Citrus Sinensis ID: 027820

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQGYKS
cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDqlkmgkgpatvKTIAGTMFVILLSSLMSIVKIQNkgaklgtmspmdQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQGYKS
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQGYKS
MIQllflvlfaegalaflllVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSAdllleydrlledNQNLQKQAQGYKS
*IQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRL*****************************************************************HVIALQKQSADLLLEYDRL****************
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMS********************LWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLI*****************************************************************************DLLLEYDRLLEDNQ***********
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRS*****************************LKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNL*********
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQ****
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVIALQKQxxxxxxxxxxxxxxxxxxxxxAQGYKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q61335245 B-cell receptor-associate yes no 0.399 0.355 0.415 2e-06
Q5R8H3246 B-cell receptor-associate yes no 0.293 0.260 0.437 1e-05
P51572246 B-cell receptor-associate no no 0.293 0.260 0.437 1e-05
Q54G14 1081 Uncharacterized protein D yes no 0.426 0.086 0.306 3e-05
Q5R9U7241 B-cell receptor-associate no no 0.527 0.477 0.300 0.0006
Q9UHQ4241 B-cell receptor-associate no no 0.527 0.477 0.300 0.0007
>sp|Q61335|BAP31_MOUSE B-cell receptor-associated protein 31 OS=Mus musculus GN=Bcap31 PE=1 SV=4 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 127 EEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVI 186
           EE +QL+K   +  DK +  + E+K   EE  +L  +L+KLK E     K+LE A+   +
Sbjct: 152 EENDQLKKGAAEDGDKLDIGNTEMKL--EENKSLKNDLRKLKDELASTKKKLEKAENEAL 209

Query: 187 ALQKQSADLLLEYDRLLEDNQNLQKQAQG 215
           A+QKQS  L  EYDRLLE++  LQ   +G
Sbjct: 210 AMQKQSEGLTKEYDRLLEEHAKLQASVRG 238
May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.
Mus musculus (taxid: 10090)
>sp|Q5R8H3|BAP31_PONAB B-cell receptor-associated protein 31 OS=Pongo abelii GN=BCAP31 PE=2 SV=3 Back     alignment and function description
>sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens GN=BCAP31 PE=1 SV=3 Back     alignment and function description
>sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 Back     alignment and function description
>sp|Q5R9U7|BAP29_PONAB B-cell receptor-associated protein 29 OS=Pongo abelii GN=BCAP29 PE=2 SV=1 Back     alignment and function description
>sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens GN=BCAP29 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
224129502218 predicted protein [Populus trichocarpa] 0.995 0.995 0.843 7e-99
255560099292 bcr-associated protein, bap, putative [R 0.986 0.736 0.851 7e-98
118487316218 unknown [Populus trichocarpa] 0.995 0.995 0.829 1e-96
356527360218 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.807 2e-96
356567842218 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.811 2e-96
224069846212 predicted protein [Populus trichocarpa] 0.972 1.0 0.839 6e-95
359495524218 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.788 2e-94
449453280219 PREDICTED: uncharacterized protein LOC10 0.995 0.990 0.816 3e-88
297792061219 hypothetical protein ARALYDRAFT_494932 [ 0.986 0.981 0.795 1e-84
195647502217 B-cell receptor-associated protein 31-li 0.972 0.976 0.683 1e-78
>gi|224129502|ref|XP_002320602.1| predicted protein [Populus trichocarpa] gi|222861375|gb|EEE98917.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 201/217 (92%)

Query: 1   MIQLLFLVLFAEGALAFLLLVKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSS 60
           MIQLLF VLFAEG +A LLLVKIGPLR+LVIKSLDQ+KMGKGPATVKTIAGTM VIL SS
Sbjct: 1   MIQLLFFVLFAEGFVASLLLVKIGPLRDLVIKSLDQVKMGKGPATVKTIAGTMSVILFSS 60

Query: 61  LMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRS 120
           LMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASL+GFTLFLGF+IDRMHHYL+KLI LRS
Sbjct: 61  LMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGLRS 120

Query: 121 NAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLET 180
           + GSSKEEVE+LQKEKMQLK++E KASKE+K LQE+ STLS NLKKLK E EQKDKQ+ET
Sbjct: 121 SVGSSKEEVERLQKEKMQLKEEEGKASKEMKLLQEQFSTLSENLKKLKLESEQKDKQIET 180

Query: 181 ADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQGYK 217
           A+AHV+AL K+SADLLLEYDRLLEDNQNLQ QA G++
Sbjct: 181 AEAHVVALHKRSADLLLEYDRLLEDNQNLQAQATGHR 217

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255560099|ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis] gi|223539636|gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118487316|gb|ABK95486.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527360|ref|XP_003532279.1| PREDICTED: uncharacterized protein LOC100526877 [Glycine max] Back     alignment and taxonomy information
>gi|356567842|ref|XP_003552124.1| PREDICTED: uncharacterized protein LOC100793884 [Glycine max] Back     alignment and taxonomy information
>gi|224069846|ref|XP_002303054.1| predicted protein [Populus trichocarpa] gi|222844780|gb|EEE82327.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495524|ref|XP_002266257.2| PREDICTED: uncharacterized protein LOC100255733 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453280|ref|XP_004144386.1| PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus] gi|449506090|ref|XP_004162649.1| PREDICTED: uncharacterized LOC101213598 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297792061|ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. lyrata] gi|297309750|gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|195647502|gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein [Zea mays] gi|195650999|gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein [Zea mays] gi|414873939|tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2152501219 AT5G48660 "AT5G48660" [Arabido 0.894 0.890 0.728 8.9e-70
TAIR|locus:2098520220 AT3G07190 "AT3G07190" [Arabido 0.880 0.872 0.703 2.2e-66
TAIR|locus:2152691218 AT5G42570 "AT5G42570" [Arabido 0.839 0.839 0.415 5.2e-33
TAIR|locus:1005716776221 AT1G11905 "AT1G11905" [Arabido 0.830 0.819 0.361 1.9e-28
TAIR|locus:2092364137 AT3G20450 "AT3G20450" [Arabido 0.444 0.708 0.408 1.4e-14
RGD|1302944245 Bcap31 "B-cell receptor-associ 0.665 0.591 0.290 5.6e-05
MGI|MGI:1350933245 Bcap31 "B cell receptor associ 0.665 0.591 0.284 7.5e-05
UNIPROTKB|P51572246 BCAP31 "B-cell receptor-associ 0.669 0.593 0.278 0.00014
UNIPROTKB|E2R5S2246 BCAP31 "Uncharacterized protei 0.559 0.495 0.274 0.00018
UNIPROTKB|E2R4U9267 BCAP31 "Uncharacterized protei 0.559 0.456 0.274 0.00022
TAIR|locus:2152501 AT5G48660 "AT5G48660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 707 (253.9 bits), Expect = 8.9e-70, P = 8.9e-70
 Identities = 142/195 (72%), Positives = 165/195 (84%)

Query:    21 VKIGPLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPM 80
             +KIGPLRELVIKSLDQ+KMGKGPATVKTIAGTM VIL S+LMSIVKIQNKGAKLGTMSPM
Sbjct:    21 IKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGAKLGTMSPM 80

Query:    81 DQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLK 140
             DQVLWRTHLLEASL+G  LFLGFIIDRMHHYL KLI LRSN GSSKEE+EQLQKE+ +LK
Sbjct:    81 DQVLWRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINLRSNVGSSKEELEQLQKERTELK 140

Query:   141 DKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSAXXXXXXX 200
             +KEEKASKE+K+LQ ++S+++  LKK ++E ++K+K+LETA+ HV ALQKQSA       
Sbjct:   141 EKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYD 200

Query:   201 XXXXXNQNLQKQAQG 215
                  NQ+LQ Q  G
Sbjct:   201 RLLEDNQHLQSQILG 215
GO:0003674 "molecular_function" evidence=ND
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016021 "integral to membrane" evidence=IEA
TAIR|locus:2098520 AT3G07190 "AT3G07190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152691 AT5G42570 "AT5G42570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716776 AT1G11905 "AT1G11905" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092364 AT3G20450 "AT3G20450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1302944 Bcap31 "B-cell receptor-associated protein 31" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1350933 Bcap31 "B cell receptor associated protein 31" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P51572 BCAP31 "B-cell receptor-associated protein 31" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5S2 BCAP31 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4U9 BCAP31 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information 
 Score = 44.2 bits (105), Expect = 1e-05
 Identities = 26/98 (26%), Positives = 55/98 (56%), Gaps = 3/98 (3%)

Query: 120 SNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQKDKQLE 179
           S+  S++E + +LQ+E  +L+++  +  ++L  LQ+E   L   L  L++E E+  K+L 
Sbjct: 59  SDTPSARERLPELQQELAELQEELAELQEQLAELQQENQELKQELSTLEAELERLQKELA 118

Query: 180 T---ADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQ 214
                 A+ I L +++ +L  E   L ++N+ L+ + +
Sbjct: 119 RIKQLSANAIELDEENRELREELAELKQENEALEAENE 156

Members of this protein family have a signal peptide, a strongly conserved SH3 domain, a variable region, and then a C-terminal hydrophobic transmembrane alpha helix region. Length = 198
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG1962216 consensus B-cell receptor-associated protein and r 100.0
PF05529192 Bap31: B-cell receptor-associated protein 31-like 100.0
COG5374192 Uncharacterized conserved protein [Function unknow 99.97
KOG1962216 consensus B-cell receptor-associated protein and r 98.77
COG4372 499 Uncharacterized protein conserved in bacteria with 96.45
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 96.41
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 96.41
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 95.73
PRK09039 343 hypothetical protein; Validated 95.61
PRK11637 428 AmiB activator; Provisional 95.29
PRK11637 428 AmiB activator; Provisional 95.06
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.92
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.83
COG5185 622 HEC1 Protein involved in chromosome segregation, i 94.61
PF00038 312 Filament: Intermediate filament protein; InterPro: 94.61
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 94.44
PF05529192 Bap31: B-cell receptor-associated protein 31-like 94.42
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.86
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.54
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.46
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 93.39
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.18
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.82
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.74
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 91.52
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.13
COG4942 420 Membrane-bound metallopeptidase [Cell division and 89.62
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 89.56
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.47
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 89.41
KOG0933 1174 consensus Structural maintenance of chromosome pro 89.38
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 89.24
PF00038 312 Filament: Intermediate filament protein; InterPro: 89.06
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 88.82
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 88.69
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 88.67
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 88.56
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 88.35
