Citrus Sinensis ID: 027557


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNIVDKVNDSSNNADDTIKVHMEKKRVGTRETNDKLSNEEIQWSKSDSAAGKKLKKKSKQKEGELDAIDDAKNQSKWF
cccccccccccccccccccccHHccccccccEEcccccccccccccccccccccEEEcccccccccHHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHcHHHHHHccccHHHHHHcccccHHHHHHHcHHHHHHHccccc
cccccccccHEEccccHHHccHHHHHHHHccEEEccccHHHHccccHHHHHHHHHHHHccccHccccHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHcccccccHcccHHHHHHHHHHccccEEEccccccHHHHHHHccccccccccHccccccHHHHHHHHHHcccccccccccHHHHHcccccHHHcHcccccccccccccEHHccccccccc
mlfgirdcpavlsrnpireiGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKlqnldlgkNLITRWSELKVLKSLVSLnnlnlqgnpvAEYDKLAKKVKNLLpslhifnarpinritknekdnivdkvndssnnaddtIKVHMEkkrvgtretndklsneeiqwsksdsaaGKKLKKKskqkegeldaiddaknqskwf
mlfgirdcpavlsrnpIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLpslhifnarpinritknekdnivdkvndssnnaddtikvhmekkrvgtretndklsneeiqwsksdsaagkklkkkskqkegeldaiddaknqskwf
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSElkvlkslvslnnlnlQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNIVDKVNDSSNNADDTIKVHMEKKRVGTRETNDKLSNEEIQWsksdsaagkklkkkskqkegeldAIDDAKNQSKWF
**FGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRIT**********************************************************************************
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARP*************************************************************************************W*
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNIVDKVNDSSNNADDTIKVHMEKKRVGTRETNDKLSNEEIQWS********************LDAIDDAKNQSKWF
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPIN*I***********************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFGIRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELAFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNIVDKVNDSSNNADDTIKVHMEKKRVGTRETNDKLSNEEIQWSKSDSAAGKKxxxxxxxxxxxxxxxxxxxxxSKWF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
Q80VQ1 524 Leucine-rich repeat-conta yes no 0.445 0.188 0.326 5e-06
Q4H4B6 1724 Protein scribble homolog no no 0.445 0.057 0.307 9e-06
Q14160 1630 Protein scribble homolog yes no 0.423 0.057 0.323 2e-05
B3DH20 440 Protein TILB homolog OS=D no no 0.761 0.384 0.285 2e-05
Q80U72 1612 Protein scribble homolog no no 0.423 0.058 0.323 3e-05
B5DX45 629 Leucine-rich repeat prote no no 0.527 0.186 0.336 3e-05
Q1ZXD6 2800 Probable serine/threonine no no 0.459 0.036 0.339 3e-05
Q9BTT6 524 Leucine-rich repeat-conta no no 0.445 0.188 0.307 4e-05
Q6UXK2 745 Immunoglobulin superfamil no no 0.509 0.151 0.319 6e-05
B4PU77 645 Leucine-rich repeat prote N/A no 0.427 0.147 0.329 6e-05
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 11  VLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAEL 70
           +L  N +RE+ +    +  + KL LS+ ++Q +   + +  +L EL ++ NDI  +P  +
Sbjct: 42  LLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESI 101

Query: 71  AFNKKLQNLDLGKNLITR----WSELKVLKSLVSLNNLNLQGNP 110
           AF K LQ  D   N +TR    + EL+ L  L S+N+++LQ  P
Sbjct: 102 AFCKALQVADFSGNPLTRLPESFPELQNLTCL-SVNDISLQSLP 144





Mus musculus (taxid: 10090)
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|B3DH20|TILB_DANRE Protein TILB homolog OS=Danio rerio GN=lrrc6 PE=1 SV=1 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|Q6UXK2|ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens GN=ISLR2 PE=2 SV=1 Back     alignment and function description
>sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
224131776 474 predicted protein [Populus trichocarpa] 0.932 0.436 0.568 4e-56
359479546 446 PREDICTED: protein phosphatase 1 regulat 0.747 0.372 0.656 3e-52
449443646 478 PREDICTED: leucine-rich repeat-containin 0.896 0.416 0.524 9e-47
255565717 485 Protein phosphatase 1 regulatory subunit 0.590 0.270 0.732 6e-46
388511123 474 unknown [Lotus japonicus] 0.653 0.305 0.655 7e-46
357453175 468 Protein phosphatase 1 regulatory subunit 0.824 0.391 0.529 2e-44
217074948 468 unknown [Medicago truncatula] gi|3885080 0.824 0.391 0.523 7e-44
147772156 560 hypothetical protein VITISV_001509 [Viti 0.747 0.296 0.480 3e-42
356543614 471 PREDICTED: protein phosphatase 1 regulat 0.653 0.307 0.648 7e-41
359806683 472 uncharacterized protein LOC100782829 [Gl 0.842 0.396 0.52 1e-40
>gi|224131776|ref|XP_002328105.1| predicted protein [Populus trichocarpa] gi|222837620|gb|EEE75985.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 121/213 (56%), Positives = 155/213 (72%), Gaps = 6/213 (2%)

Query: 11  VLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAEL 70
           VLSRNPIREIG+SL  +K++TKLSLSNC +Q IGSSLKSC ELKELRLAHNDIKTLPAEL
Sbjct: 135 VLSRNPIREIGESLFKVKSMTKLSLSNCHLQTIGSSLKSCIELKELRLAHNDIKTLPAEL 194

Query: 71  AFNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHI 130
           A+NKKLQNLDLG NLITRWS++KVL SLV L NLNL GNP+AE  K+ KKV+  LP+LHI
Sbjct: 195 AYNKKLQNLDLGNNLITRWSDVKVLSSLVDLKNLNLLGNPIAENAKITKKVQKFLPNLHI 254

Query: 131 FNARPINRITKNEKDNIVDKVNDSSNNADDTIKVHMEKKRVGTRETNDKLSNEEIQWSKS 190
           FNARP+++  +NE   I  + +DSS    + +  H EKK+  TR+ N      + +    
Sbjct: 255 FNARPVDKSARNE---ISGRADDSSLIPTNELDYHSEKKKDHTRDVNSSKHVTDQRRDHF 311

Query: 191 DSA---AGKKLKKKSKQKEGELDAIDDAKNQSK 220
           D+A   A K L++K K+ +G++  +++A    K
Sbjct: 312 DNASDDAEKDLRQKRKKTKGKVSKMEEASTDEK 344




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359479546|ref|XP_002273076.2| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Vitis vinifera] gi|296084874|emb|CBI28283.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443646|ref|XP_004139588.1| PREDICTED: leucine-rich repeat-containing protein 9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255565717|ref|XP_002523848.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] gi|223536936|gb|EEF38574.1| Protein phosphatase 1 regulatory subunit SDS22, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388511123|gb|AFK43623.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357453175|ref|XP_003596864.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] gi|355485912|gb|AES67115.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|217074948|gb|ACJ85834.1| unknown [Medicago truncatula] gi|388508012|gb|AFK42072.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147772156|emb|CAN69048.1| hypothetical protein VITISV_001509 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356543614|ref|XP_003540255.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Glycine max] Back     alignment and taxonomy information
>gi|359806683|ref|NP_001241543.1| uncharacterized protein LOC100782829 [Glycine max] gi|255641324|gb|ACU20939.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2176397452 AT5G22320 [Arabidopsis thalian 0.783 0.384 0.442 1.7e-34
UNIPROTKB|H3BNZ6138 ISLR2 "Immunoglobulin superfam 0.328 0.528 0.341 1.5e-05
TAIR|locus:2032040681 AT1G78230 [Arabidopsis thalian 0.707 0.230 0.299 1.8e-05
MGI|MGI:1924557337 Lrrc39 "leucine rich repeat co 0.342 0.225 0.402 5.3e-05
UNIPROTKB|H3BM69114 ISLR2 "Immunoglobulin superfam 0.310 0.605 0.342 6.1e-05
MGI|MGI:2442313 524 Lrrc1 "leucine rich repeat con 0.364 0.154 0.320 8.1e-05
ZFIN|ZDB-GENE-060503-289 575 lrrc47 "leucine rich repeat co 0.531 0.205 0.270 9.2e-05
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.328 0.104 0.328 0.0001
UNIPROTKB|O61967 699 let-413 "Protein lap1" [Caenor 0.328 0.104 0.328 0.0001
ZFIN|ZDB-GENE-030616-572 1724 scrib "scribbled homolog (Dros 0.346 0.044 0.324 0.00012
TAIR|locus:2176397 AT5G22320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 81/183 (44%), Positives = 125/183 (68%)

Query:    11 VLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAEL 70
             VLSRNPI EIGDSL  +K ++K+SLS+C+++ IGSSLKSC++LKELRLA+N+IK LPAEL
Sbjct:   135 VLSRNPISEIGDSLSKLKNLSKISLSDCRIKAIGSSLKSCSDLKELRLANNEIKALPAEL 194

Query:    71 AFNKKLQNLDLGKNLITRWSEXXXXXXXXXXXXXXXQGNPVAEYDKLAKKVKNLL-PSLH 129
             A NK+L NLD+G N+IT+ S                +GNP+++ DK AKKV+ LL PS++
Sbjct:   195 AVNKRLLNLDVGNNVITQLSGLEVLGTLSCLRNLNIRGNPISDNDKSAKKVRTLLLPSVN 254

Query:   130 IFNARPINRITKNEKD---NIVDKVNDSSNNA---DDTIKVHMEKKRVGTRETNDK--LS 181
             +FNA+P+ + ++N K    +  D+  D+ +N    ++  K   ++K+   R  +++  ++
Sbjct:   255 VFNAQPLEKSSRNAKHIRLDTDDETFDAYHNKSAEEEQSKEDRKRKKSSKRNKSEEEEVN 314

Query:   182 NEE 184
             NE+
Sbjct:   315 NED 317




GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
UNIPROTKB|H3BNZ6 ISLR2 "Immunoglobulin superfamily-containing leucine-rich repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2032040 AT1G78230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1924557 Lrrc39 "leucine rich repeat containing 39" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H3BM69 ISLR2 "Immunoglobulin superfamily-containing leucine-rich repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2442313 Lrrc1 "leucine rich repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-289 lrrc47 "leucine rich repeat containing 47" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O61967 let-413 "Protein lap1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-572 scrib "scribbled homolog (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 48.4 bits (115), Expect = 8e-07
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 2/113 (1%)

Query: 12  LSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELA 71
           LS N I  +   L N+  +  L LS   +  +   L + + L  L L+ N I  LP E+ 
Sbjct: 147 LSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIE 206

Query: 72  FNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNL 124
               L+ LDL  N I     L  L +L +L+ L L  N + +  +    + NL
Sbjct: 207 LLSALEELDLSNNSII--ELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNL 257


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.53
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.48
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.44
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.42
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.4
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.38
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.36
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.27
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.27
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.27
PLN03150623 hypothetical protein; Provisional 99.25
KOG4237498 consensus Extracellular matrix protein slit, conta 99.24
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.24
KOG2123 388 consensus Uncharacterized conserved protein [Funct 99.22
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.15
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.13
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 99.08
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 99.02
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.02
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.01
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.94
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.92
PLN03150623 hypothetical protein; Provisional 98.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.9
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.88
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.79
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.73
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.72
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.57
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.34
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 98.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.92
PRK15386 426 type III secretion protein GogB; Provisional 97.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.74
KOG0473326 consensus Leucine-rich repeat protein [Function un 97.73
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 97.71
PRK15386 426 type III secretion protein GogB; Provisional 97.68
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.3
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.12
KOG0473326 consensus Leucine-rich repeat protein [Function un 97.08
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.05
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.77
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.52
smart0037026 LRR Leucine-rich repeats, outliers. 95.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.74
smart0037026 LRR Leucine-rich repeats, outliers. 95.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.59
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.94
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 92.71
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.38
KOG4308478 consensus LRR-containing protein [Function unknown 90.2
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 86.34
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.08
smart0044626 LRRcap occurring C-terminal to leucine-rich repeat 83.86
KOG4308478 consensus LRR-containing protein [Function unknown 83.79
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.72
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
Probab=99.90  E-value=4.5e-24  Score=159.23  Aligned_cols=144  Identities=30%  Similarity=0.399  Sum_probs=74.4

Q ss_pred             CCccEEEeecCCCccchhhhc-CCCCCcEEEcccCCCccccccccCCccCCEEecccCcCCcCchhh-hCCCCCceeecc
Q 027557            5 IRDCPAVLSRNPIREIGDSLL-NMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAEL-AFNKKLQNLDLG   82 (222)
Q Consensus         5 ~~~~~L~L~~n~l~~lp~~~~-~l~~L~~L~L~~n~i~~lp~~~~~l~~L~~L~l~~N~i~~lp~~~-~~l~~L~~L~L~   82 (222)
                      ..+++|+|++|.|+.| +.+. .+.+|+.|+|++|.|+.++ ++..+++|+.|++++|+|+.+++.+ ..+++|++|+|+
T Consensus        19 ~~~~~L~L~~n~I~~I-e~L~~~l~~L~~L~Ls~N~I~~l~-~l~~L~~L~~L~L~~N~I~~i~~~l~~~lp~L~~L~L~   96 (175)
T PF14580_consen   19 VKLRELNLRGNQISTI-ENLGATLDKLEVLDLSNNQITKLE-GLPGLPRLKTLDLSNNRISSISEGLDKNLPNLQELYLS   96 (175)
T ss_dssp             ------------------S--TT-TT--EEE-TTS--S--T-T----TT--EEE--SS---S-CHHHHHH-TT--EEE-T
T ss_pred             cccccccccccccccc-cchhhhhcCCCEEECCCCCCcccc-CccChhhhhhcccCCCCCCccccchHHhCCcCCEEECc
Confidence            4568999999999998 4565 5889999999999999998 7899999999999999999997665 468999999999


Q ss_pred             CCccCCCcchHhhcCCCCCCEEEeeCCCCCCchhHHHHHHHhCCccccccCCCCChhhHhhhHHHHhh
Q 027557           83 KNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNIVDK  150 (222)
Q Consensus        83 ~N~i~~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~~~~  150 (222)
                      +|+|.++..+..+..+++|+.|++.+||++..+.|+.+++..+|+|+.||+..++..++..+...+.+
T Consensus        97 ~N~I~~l~~l~~L~~l~~L~~L~L~~NPv~~~~~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~~f~~  164 (175)
T PF14580_consen   97 NNKISDLNELEPLSSLPKLRVLSLEGNPVCEKKNYRLFVIYKLPSLKVLDGQDVTEEERQEAEKLFKG  164 (175)
T ss_dssp             TS---SCCCCGGGGG-TT--EEE-TT-GGGGSTTHHHHHHHH-TT-SEETTEETTS-B----------
T ss_pred             CCcCCChHHhHHHHcCCCcceeeccCCcccchhhHHHHHHHHcChhheeCCEEccHHHhccccccccc
Confidence            99999999888899999999999999999999999999999999999999999999988887665543



>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00446 LRRcap occurring C-terminal to leucine-rich repeats Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 7e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-04
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
 Score = 91.7 bits (227), Expect = 9e-22
 Identities = 28/117 (23%), Positives = 62/117 (52%), Gaps = 2/117 (1%)

Query: 12  LSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELA 71
           L+   +  +   L  +  +T L LS+ +++ +  +L +   L+ L+ + N ++ +   +A
Sbjct: 448 LAHKDLTVL-CHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVD-GVA 505

Query: 72  FNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSL 128
              +LQ L L  N + + + ++ L S   L  LNLQGN + + + + +++  +LPS+
Sbjct: 506 NLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSV 562


>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.85
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.83
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.77
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.64
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.64
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.63
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.63
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.63
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.62
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.62
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.62
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.61
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.61
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.6
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.6
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.6
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.6
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.6
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.6
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.59
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.59
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.58
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.57
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.57
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.57
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.57
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.57
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.56
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.56
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.55
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.55
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.55
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.55
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.54
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.54
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.53
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.53
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.53
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.46
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.43
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.42
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.4
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.39
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.38
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 99.35
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.33
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.29
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.23
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.85
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.79
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.74
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.31
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
Probab=99.85  E-value=5.1e-21  Score=143.21  Aligned_cols=141  Identities=21%  Similarity=0.261  Sum_probs=123.4

Q ss_pred             CCccEEEeecCCCccchhhhcC-CCCCcEEEcccCCCccccccccCCccCCEEecccCcCCcCchh-hhCCCCCceeecc
Q 027557            5 IRDCPAVLSRNPIREIGDSLLN-MKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAE-LAFNKKLQNLDLG   82 (222)
Q Consensus         5 ~~~~~L~L~~n~l~~lp~~~~~-l~~L~~L~L~~n~i~~lp~~~~~l~~L~~L~l~~N~i~~lp~~-~~~l~~L~~L~L~   82 (222)
                      ..+++|+|++|.|+.+|. +.. .++|++|+|++|.|+.+ ..+..+++|++|++++|+|+.+|.. +..+++|++|+++
T Consensus        19 ~~L~~L~l~~n~l~~i~~-~~~~~~~L~~L~Ls~N~l~~~-~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~   96 (176)
T 1a9n_A           19 VRDRELDLRGYKIPVIEN-LGATLDQFDAIDFSDNEIRKL-DGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILT   96 (176)
T ss_dssp             TSCEEEECTTSCCCSCCC-GGGGTTCCSEEECCSSCCCEE-CCCCCCSSCCEEECCSSCCCEECSCHHHHCTTCCEEECC
T ss_pred             CCceEEEeeCCCCchhHH-hhhcCCCCCEEECCCCCCCcc-cccccCCCCCEEECCCCcccccCcchhhcCCCCCEEECC
Confidence            456899999999999964 444 45999999999999999 4799999999999999999998765 5899999999999


Q ss_pred             CCccCCCcchHhhcCCCCCCEEEeeCCCCCCchhHHHHHHHhCCccccccCCCCChhhHhhhHHH
Q 027557           83 KNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNI  147 (222)
Q Consensus        83 ~N~i~~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~  147 (222)
                      +|.|..++.+..+..+++|+.|++++|++...+.++..++..+++|+.++...+...++..+...
T Consensus        97 ~N~i~~~~~~~~l~~l~~L~~L~l~~N~i~~~~~~~~~~~~~l~~L~~Ld~~~n~~~~~~~~~~~  161 (176)
T 1a9n_A           97 NNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKM  161 (176)
T ss_dssp             SCCCCCGGGGGGGGGCTTCCEEECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHHHT
T ss_pred             CCcCCcchhhHhhhcCCCCCEEEecCCCCCCcHhHHHHHHHHCCccceeCCCcCCHHHHHHHHHH
Confidence            99999988766889999999999999999999988777888999999999998887666555433



>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 59.0 bits (142), Expect = 5e-12
 Identities = 28/117 (23%), Positives = 61/117 (52%), Gaps = 2/117 (1%)

Query: 12  LSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAELA 71
           L+   +  +   L  +  +T L LS+ +++ +  +L +   L+ L+ + N ++ +    A
Sbjct: 5   LAHKDLTVL-CHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGV-A 62

Query: 72  FNKKLQNLDLGKNLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSL 128
              +LQ L L  N + + + ++ L S   L  LNLQGN + + + + +++  +LPS+
Sbjct: 63  NLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSV 119


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.89
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.55
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.41
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.37
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.32
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.32
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.27
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.19
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.13
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.94
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.73
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.96
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=1.4e-25  Score=164.35  Aligned_cols=142  Identities=20%  Similarity=0.243  Sum_probs=129.7

Q ss_pred             CCccEEEeecCCCccchhhhcCCCCCcEEEcccCCCccccccccCCccCCEEecccCcCCcCchh-hhCCCCCceeeccC
Q 027557            5 IRDCPAVLSRNPIREIGDSLLNMKAITKLSLSNCQVQIIGSSLKSCTELKELRLAHNDIKTLPAE-LAFNKKLQNLDLGK   83 (222)
Q Consensus         5 ~~~~~L~L~~n~l~~lp~~~~~l~~L~~L~L~~n~i~~lp~~~~~l~~L~~L~l~~N~i~~lp~~-~~~l~~L~~L~L~~   83 (222)
                      +++++|+|++|.|+.|+..+..+++|+.|+|++|.|+.++ ++..+++|++|++++|+|+.+|.. +..+++|++|++++
T Consensus        18 ~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~-~~~~l~~L~~L~ls~N~i~~l~~~~~~~l~~L~~L~L~~   96 (162)
T d1a9na_          18 VRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLD-GFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTN   96 (162)
T ss_dssp             TSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEEC-CCCCCSSCCEEECCSSCCCEECSCHHHHCTTCCEEECCS
T ss_pred             CcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccC-CcccCcchhhhhcccccccCCCccccccccccccceecc
Confidence            4678999999999999876688999999999999999996 689999999999999999998765 56799999999999


Q ss_pred             CccCCCcchHhhcCCCCCCEEEeeCCCCCCchhHHHHHHHhCCccccccCCCCChhhHhhhHHH
Q 027557           84 NLITRWSELKVLKSLVSLNNLNLQGNPVAEYDKLAKKVKNLLPSLHIFNARPINRITKNEKDNI  147 (222)
Q Consensus        84 N~i~~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~  147 (222)
                      |+|..++.+..+..+++|++|++++|+++..+.|+.+++..+|+|++||+.+++..++..+...
T Consensus        97 N~i~~~~~l~~l~~l~~L~~L~l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~er~~A~~~  160 (162)
T d1a9na_          97 NSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKM  160 (162)
T ss_dssp             CCCCCGGGGGGGGGCTTCCEEECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHHHT
T ss_pred             ccccccccccccccccccchhhcCCCccccccchHHHHHHHCCCcCeeCCCCCCHHHHHHHHHH
Confidence            9999998777899999999999999999999999888999999999999999999888776543



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure