Citrus Sinensis ID: 027814

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQSGSLRRGPIKASAQSLSAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSRYKEGLDDYGTWRIRWQSQLTELKRRSMNKDSRDHMSWGSRIRRRHRSKTTADDIDRNSTIKV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccccccccccccc
ccccEEccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHcccEEEc
mshgivspaaqsnflnhskssipIASSMLAEassclsfnphlpklsfslktqsgslrrgpikaSAQSLSAATESFYDllgipqsvtPREIKQAYKHLVLkyhpdvspperideNTKRFIRLQEAYetlsdpntralydnhlatgsfiafssrkpsrykeglddygtWRIRWQSQLTELKRRSmnkdsrdhmswgsrirrrhrskttaddidrnstikv
MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQSGSLRRGPIKASAQSLSAATESFYDLLGIPQSVTPREIKQAYKHLVLkyhpdvspperideNTKRFIRLQEAyetlsdpntRALYDNHLATGSfiafssrkpsrykeglddygtwriRWQSQLtelkrrsmnkdsrdhmswgsrirrrhrskttaddidrnstikv
MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQSGSLRRGPIKASAQSLSAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSRYKEGLDDYGTWRIRWQSQLTELKRRSMNKDSRDHMSWGSRIRRRHRSKTTADDIDRNSTIKV
**************************************************************************FYDLLGIPQSVTPREIKQAYKHLVLKYHPD***********KRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRK*SRYKEGLDDYGTWRIRWQSQ********************************************
***********************************************************************TESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLAT******************DDYGTWRIRW****************************************RNSTIK*
MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLK*******************AATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSRYKEGLDDYGTWRIRWQSQLTELKR**************************************
*SHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQ*****************AATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSRYKEGLDDYGTWRIRWQSQLTEL**************************TTADDIDRNSTIKV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQSGSLRRGPIKASAQSLSAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSRYKEGLDDYGTWRIRWQSQLTELKRRSMNKDSRDHMSWGSRIRRRHRSKTTADDIDRNSTIKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9SDN0197 Chaperone protein dnaJ 20 yes no 0.587 0.649 0.561 3e-36
Q9WZV3 369 Chaperone protein DnaJ OS yes no 0.353 0.208 0.448 1e-12
B1LCI2 369 Chaperone protein DnaJ OS yes no 0.353 0.208 0.448 1e-12
A5IIT4 369 Chaperone protein DnaJ OS yes no 0.321 0.189 0.492 1e-12
B9KAB9 370 Chaperone protein DnaJ OS yes no 0.321 0.189 0.478 2e-12
Q2GI75 380 Chaperone protein DnaJ OS yes no 0.293 0.168 0.484 3e-12
Q5L6F7 391 Chaperone protein DnaJ OS yes no 0.293 0.163 0.469 3e-12
Q823T2 392 Chaperone protein DnaJ OS yes no 0.311 0.173 0.457 3e-12
B9MJZ0 388 Chaperone protein DnaJ OS yes no 0.311 0.175 0.442 8e-12
Q5FGQ8 382 Chaperone protein DnaJ OS yes no 0.293 0.167 0.469 9e-12
>sp|Q9SDN0|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic OS=Arabidopsis thaliana GN=ATJ20 PE=2 SV=2 Back     alignment and function desciption
 Score =  151 bits (381), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 2/130 (1%)

Query: 74  SFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNT 133
           SFYDLLG+ +SVT  EIKQAYK L  KYHPDVSPP+R++E T RFIR+QEAYETLSDP  
Sbjct: 66  SFYDLLGVTESVTLPEIKQAYKQLARKYHPDVSPPDRVEEYTDRFIRVQEAYETLSDPRR 125

Query: 134 RALYDNHLATGSFIAFSSRKPSRY-KEGLDDYGTWRIRWQSQLTELKRRSMNKDSRDHMS 192
           R LYD  L+ G   +FS R+ +RY +E +++   W+ +WQ+QL+ L+RRS  KD+ + MS
Sbjct: 126 RVLYDRDLSMGFSFSFSGRRQNRYDQEVVEEKSEWKAKWQTQLSGLRRRSNQKDN-NTMS 184

Query: 193 WGSRIRRRHR 202
           W +R+RR+ +
Sbjct: 185 WAARMRRQQQ 194
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain Arkansas) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain S26/3) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
296088183230 unnamed protein product [Vitis vinifera] 0.922 0.873 0.485 2e-41
359496579208 PREDICTED: chaperone protein dnaJ 20, ch 0.922 0.966 0.481 2e-41
113374278177 DnaJ-like protein isoform [Solanum phure 0.733 0.903 0.521 4e-41
225433479216 PREDICTED: chaperone protein dnaJ 20, ch 0.908 0.916 0.490 1e-40
255580531208 chaperone protein DNAj, putative [Ricinu 0.885 0.927 0.470 5e-39
359496793233 PREDICTED: LOW QUALITY PROTEIN: chaperon 0.922 0.862 0.430 1e-37
255553998201 Chaperone protein dnaJ 20, chloroplast p 0.582 0.631 0.582 3e-36
449432390217 PREDICTED: chaperone protein dnaJ 20, ch 0.733 0.737 0.512 5e-36
224128988196 predicted protein [Populus trichocarpa] 0.582 0.647 0.581 2e-35
255580529216 chaperone protein DNAj, putative [Ricinu 0.825 0.833 0.494 2e-35
>gi|296088183|emb|CBI35695.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 103/212 (48%), Positives = 140/212 (66%), Gaps = 11/212 (5%)

Query: 1   MSHGIVSPAAQSNFLNHSKSSIPIASSMLAEASSCLSFNPHLPKLSFSLKTQSG--SLRR 58
           MS+G    +   +FL  SK  +P A SML  + + L FN +LPK +F LKT SG  + R 
Sbjct: 23  MSYG----STGHDFLVCSKPCLPGAKSMLKPSPNHLIFNTNLPKPAFYLKTPSGYFTTRA 78

Query: 59  GPIKASAQSL---SAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENT 115
                S+ +L     A+ESFY LLG+ ++ T  EIK+AYK LVLKYHPDVSPP+   E T
Sbjct: 79  KTAINSSYNLYLTEEASESFYCLLGVSEAATLSEIKRAYKQLVLKYHPDVSPPDSAKEFT 138

Query: 116 KRFIRLQEAYETLSDPNTRALYDNHLATGSFIAFSSRKPSR-YKEGLDDYGTWRIRWQSQ 174
           + FIR+QEAYETLSDP TR LYD  L  G  +AFS++   R ++ G+D  G W+ RWQ+Q
Sbjct: 139 RMFIRIQEAYETLSDPRTRDLYDIDLTKGLHLAFSAQNLYRSHQPGMDMSGDWKSRWQAQ 198

Query: 175 LTELKRRSMNKDSRDHMSWGSRIRRRHRSKTT 206
           L EL+R+S +K+S D+ SW +R+R + RSK++
Sbjct: 199 LGELERKSASKNSNDNKSWAARVRMQ-RSKSS 229

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496579|ref|XP_002268426.2| PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|113374278|gb|ABI34703.1| DnaJ-like protein isoform [Solanum phureja] Back     alignment and taxonomy information
>gi|225433479|ref|XP_002264154.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic [Vitis vinifera] gi|147777520|emb|CAN64811.1| hypothetical protein VITISV_024996 [Vitis vinifera] gi|298205225|emb|CBI17284.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580531|ref|XP_002531090.1| chaperone protein DNAj, putative [Ricinus communis] gi|223529336|gb|EEF31304.1| chaperone protein DNAj, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359496793|ref|XP_003635336.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein dnaJ 20, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553998|ref|XP_002518039.1| Chaperone protein dnaJ 20, chloroplast precursor, putative [Ricinus communis] gi|223542635|gb|EEF44172.1| Chaperone protein dnaJ 20, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449432390|ref|XP_004133982.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Cucumis sativus] gi|449487542|ref|XP_004157678.1| PREDICTED: chaperone protein dnaJ 20, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224128988|ref|XP_002328862.1| predicted protein [Populus trichocarpa] gi|222839292|gb|EEE77629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255580529|ref|XP_002531089.1| chaperone protein DNAj, putative [Ricinus communis] gi|223529335|gb|EEF31303.1| chaperone protein DNAj, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2119465197 J20 "AT4G13830" [Arabidopsis t 0.798 0.883 0.467 1e-36
GENEDB_PFALCIPARUM|MAL13P1.162247 MAL13P1.162 "DNAJ-like protein 0.344 0.303 0.460 4.9e-14
UNIPROTKB|C0H5E9247 MAL13P1.162 "DNAJ like protein 0.344 0.303 0.460 4.9e-14
TAIR|locus:2174239268 AT5G59610 [Arabidopsis thalian 0.692 0.563 0.339 1e-13
UNIPROTKB|Q9UBS3223 DNAJB9 "DnaJ homolog subfamily 0.591 0.578 0.347 5.6e-13
ZFIN|ZDB-GENE-040426-1122 311 dnajb6b "DnaJ (Hsp40) homolog, 0.307 0.215 0.470 1.3e-12
UNIPROTKB|F1SIM7223 DNAJB9 "Uncharacterized protei 0.385 0.376 0.431 1.9e-12
MGI|MGI:1351618222 Dnajb9 "DnaJ (Hsp40) homolog, 0.376 0.369 0.438 1.9e-12
UNIPROTKB|F1NV86216 DNAJB9 "Uncharacterized protei 0.311 0.314 0.464 2.4e-12
RGD|3070222 Dnajb9 "DnaJ (Hsp40) homolog, 0.587 0.576 0.354 2.4e-12
TAIR|locus:2119465 J20 "AT4G13830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 1.0e-36, P = 1.0e-36
 Identities = 86/184 (46%), Positives = 119/184 (64%)

Query:    23 PIASSMLAEASSCLSFNPHLPKLSFSLKTQSGSLRRGPIKASAQSLSAATESFYDLLGIP 82
             PI+S       + +S+ P   + S S + QS      P+K S + LS     FYDLLG+ 
Sbjct:    23 PISSLQPTSIPTTISY-PTRTRFS-STRIQSRLTHDDPVKQS-EDLS-----FYDLLGVT 74

Query:    83 QSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLA 142
             +SVT  EIKQAYK L  KYHPDVSPP+R++E T RFIR+QEAYETLSDP  R LYD  L+
Sbjct:    75 ESVTLPEIKQAYKQLARKYHPDVSPPDRVEEYTDRFIRVQEAYETLSDPRRRVLYDRDLS 134

Query:   143 TGSFIAFSSRKPSRY-KEGLDDYGTWRIRWQSQLTELKRRSMNKDSRDHMSWGSRIRRRH 201
              G   +FS R+ +RY +E +++   W+ +WQ+QL+ L+RRS  KD+   MSW +R+RR+ 
Sbjct:   135 MGFSFSFSGRRQNRYDQEVVEEKSEWKAKWQTQLSGLRRRSNQKDNNT-MSWAARMRRQQ 193

Query:   202 RSKT 205
             +  +
Sbjct:   194 QESS 197
GO:0006457 "protein folding" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GENEDB_PFALCIPARUM|MAL13P1.162 MAL13P1.162 "DNAJ-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|C0H5E9 MAL13P1.162 "DNAJ like protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TAIR|locus:2174239 AT5G59610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBS3 DNAJB9 "DnaJ homolog subfamily B member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1122 dnajb6b "DnaJ (Hsp40) homolog, subfamily B, member 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIM7 DNAJB9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1351618 Dnajb9 "DnaJ (Hsp40) homolog, subfamily B, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV86 DNAJB9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3070 Dnajb9 "DnaJ (Hsp40) homolog, subfamily B, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-22
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-21
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 5e-21
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-17
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-17
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-17
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-16
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-16
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 5e-16
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 8e-16
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-15
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 3e-15
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 3e-14
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-14
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-13
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-13
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 5e-13
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 7e-13
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 9e-13
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-12
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-12
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-12
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 5e-12
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 5e-12
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-12
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-11
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-11
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-11
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-10
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-10
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 4e-10
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-09
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-09
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 7e-09
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 7e-09
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-07
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 4e-07
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 6e-06
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 2e-04
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 3e-04
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 8e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.003
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 93.1 bits (232), Expect = 2e-22
 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 71  ATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSD 130
           A   +Y++LG+ +  +  EIK+AY+ L  KYHPD +P ++  E  ++F  + EAYE LSD
Sbjct: 2   AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDK--EAEEKFKEINEAYEVLSD 59

Query: 131 PNTRALYD 138
           P  RA YD
Sbjct: 60  PEKRAAYD 67

Length = 371
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
PRK14286 372 chaperone protein DnaJ; Provisional 99.84
PRK14288 369 chaperone protein DnaJ; Provisional 99.84
PRK14296 372 chaperone protein DnaJ; Provisional 99.83
PRK14287 371 chaperone protein DnaJ; Provisional 99.83
PRK14297 380 chaperone protein DnaJ; Provisional 99.82
PRK14276 380 chaperone protein DnaJ; Provisional 99.82
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
PRK14282 369 chaperone protein DnaJ; Provisional 99.82
PRK14285 365 chaperone protein DnaJ; Provisional 99.82
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.81
PRK14277 386 chaperone protein DnaJ; Provisional 99.81
PRK14280 376 chaperone protein DnaJ; Provisional 99.81
PRK14298 377 chaperone protein DnaJ; Provisional 99.81
PRK14299 291 chaperone protein DnaJ; Provisional 99.81
PRK14279 392 chaperone protein DnaJ; Provisional 99.8
PRK10767 371 chaperone protein DnaJ; Provisional 99.8
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14301 373 chaperone protein DnaJ; Provisional 99.79
PRK14283 378 chaperone protein DnaJ; Provisional 99.79
PRK14294 366 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.78
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.78
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.78
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.78
PRK14281 397 chaperone protein DnaJ; Provisional 99.78
PRK14295 389 chaperone protein DnaJ; Provisional 99.77
PRK14284 391 chaperone protein DnaJ; Provisional 99.77
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.76
PRK14278 378 chaperone protein DnaJ; Provisional 99.76
PRK14290 365 chaperone protein DnaJ; Provisional 99.75
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK14289 386 chaperone protein DnaJ; Provisional 99.74
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK14300 372 chaperone protein DnaJ; Provisional 99.73
PRK14292 371 chaperone protein DnaJ; Provisional 99.73
PRK14293 374 chaperone protein DnaJ; Provisional 99.72
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.69
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.66
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.63
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.62
PHA03102153 Small T antigen; Reviewed 99.61
PRK01356166 hscB co-chaperone HscB; Provisional 99.56
PRK05014171 hscB co-chaperone HscB; Provisional 99.56
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.54
PRK00294173 hscB co-chaperone HscB; Provisional 99.52
PRK03578176 hscB co-chaperone HscB; Provisional 99.5
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
PHA02624 647 large T antigen; Provisional 99.42
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PTZ00100116 DnaJ chaperone protein; Provisional 99.38
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.32
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.3
PRK01773173 hscB co-chaperone HscB; Provisional 99.27
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.24
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.16
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.11
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.03
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.41
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.41
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.26
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.75
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.96
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.86
KOG0431453 consensus Auxilin-like protein and related protein 96.72
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.27
PF1344662 RPT: A repeated domain in UCH-protein 89.39
PF14687112 DUF4460: Domain of unknown function (DUF4460) 82.41
KOG0724 335 consensus Zuotin and related molecular chaperones 82.22
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=1.4e-27  Score=214.64  Aligned_cols=122  Identities=34%  Similarity=0.598  Sum_probs=94.8

Q ss_pred             CCcchhhhcCCCCCCCHHHHHHHHHHHHHHcCCCCCCCchhhHHHHHHHHHHHHHHHcCChhhHHHHHhhhhcCCcc-cc
Q 027814           71 ATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFI-AF  149 (218)
Q Consensus        71 ~~~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~~~~~~~~-~~  149 (218)
                      ..+|||+||||+++|+.+|||+|||+||++||||+|+.+  ++|+++|++|++||+||+||++|+.||+++..+... .+
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~--~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~   79 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD--KEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGF   79 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC--HHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCc
Confidence            468999999999999999999999999999999999864  589999999999999999999999999999998752 11


Q ss_pred             cCCCCCCCCCCCCCch-hHHHHHHHHHHHHHHHHhCcCCCCCCCchhhhhhhccccCCCCccccccccc
Q 027814          150 SSRKPSRYKEGLDDYG-TWRIRWQSQLTELKRRSMNKDSRDHMSWGSRIRRRHRSKTTADDIDRNSTIK  217 (218)
Q Consensus       150 ~~~~~~~~~e~~~~~~-~w~~~~~~~~~e~~~r~~~~~~~~~~~~g~r~r~~r~~~~~~~~~~~~~~~~  217 (218)
                      .+.       .|.+++ ++.+.|...|.                .|++.|++++.+..++||..+.+|.
T Consensus        80 gg~-------g~~~fgg~~~DIF~~~Fg----------------Gg~~~~~~~~~~~rG~Dl~~~l~is  125 (371)
T COG0484          80 GGF-------GFGGFGGDFGDIFEDFFG----------------GGGGGRRRPNRPRRGADLRYNLEIT  125 (371)
T ss_pred             CCC-------CcCCCCCCHHHHHHHhhc----------------CCCcccCCCCCcccCCceEEEEEeE
Confidence            111       222222 34555544441                1222455666688999999998875

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-12
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-11
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-11
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 5e-11
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-11
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-10
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 5e-10
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-09
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-09
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 4e-09
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 5e-09
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 6e-09
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 7e-08
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 6e-07
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-06
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-06
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 3e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 5e-06
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 2e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 4e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
Query: 67  SLSAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYE 126
           S S+   ++Y++LG+  S +P +IK+AY+ L L++HPD +P  + +E  K+F  + EAYE
Sbjct: 3   SGSSGMANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNK-EEAEKKFKLVSEAYE 61
Query: 127 TLSDPNTRALYD 138
            LSD   R+LYD
Sbjct: 62  VLSDSKKRSLYD 73
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 6e-22
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 6e-21
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-20
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-20
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-20
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-20
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 7e-20
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 7e-20
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 8e-20
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-19
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-19
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-19
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-19
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-19
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 4e-19
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-19
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-19
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 6e-19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 6e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-17
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 8e-17
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-16
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-14
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-14
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-14
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 4e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-12
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 5e-10
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-08
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 5e-08
2guz_A71 Mitochondrial import inner membrane translocase su 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 86.8 bits (215), Expect = 6e-22
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 71  ATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSP----PERIDENTKRFIRLQEAYE 126
             + +Y +LG   S    ++KQ Y+ L+L YHPD          ++E  ++FI + +A++
Sbjct: 8   PKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK 67

Query: 127 TLSDPNTRALYDNHLATGSF 146
            L +  T+  YD        
Sbjct: 68  ILGNEETKREYDLQRCEDDL 87
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.86
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.86
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.85
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.85
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.85
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.84
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.84
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.84
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.81
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.78
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.77
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.76
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.75
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.75
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.74
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.73
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.72
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.71
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.69
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.69
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.66
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.65
2guz_A71 Mitochondrial import inner membrane translocase su 99.64
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.61
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.61
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.59
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.11
2guz_B65 Mitochondrial import inner membrane translocase su 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 87.15
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.86  E-value=5.4e-22  Score=141.10  Aligned_cols=72  Identities=33%  Similarity=0.646  Sum_probs=66.5

Q ss_pred             cchhhhcCCCCCCCHHHHHHHHHHHHHHcCCCCCCCchhhHHHHHHHHHHHHHHHcCChhhHHHHHhhhhcCCcc
Q 027814           73 ESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGSFI  147 (218)
Q Consensus        73 ~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~~~~~~~~  147 (218)
                      .|||+||||+++++.++||++|++|++++|||+++..   .+.+.|+.|++||++|+||.+|..||.++..|...
T Consensus         3 ~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~---~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~~   74 (77)
T 1hdj_A            3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEP---GAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKG   74 (77)
T ss_dssp             CCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCT---THHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCCS
T ss_pred             CCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCc---cHHHHHHHHHHHHHHHCCHHHHHHHHHHccccccc
Confidence            6899999999999999999999999999999998754   56789999999999999999999999999887653
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 5e-16
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-15
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 6e-15
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 9e-13
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-12
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 7e-10
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 71.5 bits (175), Expect = 4e-17
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 63  ASAQSLSAATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSP-PERIDENTKRFIRL 121
           ++  ++  A E+ +  +G+   VTP ++K+ Y+  VL  HPD +            F+ L
Sbjct: 23  STMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMEL 82

Query: 122 QEAYETLSDPNTRALY 137
            +A+    +   + LY
Sbjct: 83  NDAWSEFENQGQKPLY 98
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.9
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.83
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.83
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.74
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.73
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.66
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.63
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.90  E-value=4.2e-24  Score=150.16  Aligned_cols=72  Identities=38%  Similarity=0.732  Sum_probs=66.4

Q ss_pred             CcchhhhcCCCCCCCHHHHHHHHHHHHHHcCCCCCCCchhhHHHHHHHHHHHHHHHcCChhhHHHHHhhhhcCC
Q 027814           72 TESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNHLATGS  145 (218)
Q Consensus        72 ~~d~Y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~a~~~f~~I~~AY~vLsdp~~R~~YD~~~~~~~  145 (218)
                      .+|||+||||+++|+.++||+||++++++||||+++.+  +.+.+.|..|++||+||+||.+|..||++|..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~--~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD--KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT--CHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC--hHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            47999999999999999999999999999999998765  3677899999999999999999999999987654
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure