Citrus Sinensis ID: 027681


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MDIDFWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTNKFSLASDLKRYPPSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
ccHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHcccccHHccccccccccHHHHHHcccccccccccEHHHHHccHHccccccccccccHcHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccHccccccccccccccccccccccccHccccccccccHHHHHHHHHHHHHHHHccEEccccEEEEEEEEEEEEEc
MDIDFWASRVHSAKHFSAVRasrlntdnhsivdeteidddvkacfpcpfcyLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGlrnggsamLGKELssflgsptivrgnapeslpdpllspflcsgtlsdtkgiqkddctnkfslasdlkryppsseyKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
mdidfwasrvhsakhfsavrasrlntdnhsivdeteidddvkaCFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTNKFslasdlkryppSSEYKLLWSQLLFKKLANKisvsstmhfkidVLLVIGIYL
MDIDFWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTNKFSLASDLKRYPPSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
****FWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQH*************************************************LSPFLCSGTLSDTKGIQKDDCTNKFSLASDLKRYPPSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIY*
***DFW*****************************EIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMV***************************************************LSPFLC********************************************************HFKIDVLLVIGIYL
MDIDFWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTNKFSLASDLKRYPPSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
*****WA****SAKHFSAVRASRL*****SIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCL*********A****E**SFLGS***********LP*PLLS***C*****************************PSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIDFWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTNKFSLASDLKRYPPSSEYKLLWSQLLFKKLANKISVSSTMHFKIDVLLVIGIYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q7XBA5208 Protein DEHYDRATION-INDUC yes no 0.577 0.610 0.496 2e-28
Q5JME8202 Protein DEHYDRATION-INDUC no no 0.509 0.554 0.478 1e-24
Q688X9226 Protein DEHYDRATION-INDUC no no 0.718 0.699 0.337 1e-17
Q39083206 Protein DEHYDRATION-INDUC yes no 0.527 0.563 0.387 3e-15
Q6NM26222 Protein DEHYDRATION-INDUC yes no 0.659 0.653 0.333 7e-15
Q5W794233 Protein DEHYDRATION-INDUC no no 0.595 0.562 0.339 4e-14
Q9FJ17211 Protein DEHYDRATION-INDUC no no 0.518 0.540 0.377 2e-13
Q6H6E6245 Protein DEHYDRATION-INDUC no no 0.431 0.387 0.330 1e-12
Q84J70223 Protein DEHYDRATION-INDUC no no 0.654 0.645 0.341 2e-12
Q8VXU6224 Protein DEHYDRATION-INDUC no no 0.309 0.303 0.426 2e-10
>sp|Q7XBA5|DI196_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Oryza sativa subsp. japonica GN=DI19-6 PE=2 SV=1 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 81/129 (62%), Gaps = 2/129 (1%)

Query: 24  LNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANL 83
           + T N  +  E   DD+     PCPFCY+E+E H +C HLQEEHCF+MKNAVCP+CA NL
Sbjct: 16  IPTINFQMYSEIAGDDEWWEYIPCPFCYIEVEVHFLCDHLQEEHCFDMKNAVCPICADNL 75

Query: 84  GKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGK-ELSSFLGSPTIVRGN-APESLP 141
            KD  EHF VQH+  LKRR+    S   +  +A  G  E  S+  +P+   G  AP+S P
Sbjct: 76  DKDTDEHFRVQHSHLLKRRKSSSFSCKPSSAAADKGSYEEDSYFEAPSHCMGRPAPDSSP 135

Query: 142 DPLLSPFLC 150
           DPLLS F+C
Sbjct: 136 DPLLSQFIC 144





Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q5JME8|DI195_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Oryza sativa subsp. japonica GN=DI19-5 PE=2 SV=1 Back     alignment and function description
>sp|Q688X9|DI191_ORYSJ Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa subsp. japonica GN=DI19-1 PE=2 SV=1 Back     alignment and function description
>sp|Q39083|DI191_ARATH Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thaliana GN=DI19-1 PE=1 SV=2 Back     alignment and function description
>sp|Q6NM26|DI196_ARATH Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabidopsis thaliana GN=DI19-6 PE=1 SV=1 Back     alignment and function description
>sp|Q5W794|DI192_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza sativa subsp. japonica GN=DI19-2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FJ17|DI197_ARATH Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabidopsis thaliana GN=DI19-7 PE=1 SV=2 Back     alignment and function description
>sp|Q6H6E6|DI194_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Oryza sativa subsp. japonica GN=DI19-4 PE=2 SV=1 Back     alignment and function description
>sp|Q84J70|DI193_ARATH Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabidopsis thaliana GN=DI19-3 PE=1 SV=1 Back     alignment and function description
>sp|Q8VXU6|DI194_ARATH Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabidopsis thaliana GN=DI19-4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
224119454208 predicted protein [Populus trichocarpa] 0.759 0.802 0.640 2e-55
359491142192 PREDICTED: protein DEHYDRATION-INDUCED 1 0.731 0.838 0.605 5e-50
255540495299 conserved hypothetical protein [Ricinus 0.65 0.478 0.601 7e-41
449469572189 PREDICTED: protein DEHYDRATION-INDUCED 1 0.7 0.814 0.441 4e-32
358248684194 uncharacterized protein LOC100801801 [Gl 0.654 0.742 0.439 2e-27
115461655208 Os05g0107900 [Oryza sativa Japonica Grou 0.577 0.610 0.496 1e-26
28195116208 unknown [Oryza sativa Indica Group] gi|1 0.577 0.610 0.488 2e-25
116784380229 unknown [Picea sitchensis] gi|116791117| 0.731 0.703 0.408 2e-23
357126984223 PREDICTED: protein DEHYDRATION-INDUCED 1 0.531 0.524 0.454 2e-23
115442503202 Os01g0971100 [Oryza sativa Japonica Grou 0.509 0.554 0.478 6e-23
>gi|224119454|ref|XP_002318076.1| predicted protein [Populus trichocarpa] gi|222858749|gb|EEE96296.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 130/167 (77%)

Query: 1   MDIDFWASRVHSAKHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFCYLEIEAHMIC 60
           MD+DFW SRV S+K+ SAV+A+  N+DNH  +D+++ DD+ +A FPCPFCY+EIE H+ C
Sbjct: 1   MDVDFWTSRVLSSKNLSAVQAASRNSDNHLAMDDSDGDDNSRAYFPCPFCYVEIEVHLFC 60

Query: 61  SHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAMLGK 120
           SHL +EHCF++KNAVCPLCAANLGKDA  HF+VQHASSLK RRK  KSGL  G SAMLGK
Sbjct: 61  SHLLDEHCFDLKNAVCPLCAANLGKDAIGHFIVQHASSLKHRRKHKKSGLWTGSSAMLGK 120

Query: 121 ELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDDCTN 167
           +LSSFLGS T  R N  ES PDPLLSPFL + + SD +  Q D+  N
Sbjct: 121 DLSSFLGSSTNSRTNTHESAPDPLLSPFLGNLSRSDPRQSQHDEPFN 167




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491142|ref|XP_002280304.2| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 5-like [Vitis vinifera] gi|297733696|emb|CBI14943.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540495|ref|XP_002511312.1| conserved hypothetical protein [Ricinus communis] gi|223550427|gb|EEF51914.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449469572|ref|XP_004152493.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358248684|ref|NP_001239667.1| uncharacterized protein LOC100801801 [Glycine max] gi|255644938|gb|ACU22969.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|115461655|ref|NP_001054427.1| Os05g0107900 [Oryza sativa Japonica Group] gi|75141142|sp|Q7XBA5.1|DI196_ORYSJ RecName: Full=Protein DEHYDRATION-INDUCED 19 homolog 6; AltName: Full=OsDi19-6 gi|14719312|gb|AAK73130.1|AC079022_3 unknown protein [Oryza sativa] gi|33151123|gb|AAP97430.1| drought-induced protein DI1 [Oryza sativa Japonica Group] gi|113577978|dbj|BAF16341.1| Os05g0107900 [Oryza sativa Japonica Group] gi|222629917|gb|EEE62049.1| hypothetical protein OsJ_16833 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|28195116|gb|AAO33770.1| unknown [Oryza sativa Indica Group] gi|125550535|gb|EAY96244.1| hypothetical protein OsI_18142 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|116784380|gb|ABK23321.1| unknown [Picea sitchensis] gi|116791117|gb|ABK25863.1| unknown [Picea sitchensis] gi|224284059|gb|ACN39767.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|357126984|ref|XP_003565167.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 5-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115442503|ref|NP_001045531.1| Os01g0971100 [Oryza sativa Japonica Group] gi|75106327|sp|Q5JME8.1|DI195_ORYSJ RecName: Full=Protein DEHYDRATION-INDUCED 19 homolog 5; AltName: Full=OsDi19-5 gi|57899211|dbj|BAD87360.1| putative drought-induced protein DI [Oryza sativa Japonica Group] gi|113535062|dbj|BAF07445.1| Os01g0971100 [Oryza sativa Japonica Group] gi|125529280|gb|EAY77394.1| hypothetical protein OsI_05382 [Oryza sativa Indica Group] gi|125573470|gb|EAZ14985.1| hypothetical protein OsJ_04920 [Oryza sativa Japonica Group] gi|215697475|dbj|BAG91469.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
TAIR|locus:2148528222 AT5G26990 [Arabidopsis thalian 0.781 0.774 0.316 1.2e-17
TAIR|locus:2078062223 AT3G05700 [Arabidopsis thalian 0.645 0.636 0.355 5.3e-17
TAIR|locus:2155934211 HRB1 "HYPERSENSITIVE TO RED AN 0.654 0.682 0.339 9.8e-16
TAIR|locus:2196125221 AT1G02750 [Arabidopsis thalian 0.472 0.470 0.292 5.6e-13
TAIR|locus:2137819228 AT4G02200 [Arabidopsis thalian 0.572 0.552 0.263 1.5e-06
TAIR|locus:2148528 AT5G26990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 215 (80.7 bits), Expect = 1.2e-17, P = 1.2e-17
 Identities = 61/193 (31%), Positives = 91/193 (47%)

Query:     1 MDIDFWASRVHSA-KHFSAVRASRLNTDNHSIVDETEIDDDVKACFPCPFC--YLEIEAH 57
             MD D W+ R+ SA + +     SR  +DN    +E E +DD +  + CPFC  Y +I + 
Sbjct:     1 MDSDSWSDRLASASRRYQLDFLSR--SDNFLGFEEIEGEDDFREEYACPFCSDYFDIVS- 57

Query:    58 MICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHASSLKRRRKCLKSGLRNGGSAM 117
              +C H+ E+H  + KN VCP+CA  +  D   H  +QHA+  K  RK  +   R G  +M
Sbjct:    58 -LCCHIDEDHPMDAKNGVCPICAVKVSSDMIAHITLQHANMFKVTRK--RKSRRGGAQSM 114

Query:   118 L---------GKELSSFLGSPTIVRGNAPESLPDPLLSPFLCSGTLSDTKGIQKDD-CTN 167
             L         G   S F G+   V  ++     DPLLS F+    ++D   I +   C +
Sbjct:   115 LSILKREFPDGNFQSLFEGTSRAVSSSSASIAADPLLSSFI--SPMADDFFISESSLCAD 172

Query:   168 KFSLASDLKRYPP 180
               S    L +  P
Sbjct:   173 TSSAKKTLNQSLP 185




GO:0005634 "nucleus" evidence=ISM
GO:0009414 "response to water deprivation" evidence=ISS
TAIR|locus:2078062 AT3G05700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155934 HRB1 "HYPERSENSITIVE TO RED AND BLUE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196125 AT1G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137819 AT4G02200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00120791
hypothetical protein (208 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
pfam05605209 pfam05605, Di19, Drought induced 19 protein (Di19) 1e-38
>gnl|CDD|218654 pfam05605, Di19, Drought induced 19 protein (Di19) Back     alignment and domain information
 Score =  132 bits (333), Expect = 1e-38
 Identities = 67/165 (40%), Positives = 90/165 (54%), Gaps = 20/165 (12%)

Query: 15  HFSAVRASRLNTDNHS---IVDETEIDDDVKACFPCPFCYLEIEAHMICSHLQEEHCFEM 71
           H SA  + +    + S   + ++ E +D+V+  FPCPFCY + +   +C H+ EEH FE 
Sbjct: 1   HASASASYQRALPSRSDLYLFEDIEGEDEVREEFPCPFCYEDFDIVSLCCHIDEEHPFEA 60

Query: 72  KNAVCPLCAANLGKDAAEHFMVQHASSLK--RRRKCLKSGLRNGGS----AMLGKELS-- 123
           KN VCP+CA  +GKD   H  VQH    K  RRR+     LR GGS    ++L +EL   
Sbjct: 61  KNGVCPVCADRVGKDMVAHITVQHGHLFKMQRRRR-----LRRGGSSSALSLLKRELRDG 115

Query: 124 ---SFLGSPTIVRG-NAPESLPDPLLSPFLCSGTLSDTKGIQKDD 164
              S LGS  +    NA +S PDPLLS F+CS   +DT    K D
Sbjct: 116 NLQSLLGSSCMSSSSNASDSAPDPLLSSFICSSPSADTSSTSKSD 160


This family consists of several drought induced 19 (Di19) like proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought. The precise function of Di19 is unknown. Length = 209

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 99.77
PF14571105 Di19_C: Stress-induced protein Di19, C-terminal 99.49
KOG1280 381 consensus Uncharacterized conserved protein contai 97.61
KOG292367 consensus Uncharacterized conserved protein [Funct 94.74
COG521667 Uncharacterized conserved protein [Function unknow 94.35
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 89.89
PHA0073279 hypothetical protein 89.42
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 88.78
smart00531147 TFIIE Transcription initiation factor IIE. 88.22
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 88.11
KOG1842 505 consensus FYVE finger-containing protein [General 87.14
PLN03086567 PRLI-interacting factor K; Provisional 86.37
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 85.93
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 83.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 83.78
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 83.0
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 82.55
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 82.18
PF1435461 Lar_restr_allev: Restriction alleviation protein L 81.78
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.21
PF04780 466 DUF629: Protein of unknown function (DUF629); Inte 81.2
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 81.03
PRK0971064 lar restriction alleviation and modification prote 80.96
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 80.34
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 80.11
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 80.03
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
Probab=99.77  E-value=1.8e-19  Score=125.21  Aligned_cols=53  Identities=32%  Similarity=0.726  Sum_probs=51.6

Q ss_pred             eecCCCCCccchHHHhhhhhhcccCCCcccccccccccccchhHhhhhhhhcc
Q 027681           44 CFPCPFCYLEIEAHMICSHLQEEHCFEMKNAVCPLCAANLGKDAAEHFMVQHA   96 (220)
Q Consensus        44 ~F~CPfC~ed~D~~~Lc~H~~eeH~~e~k~vVCPVCa~~vg~D~i~Hit~QH~   96 (220)
                      +|+||||+++||+.+|+.|++++|+.+.+++|||||+.+++.||++||+.+||
T Consensus         2 ~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVTDNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhHHHHHHHHhcC
Confidence            79999999999999999999999999999999999999999999999999986



Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.

>PF14571 Di19_C: Stress-induced protein Di19, C-terminal Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2923 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1842 consensus FYVE finger-containing protein [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04780 DUF629: Protein of unknown function (DUF629); InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 96.94
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 96.88
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 95.95
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 95.84
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 95.67
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 95.55
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 95.48
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 95.18
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 95.18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 95.09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 95.09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 94.99
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 94.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 94.87
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 94.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 94.85
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 94.52
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 94.46
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 94.25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 94.24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 94.2
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 94.17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 94.06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 93.94
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 93.83
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 93.64
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 93.62
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 93.62
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 93.49
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 93.22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 93.03
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 92.93
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 92.57
2lv2_A85 Insulinoma-associated protein 1; structural genomi 92.55
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 92.55
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 91.93
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.88
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 91.34
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 91.2
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 91.15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 90.82
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.55
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 90.47
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 90.35
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 90.2
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 90.07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.77
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 89.74
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.67
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.57
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 89.47
2ysl_A73 Tripartite motif-containing protein 31; ring-type 89.38
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.16
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 89.1
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.01
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.0
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.94
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 88.86
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 88.74
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 88.74
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.55
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.35
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 88.34
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.31
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 88.3
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.29
1wge_A83 Hypothetical protein 2610018L09RIK; diphthamide,CS 88.24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 88.23
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.21
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 88.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.93
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 87.9
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.84
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 87.82
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.69
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.5
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.48
2jr7_A89 DPH3 homolog; DESR1, CSL zinc finger, metal bindin 87.47
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 87.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 87.39
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.36
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 87.32
1tf6_A190 Protein (transcription factor IIIA); complex (tran 87.29
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 87.21
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 86.85
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 86.79
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.75
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 86.63
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 86.39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 86.37
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 86.34
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 86.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.84
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.78
1yop_A83 KTI11P; zinc finger, metal binding protein; NMR {S 85.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 85.51
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 85.47
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 85.44
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.44
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 85.38
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.05
1vd4_A62 Transcription initiation factor IIE, alpha subunit 84.92
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.7
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 84.39
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 84.38
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 84.33
2ect_A78 Ring finger protein 126; metal binding protein, st 84.01
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 83.39
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 83.15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.0
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 82.89
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 82.66
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 81.83
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 81.74
2ecw_A85 Tripartite motif-containing protein 30; metal bind 81.58
1paa_A30 Yeast transcription factor ADR1; transcription reg 81.32
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 81.3
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.77
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 80.55
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=96.94  E-value=0.00064  Score=46.15  Aligned_cols=54  Identities=20%  Similarity=0.452  Sum_probs=44.2

Q ss_pred             eecCCCCCccc-hHHHhhhhhhcccCCCccccccccccccc--chhHhhhhhhhccc
Q 027681           44 CFPCPFCYLEI-EAHMICSHLQEEHCFEMKNAVCPLCAANL--GKDAAEHFMVQHAS   97 (220)
Q Consensus        44 ~F~CPfC~ed~-D~~~Lc~H~~eeH~~e~k~vVCPVCa~~v--g~D~i~Hit~QH~~   97 (220)
                      .|.|+.|+..| ....|..|+...|.-+.+.-.|++|....  ..++..|+...|+.
T Consensus        15 ~~~C~~C~k~f~~~~~L~~H~~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~   71 (77)
T 2ct1_A           15 PYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY   71 (77)
T ss_dssp             SEECTTTCCEESCHHHHHHHHHHHSSSSCSSEECSSSSCEESSHHHHHHHHHHTSCC
T ss_pred             CeECCCcCchhCCHHHHHHHHHHhcCCCCCccCCCCCCCccCCHHHHHHHHHHhCCC
Confidence            59999998855 46789999988888777888999999873  55899999777763



>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.31
d1wgea170 DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus 91.73
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 89.76
d1ywsa182 Diphthamide biosynthesis protein 3, DPH3 {Baker's 87.25
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 85.33
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 83.34
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 83.17
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 80.39
d2c2la280 STIP1 homology and U box-containing protein 1, STU 80.31
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 80.22
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: Transcriptional factor domain
domain: Transcription initiation factor TFIIE-alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=93.31  E-value=0.021  Score=39.19  Aligned_cols=46  Identities=24%  Similarity=0.612  Sum_probs=33.7

Q ss_pred             CccccCCCccceecCCCCCc---cchHHHhhhhhhcccCCCcccccccccccccch
Q 027681           33 DETEIDDDVKACFPCPFCYL---EIEAHMICSHLQEEHCFEMKNAVCPLCAANLGK   85 (220)
Q Consensus        33 de~e~ddd~r~~F~CPfC~e---d~D~~~Lc~H~~eeH~~e~k~vVCPVCa~~vg~   85 (220)
                      ++.+-+.-.++.|.||.|..   .+|...|.+..+.       .-.|-+|..-|-.
T Consensus         3 e~~~rd~~~~~~y~Cp~C~~~ys~Lda~~L~d~~~~-------~F~C~~C~~el~e   51 (62)
T d1vd4a_           3 ETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTG-------TFRCTFCHTEVEE   51 (62)
T ss_dssp             CCCSSSCCSSSEEECSSSCCEEEHHHHHHHEETTTT-------EEBCSSSCCBCEE
T ss_pred             chhhhccccCCceECCCCCCCcchhhHHHhcCcCCC-------eEEecCCCCEEec
Confidence            34444556799999999965   8888888776433       5689999887644



>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure