Citrus Sinensis ID: 027539
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 359482723 | 1702 | PREDICTED: protein KIAA0664 homolog [Vit | 0.851 | 0.111 | 0.8 | 1e-89 | |
| 147802928 | 1658 | hypothetical protein VITISV_010381 [Viti | 0.851 | 0.113 | 0.8 | 1e-89 | |
| 297743499 | 1262 | unnamed protein product [Vitis vinifera] | 0.851 | 0.149 | 0.8 | 7e-89 | |
| 255553265 | 1454 | eukaryotic translation initiation factor | 0.851 | 0.129 | 0.784 | 3e-86 | |
| 356528968 | 1640 | PREDICTED: uncharacterized protein LOC10 | 0.851 | 0.115 | 0.738 | 1e-81 | |
| 357468145 | 1663 | Tetratricopeptide-like helical domain-co | 0.851 | 0.113 | 0.726 | 2e-81 | |
| 357468149 | 1158 | Tetratricopeptide-like helical domain-co | 0.851 | 0.163 | 0.726 | 1e-80 | |
| 357468147 | 1120 | Tetratricopeptide-like helical domain-co | 0.851 | 0.168 | 0.726 | 1e-80 | |
| 356522331 | 1676 | PREDICTED: protein TIF31 homolog [Glycin | 0.851 | 0.112 | 0.732 | 1e-80 | |
| 449436621 | 1689 | PREDICTED: clustered mitochondria protei | 0.851 | 0.111 | 0.75 | 4e-80 |
| >gi|359482723|ref|XP_003632816.1| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 334 bits (857), Expect = 1e-89, Method: Compositional matrix adjust.
Identities = 152/190 (80%), Positives = 172/190 (90%), Gaps = 1/190 (0%)
Query: 1 MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMED-EQSWNEDHILRLQWLRT 59
MVT+AFKHVL V+ SV+ ++DL AAIASSLNFL GCC MED +Q+ +++++LQWL+T
Sbjct: 743 MVTRAFKHVLKAVVRSVENVADLPAAIASSLNFLLGCCTMEDSDQNSRHENVVKLQWLKT 802
Query: 60 FLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCK 119
FL RRFGW+LKDEF+HLRK SILRGLC KVGLELVPRDYDM+CPNPF + DI+SMVPVCK
Sbjct: 803 FLTRRFGWTLKDEFKHLRKFSILRGLCQKVGLELVPRDYDMECPNPFRKHDIISMVPVCK 862
Query: 120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVV 179
HVGC+SADGRTLLESSKIALDKGKLEDAVNYGTKALA+MIAVCGPYHRTTAS YSLLAVV
Sbjct: 863 HVGCSSADGRTLLESSKIALDKGKLEDAVNYGTKALAKMIAVCGPYHRTTASAYSLLAVV 922
Query: 180 LYHTGDFNQV 189
LYHTGDFNQ
Sbjct: 923 LYHTGDFNQA 932
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147802928|emb|CAN72877.1| hypothetical protein VITISV_010381 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743499|emb|CBI36366.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553265|ref|XP_002517675.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223543307|gb|EEF44839.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356528968|ref|XP_003533069.1| PREDICTED: uncharacterized protein LOC100801625 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357468145|ref|XP_003604357.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505412|gb|AES86554.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357468149|ref|XP_003604359.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505414|gb|AES86556.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357468147|ref|XP_003604358.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505413|gb|AES86555.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356522331|ref|XP_003529800.1| PREDICTED: protein TIF31 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449436621|ref|XP_004136091.1| PREDICTED: clustered mitochondria protein homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| TAIR|locus:2037783 | 1608 | AT1G15290 [Arabidopsis thalian | 0.846 | 0.116 | 0.656 | 2.1e-62 | |
| TAIR|locus:2035327 | 1797 | AT1G01320 [Arabidopsis thalian | 0.842 | 0.104 | 0.537 | 6.5e-48 | |
| DICTYBASE|DDB_G0292806 | 1320 | cluA "CluA protein" [Dictyoste | 0.495 | 0.083 | 0.327 | 1.6e-12 | |
| ZFIN|ZDB-GENE-030131-9913 | 1357 | si:ch211-166a6.5 "si:ch211-166 | 0.490 | 0.080 | 0.351 | 5e-11 | |
| UNIPROTKB|B4MY63 | 1441 | clu "Protein clueless" [Drosop | 0.599 | 0.092 | 0.285 | 8e-10 | |
| UNIPROTKB|B4KT50 | 1487 | clu "Protein clueless" [Drosop | 0.599 | 0.089 | 0.285 | 2.2e-08 | |
| UNIPROTKB|B4LQ23 | 1465 | clu "Protein clueless" [Drosop | 0.599 | 0.090 | 0.285 | 3.6e-08 | |
| UNIPROTKB|B4JW99 | 1494 | clu "Protein clueless" [Drosop | 0.590 | 0.087 | 0.282 | 5.3e-08 | |
| UNIPROTKB|B4GAM1 | 1435 | clu "Protein clueless" [Drosop | 0.599 | 0.092 | 0.271 | 7.2e-08 | |
| UNIPROTKB|Q291J5 | 1435 | clu "Protein clueless" [Drosop | 0.599 | 0.092 | 0.271 | 7.2e-08 |
| TAIR|locus:2037783 AT1G15290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 650 (233.9 bits), Expect = 2.1e-62, P = 2.1e-62
Identities = 124/189 (65%), Positives = 145/189 (76%)
Query: 1 MVTQAFKHVLNGVIASVDYXXXXXXXXXXXXNFLFGCCEMED-EQSWNEDHILRLQWLRT 59
M+T+AFKH+L VIASV+ NF+ G E+E ++ E++ LRLQWL+
Sbjct: 720 MITRAFKHLLRAVIASVNNMAELPVAVAASLNFMLGRRELEGCDRIPGEEYCLRLQWLQK 779
Query: 60 FLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCK 119
FL R+FGW KDEF HL+K SILRGLC KVGLELV RD+D D PNPF DI+ +VPVCK
Sbjct: 780 FLSRKFGWIQKDEFHHLKKFSILRGLCQKVGLELVSRDFDFDSPNPFMSSDIIGLVPVCK 839
Query: 120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVV 179
HV C S+DGRTLLESSK+ALDKGKL+DAV+YGTKAL +MIAVCGPYHR TA YSLLAVV
Sbjct: 840 HVLCISSDGRTLLESSKLALDKGKLDDAVSYGTKALVKMIAVCGPYHRNTACAYSLLAVV 899
Query: 180 LYHTGDFNQ 188
LYHTGDFNQ
Sbjct: 900 LYHTGDFNQ 908
|
|
| TAIR|locus:2035327 AT1G01320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292806 cluA "CluA protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9913 si:ch211-166a6.5 "si:ch211-166a6.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4MY63 clu "Protein clueless" [Drosophila willistoni (taxid:7260)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4KT50 clu "Protein clueless" [Drosophila mojavensis (taxid:7230)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4LQ23 clu "Protein clueless" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4JW99 clu "Protein clueless" [Drosophila grimshawi (taxid:7222)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4GAM1 clu "Protein clueless" [Drosophila persimilis (taxid:7234)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q291J5 clu "Protein clueless" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| pfam12807 | 169 | pfam12807, eIF3_p135, Translation initiation facto | 2e-25 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 1e-04 |
| >gnl|CDD|221783 pfam12807, eIF3_p135, Translation initiation factor eIF3 subunit 135 | Back alignment and domain information |
|---|
Score = 97.1 bits (242), Expect = 2e-25
Identities = 38/122 (31%), Positives = 57/122 (46%), Gaps = 22/122 (18%)
Query: 1 MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEM----------------EDEQ 44
M+ +A KH+L + V DLSAAI+ LN L G ED+
Sbjct: 49 MIARAAKHILRTYLRGVP-APDLSAAISHFLNCLLGSESNPDPEAEIDESRSASYPEDDF 107
Query: 45 SW-NEDHILRLQWLRTFLGRRFGWSLKDEF----QHLRKISILRGLCHKVGLELVPRDYD 99
+W + RF + LK+++ L+KIS+LR +C KVG++L+ R+YD
Sbjct: 108 AWEKLTPEELWSEIEKEAKDRFRYELKEDWKDEQYGLQKISLLREICLKVGIQLLLREYD 167
Query: 100 MD 101
D
Sbjct: 168 FD 169
|
Translation initiation factor eIF3 is a multi-subunit protein complex required for initiation of protein biosynthesis in eukaryotic cells. The complex promotes ribosome dissociation, the binding of the initiator methionyl-tRNA to the 40 S ribosomal subunit, and mRNA recruitment to the ribosome. The protein product from TIF31 genes in yeast is p135 which associates with the eIF3 but does not seem to be necessary for protein translation initiation. Length = 169 |
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 100.0 | |
| PF12807 | 169 | eIF3_p135: Translation initiation factor eIF3 subu | 99.96 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 99.27 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 99.12 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.43 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 98.41 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.2 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.95 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 97.94 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.8 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.8 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 97.6 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.59 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.45 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.39 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.31 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.22 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.22 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 97.21 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.14 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.1 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.02 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.0 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 96.97 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.96 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.95 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 96.89 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.84 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 96.83 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.81 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 96.8 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.74 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.72 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.7 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.69 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.66 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 96.64 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 96.61 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.54 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.5 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.47 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.42 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.42 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.39 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.31 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.27 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 96.26 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 96.11 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.08 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 96.07 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.0 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 95.9 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.85 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 95.62 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 95.56 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.54 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 95.47 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 95.43 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 95.41 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 95.4 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 95.21 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.19 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.16 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.14 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 95.14 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 95.1 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 95.09 | |
| KOG4563 | 400 | consensus Cell cycle-regulated histone H1-binding | 95.08 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 95.06 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 95.0 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.99 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 94.9 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 94.78 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 94.56 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 94.55 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 94.46 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 94.32 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 94.24 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 94.23 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 94.16 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 94.15 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 94.13 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 94.05 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 93.98 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 93.86 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 93.74 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 93.65 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 93.6 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 93.43 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 93.41 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 93.29 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 93.0 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 92.89 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 92.64 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 92.51 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 92.32 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 92.07 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 92.03 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 91.99 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 91.95 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 91.8 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 91.55 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 91.35 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 91.15 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 91.06 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 90.87 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 90.69 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 90.55 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 90.51 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 90.47 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 90.26 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 90.16 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 90.13 | |
| PF09311 | 181 | Rab5-bind: Rabaptin-like protein; InterPro: IPR015 | 90.11 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 90.03 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 89.4 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 89.38 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 89.13 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 88.78 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 88.65 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 88.46 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 88.39 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 88.35 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 88.25 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 87.99 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 87.95 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 87.9 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 87.87 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 87.76 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 87.74 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 87.63 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 87.61 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 87.56 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 87.53 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 87.16 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 87.06 | |
| cd02684 | 75 | MIT_2 MIT: domain contained within Microtubule Int | 86.98 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 86.88 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 86.84 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 86.79 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 86.74 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 86.46 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 86.44 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 86.23 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 86.18 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 85.41 | |
| cd02656 | 75 | MIT MIT: domain contained within Microtubule Inter | 85.17 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 85.06 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 85.0 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 84.96 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 84.84 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 84.64 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 84.64 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 84.6 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 84.29 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 83.47 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 83.21 | |
| PF08969 | 115 | USP8_dimer: USP8 dimerisation domain; InterPro: IP | 83.14 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 82.45 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 82.34 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 82.14 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 81.63 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 81.59 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 81.32 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 80.55 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 80.52 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 80.47 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 80.35 |
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-34 Score=290.88 Aligned_cols=204 Identities=22% Similarity=0.244 Sum_probs=185.5
Q ss_pred CchhhhhHHHHHHhhcCCCCCchHHHHHHHhhhhcCCCCCCC------cccc--c-----------------------ch
Q 027539 1 MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMED------EQSW--N-----------------------ED 49 (222)
Q Consensus 1 mi~RaaKHilr~~l~~~~~~~~~~~~iahfLNcLlg~~~~~~------d~~~--k-----------------------~~ 49 (222)
+++|++||||+.+++.++. ..+++++||||||+||.-.+.. ++.. + ..
T Consensus 765 i~~RslKhvlK~~~r~l~~-~~i~ta~SH~ln~~ls~~~~av~~~~t~~~~~ka~~~~~~~~~~g~~k~~~S~~s~~~l~ 843 (1236)
T KOG1839|consen 765 IALRSLKHVLKDNLRLLGA-DHIQTAASHALNCLLSVMEAAVQKEQTTLEILKAKDLRTQDAAAGTPKPDASISSKGHLS 843 (1236)
T ss_pred HHHHHHHHHHHHHHhhcch-hHHHHHHHHHHHHHhhcccccCCCccchHHHHhhhhhhhhhhccCCCCcccccccccccc
Confidence 4789999999999999995 8999999999999999754322 1100 1 12
Q ss_pred hhhhHHHHHHHhccccccccccccc-------chhhHHHHHHHHHHHceeeeccccCCCC-C--CCCCcCCccccccccc
Q 027539 50 HILRLQWLRTFLGRRFGWSLKDEFQ-------HLRKISILRGLCHKVGLELVPRDYDMDC-P--NPFTRDDIVSMVPVCK 119 (222)
Q Consensus 50 ~~~~~~~i~~~v~~rfry~L~~~~~-------~~~k~~lLR~ic~K~GIQl~~rdY~f~~-~--~~F~~~DI~ni~PvVK 119 (222)
.+.+|.||+...+.+|++..+.+.. +.+++++.|..|.|.|||..+|+|+|++ + ++|..+||+|+.|+||
T Consensus 844 ~s~L~~~I~~d~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~r~~~~e~~~~ks~f~~~Di~~~~p~ik 923 (1236)
T KOG1839|consen 844 VSDLLKYITADSKNKFTAAHDVKSRETILLKNGKSKIAVEKLEKKKRELQKPARNYDFESSEPKSEFNDSDILNLRPVIK 923 (1236)
T ss_pred hhHHHHhccccccccccchhhhhHHHHHhhhcccchhHHHHHHHHhhhcchhhhhccccccCCCCCCCcccccccccccc
Confidence 5678999999999999999986432 6789999999999999999999999998 4 7999999999999999
Q ss_pred ccccCchhHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhh
Q 027539 120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQ 199 (222)
Q Consensus 120 ~~~p~s~~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~ 199 (222)
|+.|.++++++.+|+|+..+++|.+.+|++ ..++++++++++|.+||+++.||..||++|+++||+++|+ .+|
T Consensus 924 ~s~P~~~~a~~~~e~gq~~~~e~~~~~~~~-~~~slnl~~~v~~~~h~~~~~~~~~La~l~~~~~d~~~Ai----~~~-- 996 (1236)
T KOG1839|consen 924 HSSPTVSEAKDSPEQGQEALLEDGFSEAYE-LPESLNLLNNVMGVLHPEVASKYRSLAKLSNRLGDNQEAI----AQQ-- 996 (1236)
T ss_pred cCCCccchhhhhhhhhhhhhcccchhhhhh-hhhhhhHHHHhhhhcchhHHHHHHHHHHHHhhhcchHHHH----Hhc--
Confidence 999999999999999999999999999999 9999999999999999999999999999999999999999 999
Q ss_pred hCCCCceEEEeeeechh
Q 027539 200 LGDSKSSIIITSFCTEV 216 (222)
Q Consensus 200 ~~~~~~a~~i~e~~~~~ 216 (222)
.+|++|.||+.|.
T Consensus 997 ----~ka~ii~eR~~g~ 1009 (1236)
T KOG1839|consen 997 ----RKACIISERVLGK 1009 (1236)
T ss_pred ----ccceeeechhccC
Confidence 8999999999875
|
|
| >PF12807 eIF3_p135: Translation initiation factor eIF3 subunit 135 | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF09311 Rab5-bind: Rabaptin-like protein; InterPro: IPR015390 This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5 | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08969 USP8_dimer: USP8 dimerisation domain; InterPro: IPR015063 This domain is predominantly found in the amino terminal region of Ubiquitin carboxyl-terminal hydrolase 8 (USP8) | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 3e-06 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 3e-05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 5e-05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 6e-05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 9e-05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 9e-04 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 3e-06 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 1e-05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 2e-05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 5e-05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 1e-04 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 8e-04 |
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
Score = 46.0 bits (110), Expect = 3e-06
Identities = 14/49 (28%), Positives = 23/49 (46%)
Query: 140 DKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQ 188
D+ K ++A + ALA G H A+T + LAV+ G + +
Sbjct: 55 DQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE 103
|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 99.39 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 99.33 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 99.31 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 99.19 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 99.16 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.91 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.44 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.44 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.42 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.31 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.26 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.21 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.19 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.18 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.16 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.14 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.13 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.07 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.04 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.03 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.0 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.95 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.95 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.94 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.94 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.92 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.91 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.9 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.89 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.88 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.87 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.86 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.86 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.86 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.86 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.83 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.83 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.82 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.82 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.82 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.8 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.78 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.78 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.78 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.78 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.77 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.76 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.76 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.75 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.75 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.74 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.74 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.73 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.73 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.73 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.71 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.7 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.69 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.68 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.67 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.65 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.64 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.63 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.63 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.6 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.6 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.59 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.58 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.58 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.58 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.58 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.57 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.56 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.55 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.54 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.54 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.51 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.49 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.49 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.48 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.46 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.46 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.44 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.42 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.42 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.42 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.41 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.41 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.4 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.4 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.4 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.39 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.39 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.38 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.38 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.36 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.35 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.33 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.32 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.31 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.27 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.27 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.27 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.27 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.26 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.26 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.25 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.24 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.22 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.21 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.19 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.18 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.18 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.16 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.16 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.14 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.13 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.12 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.1 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.08 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.08 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.03 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.03 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.0 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.0 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.99 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 96.99 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.98 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.98 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 96.98 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.97 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 96.96 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 96.93 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.92 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.9 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.9 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.87 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.86 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.86 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.86 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 96.84 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.84 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.8 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 96.8 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.8 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.77 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.71 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 96.68 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.62 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 96.62 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.59 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.58 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 96.58 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.58 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 96.57 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 96.56 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 96.56 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.52 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 96.52 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.48 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.47 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.4 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.31 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.28 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.11 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.01 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.91 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.86 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.68 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 95.43 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.31 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.88 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 94.87 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 94.68 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 93.86 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 93.83 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 93.59 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 92.92 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 92.72 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 92.58 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 91.34 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 91.24 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 90.92 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 90.78 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 90.67 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 90.39 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 90.23 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 89.78 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 89.71 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 89.38 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 89.16 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 88.94 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 88.42 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 87.44 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 86.88 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 86.83 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 85.89 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 85.5 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 84.4 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 84.17 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 83.87 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 83.16 | |
| 2a9u_A | 144 | Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL | 82.48 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 82.15 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 80.92 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 80.84 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 80.81 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 80.51 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 80.11 |
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
Probab=99.39 E-value=2.3e-13 Score=126.53 Aligned_cols=79 Identities=16% Similarity=0.119 Sum_probs=73.4
Q ss_pred hHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhhhCCCCce
Q 027539 127 DGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSS 206 (222)
Q Consensus 127 ~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~~~~~~~a 206 (222)
.+..+-+.|.++..+|++++|.+++.+||.++++++|+.||+||..|++||.+|..+|++++|+ .++ ++|
T Consensus 339 ~a~~~~nLa~~y~~~g~~~eA~~~~~~aL~i~~~~lG~~Hp~~a~~l~nLa~~~~~qg~~~eA~----~~~------~~A 408 (433)
T 3qww_A 339 MLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGE----KAL------KKA 408 (433)
T ss_dssp HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHSCSSCHHHHHHHHHHHHHHHHTTCHHHHH----HHH------HHH
T ss_pred HHHHHHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHhccCHHHHH----HHH------HHH
Confidence 4555566699999999999999999999999999999999999999999999999999999999 888 799
Q ss_pred EEEeeeech
Q 027539 207 IIITSFCTE 215 (222)
Q Consensus 207 ~~i~e~~~~ 215 (222)
+.|.|++.|
T Consensus 409 l~i~~~~lG 417 (433)
T 3qww_A 409 IAIMEVAHG 417 (433)
T ss_dssp HHHHHHHTC
T ss_pred HHHHHHHcC
Confidence 999998876
|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2a9u_A Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL, protease, SH3-binding, thiol protease, UBL conjugation pathway, structural genomics; 2.10A {Homo sapiens} SCOP: a.118.23.1 | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.76 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.54 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.46 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.43 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.22 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.2 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.13 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.04 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.02 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.95 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.94 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.89 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.87 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.83 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.75 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.72 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.7 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.7 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.62 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.56 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.56 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.54 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.53 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.52 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.51 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.49 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.49 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.44 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.35 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.34 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.26 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.06 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.04 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 96.08 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.85 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 95.79 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 95.5 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.45 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 94.94 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.72 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 92.01 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 91.77 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 91.69 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 91.35 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 90.76 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 88.23 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 87.23 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 86.75 | |
| d2a9ua1 | 134 | Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Hum | 85.85 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 85.5 |
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.76 E-value=5.5e-09 Score=74.96 Aligned_cols=73 Identities=15% Similarity=0.211 Sum_probs=63.9
Q ss_pred hHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhhhCCCCce
Q 027539 127 DGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSS 206 (222)
Q Consensus 127 ~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~~~~~~~a 206 (222)
.|++.++.|+++.++|++++|.+.|.+|+.+... .+..+++.+.+|.+||.+|+.+|++++|+ .++ ++|
T Consensus 4 saddc~~lG~~~~~~g~y~~A~~~~~~Al~~~~~-~~~~~~~~~~~l~~Lg~~~~~~g~~~~A~----~~y------~~a 72 (95)
T d1tjca_ 4 TAEDSFELGKVAYTEADYYHTELWMEQALRQLDE-GEISTIDKVSVLDYLSYAVYQQGDLDKAL----LLT------KKL 72 (95)
T ss_dssp CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHT-TCCCSSCHHHHHHHHHHHHHHTTCHHHHH----HHH------HHH
T ss_pred cHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHhh-hhccCccHHHHHHHHhhHHHhcCChHHHH----HHH------HHH
Confidence 4677899999999999999999999999998865 45567788999999999999999999999 777 677
Q ss_pred EEEe
Q 027539 207 IIIT 210 (222)
Q Consensus 207 ~~i~ 210 (222)
+.+.
T Consensus 73 L~l~ 76 (95)
T d1tjca_ 73 LELD 76 (95)
T ss_dssp HHHC
T ss_pred HHhC
Confidence 7653
|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a9ua1 a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|