PRK09039 343 hypothetical protein; Validated 88.25
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.22
KOG0963 629 consensus Transcription factor/CCAAT displacement 88.13
PRK10884206 SH3 domain-containing protein; Provisional 87.67
PRK12704 520 phosphodiesterase; Provisional 87.51
KOG1003205 consensus Actin filament-coating protein tropomyos 87.48
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 87.37
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 86.97
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 86.96
PHA02562 562 46 endonuclease subunit; Provisional 86.86
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 86.64
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 86.41
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.35
PF04136157 Sec34: Sec34-like family ; InterPro: IPR007265 Sec 86.07
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 86.05
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.97
PF13851201 GAS: Growth-arrest specific micro-tubule binding 85.93
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 85.86
KOG0933 1174 consensus Structural maintenance of chromosome pro 85.51
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 85.46
PRK12705 508 hypothetical protein; Provisional 85.42
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 85.33
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.86
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 84.51
PRK1542279 septal ring assembly protein ZapB; Provisional 84.4
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.36
KOG0996 1293 consensus Structural maintenance of chromosome pro 84.19
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 84.11
COG3879 247 Uncharacterized protein conserved in bacteria [Fun 84.0
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 83.43
PF0706183 Swi5: Swi5; InterPro: IPR010760 This entry represe 83.15
PHA02562 562 46 endonuclease subunit; Provisional 83.07
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 82.96
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 82.71
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 82.57
PF14235157 DUF4337: Domain of unknown function (DUF4337) 82.3
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.21
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 81.97
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 81.71
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 81.7
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 81.68
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 81.28
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 80.98
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 80.64
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 80.4
KOG0971 1243 consensus Microtubule-associated protein dynactin 80.4
PF0610390 DUF948: Bacterial protein of unknown function (DUF 80.38
COG4768139 Uncharacterized protein containing a divergent ver 80.34
COG2433 652 Uncharacterized conserved protein [Function unknow 80.27
PF13851201 GAS: Growth-arrest specific micro-tubule binding 80.05
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-46  Score=316.70  Aligned_cols=201  Identities=35%  Similarity=0.484  Sum_probs=163.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHhcccchhH---HHHHHHHHHhhhCCcchhHHHHHHHHHHHHHhhHHHHHHhhhcc--c---
Q 027820            1 MIQLLFLVLFAEGALAFLLLVKIGPLR---ELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKG--A---   72 (218)
Q Consensus         1 ~~~lvf~~L~~Em~~~~lL~lP~~P~r---k~~~~~~~~~~~~~~~~~~~~~~~~l~llF~Dsv~~~~k~~~~~--~---   72 (218)
                      |+++||++||+||+++++||+|+ |.|   +++...+......++.+++.+++++++++|+|||+|+++|.++.  +   
T Consensus         1 ~~tlvf~iL~~Eial~~iL~Lpi-p~r~~~~~~~~~~~~~~~~~~~~~i~~~~~villlfiDsvr~i~~~~~~~~~~~n~   79 (216)
T KOG1962|consen    1 YWTLVFTILYAEIALFLILLLPI-PPRRRRKIFKDRLKSGLAPQVLKTIATTMIVILLLFIDSVRRIQKYVSEYGSMANP   79 (216)
T ss_pred             CHHHHHHHHHHHHHHHHHHHcCC-CHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccCC
Confidence            78999999999999999999999 984   33333333333434577899999999999999999999998762  1   


Q ss_pred             --cCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHhHhhhHhhhhhHHH
Q 027820           73 --KLGTMSPMDQVLWRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKEL  150 (218)
Q Consensus        73 --~~~~~~~~~~~~~~~rrfn~YLtGF~LFL~lvI~R~~~li~~l~~l~~~~~a~~~~~kq~~~~~~~~~~~~~~~~~~~  150 (218)
                        .+....|.++.+++.+| |.|||||+|||||||+|+|+++++++.++++        +++++++..+++.....+   
T Consensus        80 ~~~~~a~~~~~~~l~raqr-n~YisGf~LFL~lvI~R~~~ll~~l~~l~~~--------~~~~~~~~~lk~~~~~~~---  147 (216)
T KOG1962|consen   80 TDQPLARTHLLEALFRAQR-NLYISGFVLFLSLVIRRLHTLLRELATLRAN--------EKAMKENEALKKQLENSS---  147 (216)
T ss_pred             ccchHHHHHHHHHHHHHHh-hhHHhHHHHHHHHHHHHHHHHHHHHHHHHhh--------HHHHHHHHHHHHhhhccc---
Confidence              11233455677888888 9999999999999999999999999999986        556666555554322111   


Q ss_pred             HHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Q 027820          151 KRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQG  215 (218)
Q Consensus       151 ~~~~~e~~~l~~e~~kLk~el~~~~kel~~~~~d~~aLKKQae~l~~EYdrL~~e~~~l~~~l~~  215 (218)
                       ...+++.+..++.++|+++++++.+++++++.+.++|+||++++++|||||.+||++||++++.
T Consensus       148 -~~~~~~~~~~~~~~kL~~el~~~~~~Le~~~~~~~al~Kq~e~~~~EydrLlee~~~Lq~~i~~  211 (216)
T KOG1962|consen  148 -KLEEENDKLKADLEKLETELEKKQKKLEKAQKKVDALKKQSEGLQDEYDRLLEEYSKLQEQIES  211 (216)
T ss_pred             -chhhhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHhc
Confidence             1445667788899999999999999999999999999999999999999999999999999873

>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>COG5374 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF04136 Sec34: Sec34-like family ; InterPro: IPR007265 Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1 Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG3879 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07061 Swi5: Swi5; InterPro: IPR010760 This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14235 DUF4337: Domain of unknown function (DUF4337) Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins Back     alignment and domain information
>COG4768 Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-05
3ghg_B 461 Fibrinogen beta chain; triple-stranded coiled coil 1e-04
1lwu_C 323 Fibrinogen gamma chain; heterotrimer, protein-pept 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 48.7 bits (116), Expect = 5e-07
 Identities = 21/105 (20%), Positives = 45/105 (42%)

Query: 114  KLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKELKRLQEEISTLSVNLKKLKSECEQ 173
            K+ ++  +    +++  +L KE+  L+++    +  L   +E+   L+    K +S   +
Sbjct: 984  KIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISE 1043

Query: 174  KDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQGYKS 218
             + +L+  +     L+K    L  E   L E    LQ Q    K+
Sbjct: 1044 LEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKA 1088
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Length = 461 Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.26
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.54
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.53
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.24
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 94.22
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 94.15
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 93.37
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 93.37
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 93.13
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 92.16
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 91.28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.33
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 90.12
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 88.43
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 88.36
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 88.29
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 87.8
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 87.35
4h22_A103 Leucine-rich repeat flightless-interacting protei; 87.15
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 86.16
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 84.99
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 84.63
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.55
3cl3_D130 NF-kappa-B essential modulator; death effector dom 82.02
4h22_A103 Leucine-rich repeat flightless-interacting protei; 82.0
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 81.85
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 81.15
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
Probab=95.26  E-value=0.21  Score=38.96  Aligned_cols=55  Identities=16%  Similarity=0.210  Sum_probs=32.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 027820          160 LSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQ  214 (218)
Q Consensus       160 l~~e~~kLk~el~~~~kel~~~~~d~~aLKKQae~l~~EYdrL~~e~~~l~~~l~  214 (218)
                      +..++++++.|+...+.++.+.+...+.++++.+.+.++++.|..+..+|+..+.
T Consensus        80 L~~~l~~~~kE~~~lK~el~~~~~k~e~~~~e~~~l~~~~~~l~~~~~~le~~~~  134 (138)
T 3hnw_A           80 LSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQKNIVKLETELN  134 (138)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444555555555555555566666666666666666666666666655443
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 85.97
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=85.97  E-value=2.8  Score=28.80  Aligned_cols=54  Identities=20%  Similarity=0.179  Sum_probs=26.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 027820          161 SVNLKKLKSECEQKDKQLET-ADAHVIALQKQSADLLLEYDRLLEDNQNLQKQAQ  214 (218)
Q Consensus       161 ~~e~~kLk~el~~~~kel~~-~~~d~~aLKKQae~l~~EYdrL~~e~~~l~~~l~  214 (218)
                      ..+++.|+.+-....+++.+ ...+.+.+++++..+..+-..+.++...+..++.
T Consensus        41 ~~~~e~l~~~rN~~sk~i~k~~~~~~~~l~~~~k~lk~~i~~le~~~~~~~~~l~   95 (110)
T d1seta1          41 KKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALREKEARLE   95 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444444444444444433 2334455555555555555555555555554443