Citrus Sinensis ID: 027539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQRDI
ccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcEEccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccHcHccHHHHHHHHHHHHHHcccccccccHcHHHHHHHHHHHHHHccEEEEccccccccccccHHHHEEEccEEEcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHcHEEEEEccHHHHccccc
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFgccemedeqswnEDHILRLQWLRTFLgrrfgwslKDEFQHLRKISILRGLChkvglelvprdydmdcpnpftrddivsmvpvckhvgctsadgrtlLESSKialdkgkledaVNYGTKALARMIAVcgpyhrttaSTYSLLAVVLYHtgdfnqvrqSSVVFQcqlgdskssiIITSFCTEVLIQRDI
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGctsadgrtllesskialdkgkledAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQlgdskssiiitsfctevliqrdi
MVTQAFKHVLNGVIASVDYlsdlsaaiasslNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQRDI
****AFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLI****
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEM************RLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQRDI
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQRDI
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMEDEQSWNEDHILRLQWLRTFLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSSIIITSFCTEVLIQRDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
F4J5S1 1407 Clustered mitochondria pr no no 0.477 0.075 0.372 1e-16
O15818 1320 Clustered mitochondria pr yes no 0.837 0.140 0.272 9e-14
B0W2S0 1377 Clustered mitochondria pr N/A no 0.5 0.080 0.309 5e-11
Q0IHW8 1296 Clustered mitochondria pr yes no 0.531 0.091 0.308 2e-10
B4MY63 1441 Protein clueless OS=Droso N/A no 0.599 0.092 0.278 7e-10
Q17N71 1442 Clustered mitochondria pr N/A no 0.545 0.083 0.285 2e-09
B4KT50 1487 Protein clueless OS=Droso N/A no 0.599 0.089 0.278 6e-09
Q7PZD5 1463 Clustered mitochondria pr yes no 0.545 0.082 0.293 8e-09
B4LQ23 1465 Protein clueless OS=Droso N/A no 0.599 0.090 0.278 8e-09
B4JW99 1494 Protein clueless OS=Droso N/A no 0.590 0.087 0.275 9e-09
>sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%)

Query: 77   RKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCKHVGCTSADGRTLLESSK 136
            +K+S+LR LC KVG+ +  R YD     PF   DI+ + PV KH     ++ + L+E  K
Sbjct: 974  KKVSVLRNLCQKVGVSIAARKYDFSANTPFETSDILDLRPVIKHSVPVCSEAKDLVEMGK 1033

Query: 137  IALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDF 186
            + L +G L ++  + ++A + +  V GP HR  A+    LA+VLYH GD 
Sbjct: 1034 VQLAEGMLSESYTFFSEAFSILQQVTGPMHREVANCCRYLAMVLYHAGDM 1083




Involved in proper cytoplasmic distribution of mitochondria.
Arabidopsis thaliana (taxid: 3702)
>sp|O15818|CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum GN=clua PE=1 SV=2 Back     alignment and function description
>sp|B0W2S0|CLU_CULQU Clustered mitochondria protein homolog OS=Culex quinquefasciatus GN=CPIJ001445 PE=3 SV=1 Back     alignment and function description
>sp|Q0IHW8|CLU_XENTR Clustered mitochondria protein homolog OS=Xenopus tropicalis GN=cluh PE=2 SV=1 Back     alignment and function description
>sp|B4MY63|CLU_DROWI Protein clueless OS=Drosophila willistoni GN=clu PE=3 SV=1 Back     alignment and function description
>sp|Q17N71|CLU_AEDAE Clustered mitochondria protein homolog OS=Aedes aegypti GN=AAEL000794 PE=3 SV=1 Back     alignment and function description
>sp|B4KT50|CLU_DROMO Protein clueless OS=Drosophila mojavensis GN=clu PE=3 SV=1 Back     alignment and function description
>sp|Q7PZD5|CLU_ANOGA Clustered mitochondria protein homolog OS=Anopheles gambiae GN=AGAP011851 PE=3 SV=4 Back     alignment and function description
>sp|B4LQ23|CLU_DROVI Protein clueless OS=Drosophila virilis GN=clu PE=3 SV=1 Back     alignment and function description
>sp|B4JW99|CLU_DROGR Protein clueless OS=Drosophila grimshawi GN=clu PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
359482723 1702 PREDICTED: protein KIAA0664 homolog [Vit 0.851 0.111 0.8 1e-89
147802928 1658 hypothetical protein VITISV_010381 [Viti 0.851 0.113 0.8 1e-89
297743499 1262 unnamed protein product [Vitis vinifera] 0.851 0.149 0.8 7e-89
255553265 1454 eukaryotic translation initiation factor 0.851 0.129 0.784 3e-86
356528968 1640 PREDICTED: uncharacterized protein LOC10 0.851 0.115 0.738 1e-81
357468145 1663 Tetratricopeptide-like helical domain-co 0.851 0.113 0.726 2e-81
357468149 1158 Tetratricopeptide-like helical domain-co 0.851 0.163 0.726 1e-80
357468147 1120 Tetratricopeptide-like helical domain-co 0.851 0.168 0.726 1e-80
356522331 1676 PREDICTED: protein TIF31 homolog [Glycin 0.851 0.112 0.732 1e-80
449436621 1689 PREDICTED: clustered mitochondria protei 0.851 0.111 0.75 4e-80
>gi|359482723|ref|XP_003632816.1| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (90%), Gaps = 1/190 (0%)

Query: 1   MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMED-EQSWNEDHILRLQWLRT 59
           MVT+AFKHVL  V+ SV+ ++DL AAIASSLNFL GCC MED +Q+   +++++LQWL+T
Sbjct: 743 MVTRAFKHVLKAVVRSVENVADLPAAIASSLNFLLGCCTMEDSDQNSRHENVVKLQWLKT 802

Query: 60  FLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCK 119
           FL RRFGW+LKDEF+HLRK SILRGLC KVGLELVPRDYDM+CPNPF + DI+SMVPVCK
Sbjct: 803 FLTRRFGWTLKDEFKHLRKFSILRGLCQKVGLELVPRDYDMECPNPFRKHDIISMVPVCK 862

Query: 120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVV 179
           HVGC+SADGRTLLESSKIALDKGKLEDAVNYGTKALA+MIAVCGPYHRTTAS YSLLAVV
Sbjct: 863 HVGCSSADGRTLLESSKIALDKGKLEDAVNYGTKALAKMIAVCGPYHRTTASAYSLLAVV 922

Query: 180 LYHTGDFNQV 189
           LYHTGDFNQ 
Sbjct: 923 LYHTGDFNQA 932




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147802928|emb|CAN72877.1| hypothetical protein VITISV_010381 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743499|emb|CBI36366.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553265|ref|XP_002517675.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223543307|gb|EEF44839.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356528968|ref|XP_003533069.1| PREDICTED: uncharacterized protein LOC100801625 [Glycine max] Back     alignment and taxonomy information
>gi|357468145|ref|XP_003604357.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505412|gb|AES86554.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468149|ref|XP_003604359.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505414|gb|AES86556.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468147|ref|XP_003604358.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] gi|355505413|gb|AES86555.1| Tetratricopeptide-like helical domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356522331|ref|XP_003529800.1| PREDICTED: protein TIF31 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449436621|ref|XP_004136091.1| PREDICTED: clustered mitochondria protein homolog [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2037783 1608 AT1G15290 [Arabidopsis thalian 0.846 0.116 0.656 2.1e-62
TAIR|locus:2035327 1797 AT1G01320 [Arabidopsis thalian 0.842 0.104 0.537 6.5e-48
DICTYBASE|DDB_G0292806 1320 cluA "CluA protein" [Dictyoste 0.495 0.083 0.327 1.6e-12
ZFIN|ZDB-GENE-030131-9913 1357 si:ch211-166a6.5 "si:ch211-166 0.490 0.080 0.351 5e-11
UNIPROTKB|B4MY63 1441 clu "Protein clueless" [Drosop 0.599 0.092 0.285 8e-10
UNIPROTKB|B4KT50 1487 clu "Protein clueless" [Drosop 0.599 0.089 0.285 2.2e-08
UNIPROTKB|B4LQ23 1465 clu "Protein clueless" [Drosop 0.599 0.090 0.285 3.6e-08
UNIPROTKB|B4JW99 1494 clu "Protein clueless" [Drosop 0.590 0.087 0.282 5.3e-08
UNIPROTKB|B4GAM1 1435 clu "Protein clueless" [Drosop 0.599 0.092 0.271 7.2e-08
UNIPROTKB|Q291J5 1435 clu "Protein clueless" [Drosop 0.599 0.092 0.271 7.2e-08
TAIR|locus:2037783 AT1G15290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 650 (233.9 bits), Expect = 2.1e-62, P = 2.1e-62
 Identities = 124/189 (65%), Positives = 145/189 (76%)

Query:     1 MVTQAFKHVLNGVIASVDYXXXXXXXXXXXXNFLFGCCEMED-EQSWNEDHILRLQWLRT 59
             M+T+AFKH+L  VIASV+             NF+ G  E+E  ++   E++ LRLQWL+ 
Sbjct:   720 MITRAFKHLLRAVIASVNNMAELPVAVAASLNFMLGRRELEGCDRIPGEEYCLRLQWLQK 779

Query:    60 FLGRRFGWSLKDEFQHLRKISILRGLCHKVGLELVPRDYDMDCPNPFTRDDIVSMVPVCK 119
             FL R+FGW  KDEF HL+K SILRGLC KVGLELV RD+D D PNPF   DI+ +VPVCK
Sbjct:   780 FLSRKFGWIQKDEFHHLKKFSILRGLCQKVGLELVSRDFDFDSPNPFMSSDIIGLVPVCK 839

Query:   120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVV 179
             HV C S+DGRTLLESSK+ALDKGKL+DAV+YGTKAL +MIAVCGPYHR TA  YSLLAVV
Sbjct:   840 HVLCISSDGRTLLESSKLALDKGKLDDAVSYGTKALVKMIAVCGPYHRNTACAYSLLAVV 899

Query:   180 LYHTGDFNQ 188
             LYHTGDFNQ
Sbjct:   900 LYHTGDFNQ 908




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2035327 AT1G01320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292806 cluA "CluA protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9913 si:ch211-166a6.5 "si:ch211-166a6.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4MY63 clu "Protein clueless" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B4KT50 clu "Protein clueless" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4LQ23 clu "Protein clueless" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4JW99 clu "Protein clueless" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4GAM1 clu "Protein clueless" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q291J5 clu "Protein clueless" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
pfam12807169 pfam12807, eIF3_p135, Translation initiation facto 2e-25
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-04
>gnl|CDD|221783 pfam12807, eIF3_p135, Translation initiation factor eIF3 subunit 135 Back     alignment and domain information
 Score = 97.1 bits (242), Expect = 2e-25
 Identities = 38/122 (31%), Positives = 57/122 (46%), Gaps = 22/122 (18%)

Query: 1   MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEM----------------EDEQ 44
           M+ +A KH+L   +  V    DLSAAI+  LN L G                    ED+ 
Sbjct: 49  MIARAAKHILRTYLRGVP-APDLSAAISHFLNCLLGSESNPDPEAEIDESRSASYPEDDF 107

Query: 45  SW-NEDHILRLQWLRTFLGRRFGWSLKDEF----QHLRKISILRGLCHKVGLELVPRDYD 99
           +W           +      RF + LK+++      L+KIS+LR +C KVG++L+ R+YD
Sbjct: 108 AWEKLTPEELWSEIEKEAKDRFRYELKEDWKDEQYGLQKISLLREICLKVGIQLLLREYD 167

Query: 100 MD 101
            D
Sbjct: 168 FD 169


Translation initiation factor eIF3 is a multi-subunit protein complex required for initiation of protein biosynthesis in eukaryotic cells. The complex promotes ribosome dissociation, the binding of the initiator methionyl-tRNA to the 40 S ribosomal subunit, and mRNA recruitment to the ribosome. The protein product from TIF31 genes in yeast is p135 which associates with the eIF3 but does not seem to be necessary for protein translation initiation. Length = 169

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 100.0
PF12807169 eIF3_p135: Translation initiation factor eIF3 subu 99.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.27
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 99.12
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.95
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 97.94
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.8
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.8
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.45
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.39
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.31
PRK15359144 type III secretion system chaperone protein SscB; 97.22
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.22
KOG0553 304 consensus TPR repeat-containing protein [General f 97.21
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 97.14
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.1
PF1337173 TPR_9: Tetratricopeptide repeat 97.02
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.97
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.96
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.95
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.89
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.84
PRK15359144 type III secretion system chaperone protein SscB; 96.83
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.8
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.74
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.7
PRK11189 296 lipoprotein NlpI; Provisional 96.69
PF12688120 TPR_5: Tetratrico peptide repeat 96.66
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.64
PRK10370198 formate-dependent nitrite reductase complex subuni 96.61
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.54
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 96.5
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.47
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.42
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.42
PRK11189 296 lipoprotein NlpI; Provisional 96.39
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.31
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.27
PRK12370 553 invasion protein regulator; Provisional 96.26
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.11
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.07
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.0
PRK10803263 tol-pal system protein YbgF; Provisional 95.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.85
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 95.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.56
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 95.54
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.47
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.43
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.41
PF1343134 TPR_17: Tetratricopeptide repeat 95.4
PRK11788 389 tetratricopeptide repeat protein; Provisional 95.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.19
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 95.16
PRK04841 903 transcriptional regulator MalT; Provisional 95.14
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.14
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.1
PRK10803263 tol-pal system protein YbgF; Provisional 95.09
KOG4563 400 consensus Cell cycle-regulated histone H1-binding 95.08
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.06
PRK11788 389 tetratricopeptide repeat protein; Provisional 95.0
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.99
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.9
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.78
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 94.56
COG4105 254 ComL DNA uptake lipoprotein [General function pred 94.55
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.46
PRK10153517 DNA-binding transcriptional activator CadC; Provis 94.32
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.24
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 94.23
PRK10747398 putative protoheme IX biogenesis protein; Provisio 94.16
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.15
PF13512142 TPR_18: Tetratricopeptide repeat 94.13
PRK12370553 invasion protein regulator; Provisional 94.05
KOG4555175 consensus TPR repeat-containing protein [Function 93.98
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 93.86
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 93.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 93.65
PF12688120 TPR_5: Tetratrico peptide repeat 93.6
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 93.43
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.29
KOG2076 895 consensus RNA polymerase III transcription factor 93.0
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.89
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.64
PRK15331165 chaperone protein SicA; Provisional 92.51
KOG0547 606 consensus Translocase of outer mitochondrial membr 92.32
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 92.07
PF1342844 TPR_14: Tetratricopeptide repeat 92.03
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 91.99
PRK04841 903 transcriptional regulator MalT; Provisional 91.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 91.8
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 91.55
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 91.35
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 91.15
KOG2076 895 consensus RNA polymerase III transcription factor 91.06
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 90.69
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 90.55
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 90.51
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.47
PF0421269 MIT: MIT (microtubule interacting and transport) d 90.26
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 90.16
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.13
PF09311181 Rab5-bind: Rabaptin-like protein; InterPro: IPR015 90.11
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 90.03
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 89.4
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.38
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 89.13
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.78
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 88.65
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 88.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 88.39
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 88.35
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 88.25
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 87.99
PF03704146 BTAD: Bacterial transcriptional activator domain; 87.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 87.9
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 87.76
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.74
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 87.63
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.61
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 87.56
PRK14574 822 hmsH outer membrane protein; Provisional 87.53
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 87.16
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 87.06
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 86.98
KOG1126638 consensus DNA-binding cell division cycle control 86.88
COG4235287 Cytochrome c biogenesis factor [Posttranslational 86.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 86.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 86.74
PF1286294 Apc5: Anaphase-promoting complex subunit 5 86.46
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.44
KOG0553 304 consensus TPR repeat-containing protein [General f 86.23
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 86.18
COG4783484 Putative Zn-dependent protease, contains TPR repea 85.41
cd0265675 MIT MIT: domain contained within Microtubule Inter 85.17
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 85.06
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 85.0
KOG2003 840 consensus TPR repeat-containing protein [General f 84.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 84.84
KOG0547 606 consensus Translocase of outer mitochondrial membr 84.64
KOG2376 652 consensus Signal recognition particle, subunit Srp 84.64
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 84.6
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 84.29
PF1342844 TPR_14: Tetratricopeptide repeat 83.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 83.21
PF08969115 USP8_dimer: USP8 dimerisation domain; InterPro: IP 83.14
smart0074577 MIT Microtubule Interacting and Trafficking molecu 82.45
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 82.34
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 82.14
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.63
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.59
PRK11906458 transcriptional regulator; Provisional 81.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.55
KOG4555175 consensus TPR repeat-containing protein [Function 80.52
KOG4340 459 consensus Uncharacterized conserved protein [Funct 80.47
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 80.35
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.6e-34  Score=290.88  Aligned_cols=204  Identities=22%  Similarity=0.244  Sum_probs=185.5

Q ss_pred             CchhhhhHHHHHHhhcCCCCCchHHHHHHHhhhhcCCCCCCC------cccc--c-----------------------ch
Q 027539            1 MVTQAFKHVLNGVIASVDYLSDLSAAIASSLNFLFGCCEMED------EQSW--N-----------------------ED   49 (222)
Q Consensus         1 mi~RaaKHilr~~l~~~~~~~~~~~~iahfLNcLlg~~~~~~------d~~~--k-----------------------~~   49 (222)
                      +++|++||||+.+++.++. ..+++++||||||+||.-.+..      ++..  +                       ..
T Consensus       765 i~~RslKhvlK~~~r~l~~-~~i~ta~SH~ln~~ls~~~~av~~~~t~~~~~ka~~~~~~~~~~g~~k~~~S~~s~~~l~  843 (1236)
T KOG1839|consen  765 IALRSLKHVLKDNLRLLGA-DHIQTAASHALNCLLSVMEAAVQKEQTTLEILKAKDLRTQDAAAGTPKPDASISSKGHLS  843 (1236)
T ss_pred             HHHHHHHHHHHHHHhhcch-hHHHHHHHHHHHHHhhcccccCCCccchHHHHhhhhhhhhhhccCCCCcccccccccccc
Confidence            4789999999999999995 8999999999999999754322      1100  1                       12


Q ss_pred             hhhhHHHHHHHhccccccccccccc-------chhhHHHHHHHHHHHceeeeccccCCCC-C--CCCCcCCccccccccc
Q 027539           50 HILRLQWLRTFLGRRFGWSLKDEFQ-------HLRKISILRGLCHKVGLELVPRDYDMDC-P--NPFTRDDIVSMVPVCK  119 (222)
Q Consensus        50 ~~~~~~~i~~~v~~rfry~L~~~~~-------~~~k~~lLR~ic~K~GIQl~~rdY~f~~-~--~~F~~~DI~ni~PvVK  119 (222)
                      .+.+|.||+...+.+|++..+.+..       +.+++++.|..|.|.|||..+|+|+|++ +  ++|..+||+|+.|+||
T Consensus       844 ~s~L~~~I~~d~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~r~~~~e~~~~ks~f~~~Di~~~~p~ik  923 (1236)
T KOG1839|consen  844 VSDLLKYITADSKNKFTAAHDVKSRETILLKNGKSKIAVEKLEKKKRELQKPARNYDFESSEPKSEFNDSDILNLRPVIK  923 (1236)
T ss_pred             hhHHHHhccccccccccchhhhhHHHHHhhhcccchhHHHHHHHHhhhcchhhhhccccccCCCCCCCcccccccccccc
Confidence            5678999999999999999986432       6789999999999999999999999998 4  7999999999999999


Q ss_pred             ccccCchhHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhh
Q 027539          120 HVGCTSADGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQ  199 (222)
Q Consensus       120 ~~~p~s~~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~  199 (222)
                      |+.|.++++++.+|+|+..+++|.+.+|++ ..++++++++++|.+||+++.||..||++|+++||+++|+    .+|  
T Consensus       924 ~s~P~~~~a~~~~e~gq~~~~e~~~~~~~~-~~~slnl~~~v~~~~h~~~~~~~~~La~l~~~~~d~~~Ai----~~~--  996 (1236)
T KOG1839|consen  924 HSSPTVSEAKDSPEQGQEALLEDGFSEAYE-LPESLNLLNNVMGVLHPEVASKYRSLAKLSNRLGDNQEAI----AQQ--  996 (1236)
T ss_pred             cCCCccchhhhhhhhhhhhhcccchhhhhh-hhhhhhHHHHhhhhcchhHHHHHHHHHHHHhhhcchHHHH----Hhc--
Confidence            999999999999999999999999999999 9999999999999999999999999999999999999999    999  


Q ss_pred             hCCCCceEEEeeeechh
Q 027539          200 LGDSKSSIIITSFCTEV  216 (222)
Q Consensus       200 ~~~~~~a~~i~e~~~~~  216 (222)
                          .+|++|.||+.|.
T Consensus       997 ----~ka~ii~eR~~g~ 1009 (1236)
T KOG1839|consen  997 ----RKACIISERVLGK 1009 (1236)
T ss_pred             ----ccceeeechhccC
Confidence                8999999999875



>PF12807 eIF3_p135: Translation initiation factor eIF3 subunit 135 Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF09311 Rab5-bind: Rabaptin-like protein; InterPro: IPR015390 This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5 Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08969 USP8_dimer: USP8 dimerisation domain; InterPro: IPR015063 This domain is predominantly found in the amino terminal region of Ubiquitin carboxyl-terminal hydrolase 8 (USP8) Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 3e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-05
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 5e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-05
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 9e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-04
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-06
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-05
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 8e-04
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
 Score = 46.0 bits (110), Expect = 3e-06
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 140 DKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQ 188
           D+ K ++A +    ALA      G  H   A+T + LAV+    G + +
Sbjct: 55  DQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE 103


>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.39
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.31
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.19
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.91
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.44
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.42
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.31
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.21
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.18
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.14
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.07
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.04
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.03
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.0
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.95
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.95
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.94
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.94
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.92
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.91
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.9
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.89
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.88
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.87
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.86
3k9i_A117 BH0479 protein; putative protein binding protein, 97.86
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.86
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.83
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 97.83
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.82
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.82
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.78
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 97.78
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.77
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.76
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.74
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.73
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.73
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.7
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 97.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.68
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.67
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.65
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 97.64
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.63
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 97.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.58
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.58
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.58
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.56
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.55
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.54
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.51
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.49
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.49
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.46
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.44
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.42
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.42
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.41
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.4
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.4
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.38
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.35
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.32
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.31
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.27
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.27
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.26
3u4t_A 272 TPR repeat-containing protein; structural genomics 97.26
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 97.25
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 97.24
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.22
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.18
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 97.18
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.17
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.16
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.14
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.13
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.1
3k9i_A117 BH0479 protein; putative protein binding protein, 97.08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.08
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.03
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.0
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.99
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 96.99
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.98
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 96.98
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 96.98
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.97
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.93
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.92
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.9
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.9
3u4t_A272 TPR repeat-containing protein; structural genomics 96.87
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.86
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.86
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.84
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.8
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.8
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.8
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.77
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.68
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.62
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.59
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.58
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.58
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.57
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 96.56
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 96.56
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.52
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 96.52
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 96.48
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.47
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.4
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.31
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.28
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.86
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.68
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 95.43
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.31
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.88
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 94.87
3rjv_A 212 Putative SEL1 repeat protein; alpha-alpha superhel 94.68
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.86
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 93.83
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.59
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.92
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 92.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 92.58
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 91.34
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.24
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 90.92
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 90.78
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 90.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.39
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.23
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 89.78
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 89.71
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.38
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.16
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 88.94
1klx_A138 Cysteine rich protein B; structural genomics, heli 88.42
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 87.44
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 86.88
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 86.83
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 85.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 85.5
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 84.4
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 84.17
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 83.87
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 83.16
2a9u_A144 Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL 82.48
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 82.15
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 80.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 80.84
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 80.81
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.51
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 80.11
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
Probab=99.39  E-value=2.3e-13  Score=126.53  Aligned_cols=79  Identities=16%  Similarity=0.119  Sum_probs=73.4

Q ss_pred             hHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhhhCCCCce
Q 027539          127 DGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSS  206 (222)
Q Consensus       127 ~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~~~~~~~a  206 (222)
                      .+..+-+.|.++..+|++++|.+++.+||.++++++|+.||+||..|++||.+|..+|++++|+    .++      ++|
T Consensus       339 ~a~~~~nLa~~y~~~g~~~eA~~~~~~aL~i~~~~lG~~Hp~~a~~l~nLa~~~~~qg~~~eA~----~~~------~~A  408 (433)
T 3qww_A          339 MLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGE----KAL------KKA  408 (433)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHSCSSCHHHHHHHHHHHHHHHHTTCHHHHH----HHH------HHH
T ss_pred             HHHHHHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHhccCHHHHH----HHH------HHH
Confidence            4555566699999999999999999999999999999999999999999999999999999999    888      799


Q ss_pred             EEEeeeech
Q 027539          207 IIITSFCTE  215 (222)
Q Consensus       207 ~~i~e~~~~  215 (222)
                      +.|.|++.|
T Consensus       409 l~i~~~~lG  417 (433)
T 3qww_A          409 IAIMEVAHG  417 (433)
T ss_dssp             HHHHHHHTC
T ss_pred             HHHHHHHcC
Confidence            999998876



>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2a9u_A Ubiquitin carboxyl-terminal hydrolase 8; coil-COIL, protease, SH3-binding, thiol protease, UBL conjugation pathway, structural genomics; 2.10A {Homo sapiens} SCOP: a.118.23.1 Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.76
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 98.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.2
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.04
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.02
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.95
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.94
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.89
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.87
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.83
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.75
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.72
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.7
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.56
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.56
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.54
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.52
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.49
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.49
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.44
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.35
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.34
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.26
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.06
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 96.08
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 95.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.79
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.5
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.45
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.94
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.72
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 92.01
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 91.77
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 91.69
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 91.35
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 90.76
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 88.23
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 87.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 86.75
d2a9ua1134 Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Hum 85.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 85.5
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Prolyl 4-hydroxylase alpha-1 subunit, P4HA1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.76  E-value=5.5e-09  Score=74.96  Aligned_cols=73  Identities=15%  Similarity=0.211  Sum_probs=63.9

Q ss_pred             hHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHcCChhhHhhchHHhhhhhCCCCce
Q 027539          127 DGRTLLESSKIALDKGKLEDAVNYGTKALARMIAVCGPYHRTTASTYSLLAVVLYHTGDFNQVRQSSVVFQCQLGDSKSS  206 (222)
Q Consensus       127 ~a~~lle~g~~~l~qG~~e~A~~L~~eAL~i~eqV~G~~HpevA~~y~~LA~vy~~~Gd~~eAi~~~~~~~~~~~~~~~a  206 (222)
                      .|++.++.|+++.++|++++|.+.|.+|+.+... .+..+++.+.+|.+||.+|+.+|++++|+    .++      ++|
T Consensus         4 saddc~~lG~~~~~~g~y~~A~~~~~~Al~~~~~-~~~~~~~~~~~l~~Lg~~~~~~g~~~~A~----~~y------~~a   72 (95)
T d1tjca_           4 TAEDSFELGKVAYTEADYYHTELWMEQALRQLDE-GEISTIDKVSVLDYLSYAVYQQGDLDKAL----LLT------KKL   72 (95)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHT-TCCCSSCHHHHHHHHHHHHHHTTCHHHHH----HHH------HHH
T ss_pred             cHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHhh-hhccCccHHHHHHHHhhHHHhcCChHHHH----HHH------HHH
Confidence            4677899999999999999999999999998865 45567788999999999999999999999    777      677


Q ss_pred             EEEe
Q 027539          207 IIIT  210 (222)
Q Consensus       207 ~~i~  210 (222)
                      +.+.
T Consensus        73 L~l~   76 (95)
T d1tjca_          73 LELD   76 (95)
T ss_dssp             HHHC
T ss_pred             HHhC
Confidence            7653



>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a9ua1 a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure