Citrus Sinensis ID: 027830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MDMELFFKKIKPSPREEAHPSSPLVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEKELLALAANKDLSFNYTPKPHPMPAPAVEEVGLAEVPPPHSIPNLPLPLPSTLKSTQEIEDKTLVSAGR
ccccccccccccccccccccccccccccEEEEccHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccEEEEEEccccEEEEEEEEcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHccccccHHHcccccccccEEEEEccHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccccccEEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEccccc
MDMELFFkkikpspreeahpsspLVHRLALELGRHKDLVESLWHAGDKLVvvdffspgcggckalhpkicqlaemnpdvqFLQVNYEEHKSMCYSLnvhvlpffrfyrgahgrvcsfsctnATIKKFKDALAkhtpdrcglgptkglEEKELLALAANkdlsfnytpkphpmpapaveevglaevppphsipnlplplpstlkstqEIEDKTLVSAGR
MDMELFFkkikpspreeahpssPLVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDalakhtpdrcglgptKGLEEKELLALAANKDLSFNYTPKPHPMPAPAVEEVGLAEVPPPHSIPNLPLplpstlkstqeiedktlvsagr
MDMELFFKKIKPSPREEAHPSSPLVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTkgleekellalaankdlSFNYTPKPHPMPAPAVEEVGLAEVppphsipnlplplpstlksTQEIEDKTLVSAGR
************************VHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGP*******ELLALAA*************************************************************
************************VHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAK*************************************************************************************
MDMELFFKKIK************LVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEKELLALAANKDLSFNYTPKPHPMPAPAVEEVGLAEVPPPHSIPNLPLPLPSTLKSTQEIEDKTLVSAGR
******F*************SSPLVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEKELLALAANKDLSFNYTPK**************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMELFFKKIKPSPREEAHPSSPLVHRLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEKELLALAANKDLSFNYTPKPHPMPAPAVEEVGLAEVPPPHSIPNLPLPLPSTLKSTQEIEDKTLVSAGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
O64654275 Thioredoxin-like 1-1, chl yes no 0.802 0.636 0.734 3e-75
Q10M18279 Thioredoxin-like 1-2, chl yes no 0.811 0.634 0.678 9e-69
Q6Z4N3279 Thioredoxin-like 1-1, chl yes no 0.944 0.738 0.604 5e-66
O22779273 Thioredoxin-like 1-3, chl no no 0.605 0.483 0.772 9e-59
Q9XFI1245 Thioredoxin-like 1-2, chl no no 0.619 0.551 0.674 6e-50
Q5TKD8216 Thioredoxin-like 2, chlor no no 0.541 0.546 0.466 9e-30
Q8LEK4221 Thioredoxin-like 2-1, chl no no 0.486 0.479 0.462 1e-26
Q8LCT3236 Thioredoxin-like 2-2, chl no no 0.444 0.411 0.484 3e-23
O96952106 Thioredoxin OS=Geodia cyd N/A no 0.371 0.764 0.345 8e-10
Q8IFW4157 Thioredoxin-T OS=Drosophi yes no 0.431 0.598 0.364 7e-09
>sp|O64654|TRL11_ARATH Thioredoxin-like 1-1, chloroplastic OS=Arabidopsis thaliana GN=At1g08570 PE=2 SV=1 Back     alignment and function desciption
 Score =  281 bits (718), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 154/188 (81%), Gaps = 13/188 (6%)

Query: 31  ELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHK 90
           E+   ++LV+SL +AGDKLVVVDFFSPGCGGCKALHPKICQ AEMNPDVQFLQVNYEEHK
Sbjct: 101 EISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHK 160

Query: 91  SMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEK 150
           SMCYSL VHVLPFFRFYRG+ GRVCSFSCTNATIKKF+DALAKH PDRC LGPTKGLEEK
Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEK 220

Query: 151 ELLALAANKDLSFNYTPKPHPMPAPAVEEVGLAEVPPPHSIPNLPLPLPSTLKSTQEIED 210
           EL+ALAANK+L+F YTPKP P+           E   P S P+LP+PLPS   +    ++
Sbjct: 221 ELVALAANKELNFTYTPKPVPVE---------KEAATPDSNPSLPVPLPSMSSN----DE 267

