222)
+.|+|+.+++++.++|+++++++.
T Consensus 372 ~~fs~~~~~~~~~~~~~~~~~~~~ 395 (413)
T 3oy2_A 372 TKPTWDDISSDIIDFFNSLLRVES 395 (413)
T ss_dssp TSCCHHHHHHHHHHHHHHHTC---
T ss_pred HhCCHHHHHHHHHHHHHHHHhhcC
Confidence 999999999999999999987654
|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* | Back alignment and structure |
|---|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* | Back alignment and structure |
|---|
| >3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* | Back alignment and structure |
|---|
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* | Back alignment and structure |
|---|
| >2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* | Back alignment and structure |
|---|
| >3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* | Back alignment and structure |
|---|
| >1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A | Back alignment and structure |
|---|
| >2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* | Back alignment and structure |
|---|
| >2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* | Back alignment and structure |
|---|
| >2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* | Back alignment and structure |
|---|
| >1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* | Back alignment and structure |
|---|
| >2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* | Back alignment and structure |
|---|
| >3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* | Back alignment and structure |
|---|
| >3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* | Back alignment and structure |
|---|
| >3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* | Back alignment and structure |
|---|
| >1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 | Back alignment and structure |
|---|
| >3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* | Back alignment and structure |
|---|
| >3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* | Back alignment and structure |
|---|
| >3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} | Back alignment and structure |
|---|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* | Back alignment and structure |
|---|
| >2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... | Back alignment and structure |
|---|
| >3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* | Back alignment and structure |
|---|
| >3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* | Back alignment and structure |
|---|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 | Back alignment and structure |
|---|
| >1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 | Back alignment and structure |
|---|
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* | Back alignment and structure |
|---|
| >3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} | Back alignment and structure |
|---|
| >2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* | Back alignment and structure |
|---|
| >2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A | Back alignment and structure |
|---|
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* | Back alignment and structure |
|---|
| >4fyk_A Deoxyribonucleoside 5'-monophosphate N-glycosidas; hydrolas; HET: SRA; 1.79A {Rattus norvegicus} PDB: 4fyh_A* 4fyi_A* 2klh_A* | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1rzua_ | 477 | c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacte | 1e-17 | |
| d2bisa1 | 437 | c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyro | 2e-14 | |
| d1uqta_ | 456 | c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA | 2e-09 |
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Length = 477 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: Glycosyl transferases group 1 domain: Glycogen synthase 1, GlgA species: Agrobacterium tumefaciens [TaxId: 358]
Score = 78.9 bits (193), Expect = 1e-17
Identities = 28/160 (17%), Positives = 51/160 (31%), Gaps = 13/160 (8%)
Query: 1 MRVKVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTE 60
+ + R +V G G + + RV + + + S E
Sbjct: 317 VSLGGRLVVLGAGDVALEGALLAAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFE 376
Query: 61 AFCIAILEAASCGLLTVSTRVGGVPEVLPDDM-----------VVLAEPDPGDMVLAIRK 109
+ L A G + V R GG+ + + D V + + AIR+
Sbjct: 377 PCGLTQLYALRYGCIPVVARTGGLADTVIDANHAALASKAATGVQFSPVTLDGLKQAIRR 436
Query: 110 AISLL--PKIDPQVMHERMKKLYNWHDVAKRTEIVYDRAL 147
+ PK+ Q+ MK +W A +Y + +
Sbjct: 437 TVRYYHDPKLWTQMQKLGMKSDVSWEKSAGLYAALYSQLI 476
|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Length = 437 | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Length = 456 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 99.92 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 99.91 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 99.89 | |
| d2f9fa1 | 166 | First mannosyl transferase WbaZ {Archaeoglobus ful | 99.86 | |
| d2bfwa1 | 196 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 99.85 | |
| d1uqta_ | 456 | Trehalose-6-phosphate synthase, OtsA {Escherichia | 99.67 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 98.02 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 98.02 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 97.98 | |
| d1v4va_ | 373 | UDP-N-acetylglucosamine 2-epimerase {Thermus therm | 97.45 | |
| d1f0ka_ | 351 | Peptidoglycan biosynthesis glycosyltransferase Mur | 97.4 | |
| d1o6ca_ | 377 | UDP-N-acetylglucosamine 2-epimerase {Bacillus subt | 97.03 | |
| d2pq6a1 | 473 | (Iso)flavonoid glycosyltransferase {Medicago trunc | 96.77 | |
| d2vcha1 | 471 | Hydroquinone glucosyltransferase {Thale cress (Ara | 96.52 | |
| d2acva1 | 461 | Triterpene UDP-glucosyl transferase UGT71G1 {Medic | 96.24 | |
| d1f6da_ | 376 | UDP-N-acetylglucosamine 2-epimerase {Escherichia c | 96.0 | |
| d2c1xa1 | 450 | UDP glucose:flavonoid 3-o-glucosyltransferase {Gra | 95.67 | |
| d1l5wa_ | 796 | Maltodextrin phosphorylase (MALP) {Escherichia col | 95.2 | |
| d2gj4a1 | 824 | Glycogen phosphorylase {Rabbit (Oryctolagus cunicu | 94.93 | |
| d1ygpa_ | 876 | Glycogen phosphorylase {Baker's yeast (Saccharomyc | 94.65 | |
| d1pswa_ | 348 | ADP-heptose LPS heptosyltransferase II {Escherichi | 94.4 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 89.49 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 89.17 | |
| d2ez9a1 | 183 | Pyruvate oxidase {Lactobacillus plantarum [TaxId: | 86.48 | |
| d1ybha1 | 179 | Acetohydroxyacid synthase catalytic subunit {Thale | 85.05 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 83.37 | |
| d1t9ba1 | 171 | Acetohydroxyacid synthase catalytic subunit {Baker | 80.57 |
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: Glycosyl transferases group 1 domain: Glycogen synthase 1, GlgA species: Agrobacterium tumefaciens [TaxId: 358]
Probab=99.92 E-value=1.9e-25 Score=195.76 Aligned_cols=145 Identities=18% Similarity=0.194 Sum_probs=118.9
Q ss_pred ceEEEEEcCCccHHHHHHHHHHcCCCCcEEEeCCCChhHHHHHHHhccEEEEcCCCccccHHHHHHHHhCCcEEEeCCCC
Q 027511 4 KVRFIVGGDGPKRVRLEEMREKHSLQDRVEMLGAVPHAQVRSVLISGHIFLNSSLTEAFCIAILEAASCGLLTVSTRVGG 83 (222)
Q Consensus 4 ~~~lvi~G~g~~~~~l~~~~~~~~l~~~V~~~g~v~~~~~~~ll~~adv~v~~s~~E~~g~~ilEAma~G~PvVa~~~gg 83 (222)
+.+++++|.|+.....+......++.++|.+.+..+.++...++++||++|+||.+|+||++++|||+||+|||+|+.||
T Consensus 320 ~~~l~~~G~G~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~aD~~v~PS~~E~fglv~lEAma~G~PvVas~~GG 399 (477)
T d1rzua_ 320 GGRLVVLGAGDVALEGALLAAASRHHGRVGVAIGYNEPLSHLMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTGG 399 (477)
T ss_dssp TCEEEEEECBCHHHHHHHHHHHHHTTTTEEEEESCCHHHHHHHHHHCSEEEECCSCCSSCSHHHHHHHHTCEEEEESSHH
T ss_pred CCeEEEEecCCchHHHHHHHHHhhcCCeEEEEcccChhHHHHHHHhCccccCCccccCCCHHHHHHHHcCCCEEEcCCCC
Confidence 67899999987765555444444566899999999999999999999999999999999999999999999999999999
Q ss_pred ccccccCCc---------eEE--eCCCHHHHHHHHHHHHhcCC--CCCHHHHHHHHHhcCCHHHHHHHHHHHHHHHhc
Q 027511 84 VPEVLPDDM---------VVL--AEPDPGDMVLAIRKAISLLP--KIDPQVMHERMKKLYNWHDVAKRTEIVYDRALE 148 (222)
Q Consensus 84 ~~e~i~~~~---------~g~--~~~~~~~la~~i~~ll~~~~--~~~~~~~~~~~~~~fs~~~~~~~~~~~~~~~~~ 148 (222)
++|++.++. +|+ .+.|+++++++|.++++..+ ....+.+++.+++.|||+.++++++++|+++++
T Consensus 400 ~~E~v~d~~~~~~~~~~~~G~l~~~~d~~~la~ai~~~l~~~~~~~~~~~~~~~a~~~~fsw~~~a~~~~~lY~~ll~ 477 (477)
T d1rzua_ 400 LADTVIDANHAALASKAATGVQFSPVTLDGLKQAIRRTVRYYHDPKLWTQMQKLGMKSDVSWEKSAGLYAALYSQLIS 477 (477)
T ss_dssp HHHHCCBCCHHHHHTTCCCBEEESSCSHHHHHHHHHHHHHHHTCHHHHHHHHHHHHTCCCBHHHHHHHHHHHHHHHTC
T ss_pred CcceeecCCccccccCCCceEEeCCCCHHHHHHHHHHHHhhhCCHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHhC
Confidence 999998763 443 33499999999999987543 222333334456789999999999999999874
|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} | Back information, alignment and structure |
|---|
| >d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|