Query: 211 KTLVSAGR 218
           KTLVSAGR
Sbjct: 268 KTLVSAGR 275




Thiol-disulfide oxidoreductase that may participate in various redox reactions. Possesses insulin disulfide bonds reducing activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q10M18|TRL12_ORYSJ Thioredoxin-like 1-2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0326500 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z4N3|TRL11_ORYSJ Thioredoxin-like 1-1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0684100 PE=2 SV=1 Back     alignment and function description
>sp|O22779|TRL13_ARATH Thioredoxin-like 1-3, chloroplastic OS=Arabidopsis thaliana GN=At2g33270 PE=2 SV=1 Back     alignment and function description
>sp|Q9XFI1|TRL12_ARATH Thioredoxin-like 1-2, chloroplastic OS=Arabidopsis thaliana GN=At5g61440 PE=2 SV=1 Back     alignment and function description
>sp|Q5TKD8|TRL2_ORYSJ Thioredoxin-like 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0200100 PE=2 SV=1 Back     alignment and function description
>sp|Q8LEK4|TRL21_ARATH Thioredoxin-like 2-1, chloroplastic OS=Arabidopsis thaliana GN=At4g26160 PE=2 SV=2 Back     alignment and function description
>sp|Q8LCT3|TRL22_ARATH Thioredoxin-like 2-2, chloroplastic OS=Arabidopsis thaliana GN=At4g29670 PE=2 SV=2 Back     alignment and function description
>sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 Back     alignment and function description
>sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
224144761295 predicted protein [Populus trichocarpa] 0.857 0.633 0.8 7e-81
255568982296 Thioredoxin, putative [Ricinus communis] 0.862 0.635 0.753 7e-79
380710175287 chloroplast Trx [Gossypium hirsutum] 0.834 0.634 0.734 8e-75
224125912304 predicted protein [Populus trichocarpa] 0.862 0.618 0.728 1e-74
356571680297 PREDICTED: thioredoxin-like 1-1, chlorop 0.844 0.619 0.744 4e-74
255639909248 unknown [Glycine max] 0.844 0.741 0.744 6e-74
384156891222 thioredoxin-like protein 1.2, partial [P 0.862 0.846 0.728 8e-74
312282269274 unnamed protein product [Thellungiella h 0.802 0.638 0.755 8e-74
15223262275 thioredoxin-like 1-1 [Arabidopsis thalia 0.802 0.636 0.734 2e-73
145323804244 thioredoxin-like 1-1 [Arabidopsis thalia 0.802 0.717 0.734 2e-73
>gi|224144761|ref|XP_002325404.1| predicted protein [Populus trichocarpa] gi|222862279|gb|EEE99785.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 165/190 (86%), Gaps = 3/190 (1%)

Query: 31  ELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHK 90
           E+   +DLV+SL +AGD+LVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHK
Sbjct: 107 EVTSAQDLVDSLMNAGDQLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHK 166

Query: 91  SMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEK 150
           SMCYSLNVHVLPFFRFYRGAHGR+CSFSCTNATIKKFKDALAKHTP+RC LGPTKGLEEK
Sbjct: 167 SMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPERCSLGPTKGLEEK 226

Query: 151 ELLALAANKDLSFNYTPKP-HPMPAPAVEEVGLAEVPPPHSIPNLPLPLP-STLKSTQEI 208
           EL+ALAANKDLSF YTPKP  P P PA EEV      P HS   LPLPLP ++ KS Q+ 
Sbjct: 227 ELVALAANKDLSFTYTPKPVQPAPVPAEEEVA-PTAGPSHSDRGLPLPLPITSSKSAQDS 285

Query: 209 EDKTLVSAGR 218
           E+KTLVS+GR
Sbjct: 286 EEKTLVSSGR 295




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255568982|ref|XP_002525461.1| Thioredoxin, putative [Ricinus communis] gi|223535274|gb|EEF36951.1| Thioredoxin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|380710175|gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224125912|ref|XP_002319706.1| predicted protein [Populus trichocarpa] gi|118488527|gb|ABK96076.1| unknown [Populus trichocarpa] gi|222858082|gb|EEE95629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356571680|ref|XP_003554002.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255639909|gb|ACU20247.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|384156891|gb|AFH68082.1| thioredoxin-like protein 1.2, partial [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|312282269|dbj|BAJ34000.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|15223262|ref|NP_172333.1| thioredoxin-like 1-1 [Arabidopsis thaliana] gi|51701910|sp|O64654.1|TRL11_ARATH RecName: Full=Thioredoxin-like 1-1, chloroplastic; AltName: Full=Atypical cysteine/histidine-rich thioredoxin 4; Short=AtACHT4; AltName: Full=Lilium-type thioredoxin 1-1; Flags: Precursor gi|4973256|gb|AAD35005.1|AF144387_1 thioredoxin-like 1 [Arabidopsis thaliana] gi|9802552|gb|AAF99754.1|AC003981_4 F22O13.5 [Arabidopsis thaliana] gi|14334494|gb|AAK59444.1| putative thioredoxin [Arabidopsis thaliana] gi|17104801|gb|AAL34289.1| putative thioredoxin [Arabidopsis thaliana] gi|332190186|gb|AEE28307.1| thioredoxin-like 1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145323804|ref|NP_001077491.1| thioredoxin-like 1-1 [Arabidopsis thaliana] gi|332190187|gb|AEE28308.1| thioredoxin-like 1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2025625275 ACHT4 "atypical CYS HIS rich t 0.669 0.530 0.726 1.4e-55
TAIR|locus:2051048273 ACHT3 "atypical CYS HIS rich t 0.605 0.483 0.659 7.9e-46
TAIR|locus:2163168245 ACHT5 "atypical CYS HIS rich t 0.532 0.473 0.683 5.9e-41
TAIR|locus:2120860221 ACHT1 "atypical CYS HIS rich t 0.481 0.475 0.466 1.4e-25
TAIR|locus:2134443236 ACHT2 "atypical CYS HIS rich t 0.417 0.385 0.516 3.8e-23
UNIPROTKB|Q98TX1105 TXN "Thioredoxin" [Ophiophagus 0.435 0.904 0.336 1.2e-10
FB|FBgn0029752157 TrxT "Thioredoxin T" [Drosophi 0.440 0.611 0.357 1.5e-10
ZFIN|ZDB-GENE-030131-8581108 zgc:56493 "zgc:56493" [Danio r 0.417 0.842 0.357 1.1e-09
RGD|1359251550 Txndc2 "thioredoxin domain con 0.435 0.172 0.346 2e-09
UNIPROTKB|Q5XHX6550 Txndc2 "Thioredoxin domain-con 0.435 0.172 0.346 2e-09
TAIR|locus:2025625 ACHT4 "atypical CYS HIS rich thioredoxin 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 573 (206.8 bits), Expect = 1.4e-55, P = 1.4e-55
 Identities = 106/146 (72%), Positives = 115/146 (78%)

Query:    31 ELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHK 90
             E+   ++LV+SL +AGDKLVVVDFFSPGCGGCKALHPKICQ AEMNPDVQFLQVNYEEHK
Sbjct:   101 EISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHK 160

Query:    91 SMCYSLNVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKHTPDRCGLGPTXXXXXX 150
             SMCYSL VHVLPFFRFYRG+ GRVCSFSCTNATIKKF+DALAKH PDRC LGPT      
Sbjct:   161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEK 220

Query:   151 XXXXXXXXXXXSFNYTPKPHPMPAPA 176
                        +F YTPKP P+   A
Sbjct:   221 ELVALAANKELNFTYTPKPVPVEKEA 246




GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IDA
GO:0031969 "chloroplast membrane" evidence=IDA
TAIR|locus:2051048 ACHT3 "atypical CYS HIS rich thioredoxin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163168 ACHT5 "atypical CYS HIS rich thioredoxin 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120860 ACHT1 "atypical CYS HIS rich thioredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134443 ACHT2 "atypical CYS HIS rich thioredoxin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q98TX1 TXN "Thioredoxin" [Ophiophagus hannah (taxid:8665)] Back     alignment and assigned GO terms
FB|FBgn0029752 TrxT "Thioredoxin T" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8581 zgc:56493 "zgc:56493" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1359251 Txndc2 "thioredoxin domain containing 2 (spermatozoa)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XHX6 Txndc2 "Thioredoxin domain-containing protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O64654TRL11_ARATHNo assigned EC number0.73400.80270.6363yesno
Q10M18TRL12_ORYSJNo assigned EC number0.67870.81190.6344yesno
Q6Z4N3TRL11_ORYSJNo assigned EC number0.60440.94490.7383yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
cd0294793 cd02947, TRX_family, TRX family; composed of two g 1e-18
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 6e-12
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 7e-10
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 5e-09
PTZ0005198 PTZ00051, PTZ00051, thioredoxin; Provisional 2e-08
cd02985103 cd02985, TRX_CDSP32, TRX family, chloroplastic dro 3e-08
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER 7e-08
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 6e-07
cd02957113 cd02957, Phd_like, Phosducin (Phd)-like family; co 2e-06
cd0294997 cd02949, TRX_NTR, TRX domain, novel NADPH thioredo 3e-06
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superf 1e-05
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 4e-05
cd0298497 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int 7e-05
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 2e-04
pfam13098105 pfam13098, Thioredoxin_2, Thioredoxin-like domain 2e-04
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 2e-04
cd02989113 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like fam 2e-04
pfam1390594 pfam13905, Thioredoxin_8, Thioredoxin-like 4e-04
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret 8e-04
cd03023154 cd03023, DsbA_Com1_like, DsbA family, Com1-like su 8e-04
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 8e-04
cd02966116 cd02966, TlpA_like_family, TlpA-like family; compo 0.001
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp 0.002
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 0.004
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
 Score = 76.8 bits (190), Expect = 1e-18
 Identities = 25/65 (38%), Positives = 40/65 (61%)

Query: 45  AGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFF 104
              K VVVDF++P CG CKA+ P + +LAE  P V+F++V+ +E+  +     V  +P F
Sbjct: 8   KSAKPVVVDFWAPWCGPCKAIAPVLEELAEEYPKVKFVKVDVDENPELAEEYGVRSIPTF 67

Query: 105 RFYRG 109
            F++ 
Sbjct: 68  LFFKN 72


Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins. Length = 93

>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239283 cd02985, TRX_CDSP32, TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239255 cd02957, Phd_like, Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>gnl|CDD|239247 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|239287 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|239321 cd03023, DsbA_Com1_like, DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.9
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.89
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.89
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.88
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.88
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.88
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.88
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.87
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.87
PHA02278103 thioredoxin-like protein 99.87
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.87
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.86
COG3118304 Thioredoxin domain-containing protein [Posttransla 99.86
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.86
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.85
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.85
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.85
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.85
PRK09381109 trxA thioredoxin; Provisional 99.85
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.84
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.84
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.84
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.83
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 99.83
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.83
PRK10996139 thioredoxin 2; Provisional 99.83
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 99.82
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.82
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.82
PTZ0005198 thioredoxin; Provisional 99.82
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.81
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.81
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.81
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.81
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.8
PTZ00102477 disulphide isomerase; Provisional 99.8
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.8
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.8
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.8
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 99.8
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.8
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.79
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.78
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.78
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.77
PTZ00062204 glutaredoxin; Provisional 99.77
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.77
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.77
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.77
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.76
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.76
PLN02309457 5'-adenylylsulfate reductase 99.76
KOG4277 468 consensus Uncharacterized conserved protein, conta 99.76
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.75
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.74
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.74
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.74
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.72
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.72
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.71
PTZ00102 477 disulphide isomerase; Provisional 99.71
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.71
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.7
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.7
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.65
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 99.64
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.62
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.58
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.56
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.55
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.53
PHA0212575 thioredoxin-like protein 99.52
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.52
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 99.5
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.46
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.45
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.45
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.44
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.42
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.42
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 99.42
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.39
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.39
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.39
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.39
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.38
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.36
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.36
COG4232569 Thiol:disulfide interchange protein [Posttranslati 99.32
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 99.3
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.28
PRK13728181 conjugal transfer protein TrbB; Provisional 99.28
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.26
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.26
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.21
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 99.19
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.18
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.14
PTZ00056199 glutathione peroxidase; Provisional 99.13
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.11
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.11
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 99.11
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 99.08
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 99.08
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.07
PF13728215 TraF: F plasmid transfer operon protein 99.06
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.05
KOG1672211 consensus ATP binding protein [Posttranslational m 99.04
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 99.02
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 99.01
PLN02412167 probable glutathione peroxidase 98.99
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 98.99
smart00594122 UAS UAS domain. 98.98
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.97
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.96
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.94
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.93
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.92
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.88
TIGR02739256 TraF type-F conjugative transfer system pilin asse 98.87
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 98.78
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 98.77
KOG0913248 consensus Thiol-disulfide isomerase and thioredoxi 98.77
PRK13703248 conjugal pilus assembly protein TraF; Provisional 98.74
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 98.73
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 98.73
PTZ00256183 glutathione peroxidase; Provisional 98.72
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.72
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.72
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.71
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 98.63
PRK1120085 grxA glutaredoxin 1; Provisional 98.61
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 98.59
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.58
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.57
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 98.56
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 98.55
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.51
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 98.48
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 98.48
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 98.47
PRK13190202 putative peroxiredoxin; Provisional 98.44
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.43
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.42
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.4
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 98.4
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 98.4
PRK10606183 btuE putative glutathione peroxidase; Provisional 98.38
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.38
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 98.34
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.33
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 98.32
KOG3425128 consensus Uncharacterized conserved protein [Funct 98.3
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.3
PRK15000200 peroxidase; Provisional 98.28
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 98.28
KOG3171273 consensus Conserved phosducin-like protein [Signal 98.27
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 98.27
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 98.26
PF01216 383 Calsequestrin: Calsequestrin; InterPro: IPR001393 98.26
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 98.22
PRK10877232 protein disulfide isomerase II DsbC; Provisional 98.16
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 98.13
PRK13189222 peroxiredoxin; Provisional 98.13
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.12
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.09
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 98.09
PTZ00137261 2-Cys peroxiredoxin; Provisional 98.07
PRK13599215 putative peroxiredoxin; Provisional 98.03
PRK13191215 putative peroxiredoxin; Provisional 97.99
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 97.98
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 97.96
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.94
PTZ00253199 tryparedoxin peroxidase; Provisional 97.94
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 97.88
KOG3170240 consensus Conserved phosducin-like protein [Signal 97.87
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.86
PRK1032981 glutaredoxin-like protein; Provisional 97.84
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 97.81
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 97.73
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 97.72
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.72
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 97.7
PHA03050108 glutaredoxin; Provisional 97.69
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 97.69
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 97.6
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 97.58
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 97.57
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 97.57
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 97.55
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 97.52
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 97.47
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 97.47
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 97.42
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 97.41
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.4
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 97.25
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.23
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 97.22
KOG2603331 consensus Oligosaccharyltransferase, gamma subunit 97.21
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 97.13
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 97.08
PRK1063883 glutaredoxin 3; Provisional 97.07
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 96.93
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 96.89
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 96.8
PRK10824115 glutaredoxin-4; Provisional 96.64
KOG2640319 consensus Thioredoxin [Function unknown] 96.3
PF13743176 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. 96.24
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 96.18
cd0297494 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit 96.09
PTZ00062204 glutaredoxin; Provisional 96.05
KOG1752104 consensus Glutaredoxin and related proteins [Postt 95.85
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 95.77
COG1331 667 Highly conserved protein containing a thioredoxin 95.68
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 95.36
PF01323193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 95.02
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 94.89
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 94.72
PHA03075123 glutaredoxin-like protein; Provisional 93.44
cd0297872 KaiB_like KaiB-like family; composed of the circad 93.42
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 93.03
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 92.99
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 92.7
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 92.59
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 92.58
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 92.14
PRK09301103 circadian clock protein KaiB; Provisional 91.25
TIGR0265487 circ_KaiB circadian clock protein KaiB. Members of 91.08
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 91.0
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 90.11
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 89.69
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 89.67
PF09673113 TrbC_Ftype: Type-F conjugative transfer system pil 89.26
PF06053249 DUF929: Domain of unknown function (DUF929); Inter 89.26
COG2761225 FrnE Predicted dithiol-disulfide isomerase involve 89.03
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 88.85
KOG2792280 consensus Putative cytochrome C oxidase assembly p 88.61
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 88.52
PRK01655131 spxA transcriptional regulator Spx; Reviewed 88.21
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 87.68
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 87.24
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 86.05
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 85.94
COG0278105 Glutaredoxin-related protein [Posttranslational mo 85.91
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 85.8
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 85.06
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 85.05
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 84.87
PHA02278103 thioredoxin-like protein 84.77
TIGR02742130 TrbC_Ftype type-F conjugative transfer system pili 84.71
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 84.37
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 84.16
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 83.95
PRK12559131 transcriptional regulator Spx; Provisional 83.66
PF09822271 ABC_transp_aux: ABC-type uncharacterized transport 82.91
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 82.85
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 82.84
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 80.67
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 80.51
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 80.38
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.90  E-value=1.2e-23  Score=160.58  Aligned_cols=107  Identities=18%  Similarity=0.380  Sum_probs=96.8

Q ss_pred             cCcEEecChhhHHHHHHhcCCCeEEEEEECCCChhHHhHHHHHHHHHHHCCC-cEEEEEeCcCcHHHHHHCCCCcCCEEE
Q 027830           27 RLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPD-VQFLQVNYEEHKSMCYSLNVHVLPFFR  105 (218)
Q Consensus        27 ~~v~~i~s~~~~~~~l~~~~~k~vlV~Fya~wC~~C~~~~p~l~~la~~~~~-v~~~~Vd~~~~~~l~~~~~I~~~Pti~  105 (218)
                      .....+.+..+|++.+.+ ++.+|+|+|||+||++|+.+.|.++++..+|.| ++|++||.|++.+++.+|+|..+||++
T Consensus        42 ~~~~~~~s~~~~~~~Vi~-S~~PVlVdF~A~WCgPCk~l~P~l~~~~~~~~g~~k~~kvdtD~~~ela~~Y~I~avPtvl  120 (150)
T KOG0910|consen   42 ATLFNVQSDSEFDDKVIN-SDVPVLVDFHAEWCGPCKMLGPILEELVSEYAGKFKLYKVDTDEHPELAEDYEISAVPTVL  120 (150)
T ss_pred             cccccccCHHHHHHHHHc-cCCCEEEEEecCcCccHhHhhHHHHHHHHhhcCeEEEEEEccccccchHhhcceeeeeEEE
Confidence            346677888899999986 899999999999999999999999999999987 999999999999999999999999999


Q ss_pred             EEeCCCeeEEEEecCccCHHHHHHHHHhhCC
Q 027830          106 FYRGAHGRVCSFSCTNATIKKFKDALAKHTP  136 (218)
Q Consensus       106 l~~~g~~~~~~~~~g~~~~~~l~~~l~~~~~  136 (218)
                      +|++|+ ....+. |..+.+.|.++|++.+.
T Consensus       121 vfknGe-~~d~~v-G~~~~~~l~~~i~k~l~  149 (150)
T KOG0910|consen  121 VFKNGE-KVDRFV-GAVPKEQLRSLIKKFLK  149 (150)
T ss_pred             EEECCE-Eeeeec-ccCCHHHHHHHHHHHhc
Confidence            999996 444555 89999999999998764



>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>KOG2640 consensus Thioredoxin [Function unknown] Back     alignment and domain information
>PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK09301 circadian clock protein KaiB; Provisional Back     alignment and domain information
>TIGR02654 circ_KaiB circadian clock protein KaiB Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09673 TrbC_Ftype: Type-F conjugative transfer system pilin assembly protein; InterPro: IPR019106 This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system (aka type 4 secretion system) for the transfer of plasmid DNA [, ] Back     alignment and domain information
>PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function Back     alignment and domain information
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR02742 TrbC_Ftype type-F conjugative transfer system pilin assembly protein TrbC Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3zzx_A105 Crystallographic Structure Of Thioredoxin From Lito 1e-09
2fa4_A111 Crystal Structure Of Oxidized Form From Saccharomyc 3e-09
2hsy_A104 Solution Structure Of Thioredoxin 2 From Saccharomy 3e-09
1trs_A105 The High-Resolution Three-Dimensional Solution Stru 4e-09
2vim_A104 X-Ray Structure Of Fasciola Hepatica Thioredoxin Le 6e-09
1f9m_A112 Crystal Structure Of Thioredoxin F From Spinach Chl 1e-08
2ifq_A105 Crystal Structure Of S-Nitroso Thioredoxin Length = 1e-08
1faa_A124 Crystal Structure Of Thioredoxin F From Spinach Chl 1e-08
3m9j_A105 Crystal Structure Of Human Thioredoxin C6973S DOUBL 1e-08
2hsh_A105 Crystal Structure Of C73s Mutant Of Human Thioredox 1e-08
2ifq_B105 Crystal Structure Of S-Nitroso Thioredoxin Length = 2e-08
3kd0_A105 Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showin 2e-08
1mdi_A105 High Resolution Solution Nmr Structure Of Mixed Dis 2e-08
4dss_B112 Crystal Structure Of Peroxiredoxin Ahp1 From Saccha 3e-08
3pin_A104 Crystal Structure Of Mxr1 From Saccharomyces Cerevi 3e-08
1aiu_A105 Human Thioredoxin (D60n Mutant, Reduced Form) Lengt 4e-08
3trx_A105 High-Resolution Three-Dimensional Structure Of Redu 4e-08
1xwa_A111 Drospohila Thioredoxin, Oxidized, P41212 Length = 1 9e-08
1xw9_A106 Drospohila Thioredoxin, Oxidized, P21 Length = 106 1e-07
2pu9_C111 Crystal Srtucture Of The Binary Complex Between Fer 1e-07
3qfa_C116 Crystal Structure Of The Human Thioredoxin Reductas 1e-07
3e3e_A105 Human Thioredoxin Double Mutant C35s,C73r Length = 2e-07
1ti3_A113 Solution Structure Of The Thioredoxin H1 From Popla 2e-07
1xfl_A124 Solution Structure Of Thioredoxin H1 From Arabidops 4e-07
2hxk_A105 Crystal Structure Of S-Nitroso Thioredoxin Length = 6e-07
1m7t_A107 Solution Structure And Dynamics Of The Human-Escher 8e-07
2vlt_A122 Crystal Structure Of Barley Thioredoxin H Isoform 2 1e-06
1erw_A105 Human Thioredoxin Double Mutant With Cys 32 Replace 2e-06
2vm1_A118 Crystal Structure Of Barley Thioredoxin H Isoform 1 2e-06
2xbq_A117 Crystal Structure Of Reduced Schistosoma Mansoni Th 3e-06
2xbi_A108 Crystal Structure Of Schistosoma Mansoni Thioredoxi 4e-06
2j23_A121 Cross-Reactivity And Crystal Structure Of Malassezi 4e-06
1gh2_A107 Crystal Structure Of The Catalytic Domain Of A New 4e-06
2f51_A118 Structure Of Trichomonas Vaginalis Thioredoxin Leng 7e-06
2i9h_A103 Nmr Solution Structure Of The Reduced Form Of Thior 8e-06
3f3q_A109 Crystal Structure Of The Oxidised Form Of Thioredox 8e-06
3hhv_A110 The Crystal Structure Of The Thioredoxin A2 From Su 1e-05
1wmj_A130 Solution Structure Of Thioredoxin Type H From Oryza 1e-05
2iwt_A125 Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Compl 1e-05
2oe0_A114 Crystal Structure Of Mitochondrial Thioredoxin 3 Fr 2e-05
1v98_A140 Crystal Structure Analysis Of Thioredoxin From Ther 6e-05
3f3r_A109 Crystal Structure Of Yeast Thioredoxin1-Glutathione 7e-05
1mek_A120 Human Protein Disulfide Isomerase, Nmr, 40 Structur 2e-04
1fb0_A105 Crystal Structure Of Thioredoxin M From Spinach Chl 2e-04
1gl8_A104 Solution Structure Of Thioredoxin M From Spinach, O 2e-04
3d21_A139 Crystal Structure Of A Poplar Wild-Type Thioredoxin 2e-04
1syr_A112 Initial Structural Analysis Of Plasmodium Falciparu 2e-04
1nw2_A105 The Crystal Structure Of The Mutant R82e Of Thiored 3e-04
3p2a_A148 Crystal Structure Of Thioredoxin 2 From Yersinia Pe 3e-04
1quw_A105 Solution Structure Of The Thioredoxin From Bacillus 3e-04
2e0q_A104 Crystal Structure Of K53e Thioredoxin From Sulfolob 3e-04
1t00_A112 The Structure Of Thioredoxin From S. Coelicolor Len 6e-04
2b5e_A 504 Crystal Structure Of Yeast Protein Disulfide Isomer 6e-04
>pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei Length = 105 Back     alignment and structure

Iteration: 1

Score = 59.7 bits (143), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 29/94 (30%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Query: 28 LALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYE 87 + ++ +D + L AG+KLVV+DF++ CG CK + PK+ +L++ DV FL+V+ + Sbjct: 1 MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVD 60 Query: 88 EHKSMCYSLNVHVLPFFRFYRGAHGRVCSFSCTN 121 E + + + +P F F + ++ S S N Sbjct: 61 ECEDIAQDNQIACMPTFLFMKNGQ-KLDSLSGAN 93
>pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 Back     alignment and structure
>pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 Back     alignment and structure
>pdb|1TRS|A Chain A, The High-Resolution Three-Dimensional Solution Structures Of The Oxidized And Reduced States Of Human Thioredoxin Length = 105 Back     alignment and structure
>pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin Length = 104 Back     alignment and structure
>pdb|1F9M|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Short Form) Length = 112 Back     alignment and structure
>pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|1FAA|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Long Form) Length = 124 Back     alignment and structure
>pdb|3M9J|A Chain A, Crystal Structure Of Human Thioredoxin C6973S DOUBLE MUTANT, REDUCED Form Length = 105 Back     alignment and structure
>pdb|2HSH|A Chain A, Crystal Structure Of C73s Mutant Of Human Thioredoxin-1 Oxidized With H2o2 Length = 105 Back     alignment and structure
>pdb|2IFQ|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|3KD0|A Chain A, Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showing Cadmium Chloride Bound To The Active Site Length = 105 Back     alignment and structure
>pdb|1MDI|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide Intermediate Between Mutant Human Thioredoxin And A 13 Residue Peptide Comprising Its Target Site In Human Nfkb Length = 105 Back     alignment and structure
>pdb|4DSS|B Chain B, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Complex With Thioredoxin Trx2 Length = 112 Back     alignment and structure
>pdb|3PIN|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Complex With Trx2 Length = 104 Back     alignment and structure
>pdb|1AIU|A Chain A, Human Thioredoxin (D60n Mutant, Reduced Form) Length = 105 Back     alignment and structure
>pdb|3TRX|A Chain A, High-Resolution Three-Dimensional Structure Of Reduced Recombinant Human Thioredoxin In Solution Length = 105 Back     alignment and structure
>pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 Length = 111 Back     alignment and structure
>pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21 Length = 106 Back     alignment and structure
>pdb|2PU9|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin F Length = 111 Back     alignment and structure
>pdb|3QFA|C Chain C, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 116 Back     alignment and structure
>pdb|3E3E|A Chain A, Human Thioredoxin Double Mutant C35s,C73r Length = 105 Back     alignment and structure
>pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Back     alignment and structure
>pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Back     alignment and structure
>pdb|2HXK|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 Back     alignment and structure
>pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human-Escherichia Coli Thioredoxin Chimera: Insights Into Thermodynamic Stability Length = 107 Back     alignment and structure
>pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State Length = 122 Back     alignment and structure
>pdb|1ERW|A Chain A, Human Thioredoxin Double Mutant With Cys 32 Replaced By Ser And Cys 35 Replaced By Ser Length = 105 Back     alignment and structure
>pdb|2VM1|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 Crystallized Using Ammonium Sulfate As Precipitant Length = 118 Back     alignment and structure
>pdb|2XBQ|A Chain A, Crystal Structure Of Reduced Schistosoma Mansoni Thioredoxin Pre-Protein At 1.7 Angstrom Length = 117 Back     alignment and structure
>pdb|2XBI|A Chain A, Crystal Structure Of Schistosoma Mansoni Thioredoxin At 1.6 Angstrom Length = 108 Back     alignment and structure
>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 Back     alignment and structure
>pdb|1GH2|A Chain A, Crystal Structure Of The Catalytic Domain Of A New Human Thioredoxin-Like Protein Length = 107 Back     alignment and structure
>pdb|2F51|A Chain A, Structure Of Trichomonas Vaginalis Thioredoxin Length = 118 Back     alignment and structure
>pdb|2I9H|A Chain A, Nmr Solution Structure Of The Reduced Form Of Thioredoxin 1 From Yeast (Trx1) Length = 103 Back     alignment and structure
>pdb|3F3Q|A Chain A, Crystal Structure Of The Oxidised Form Of Thioredoxin 1 From Saccharomyces Cerevisiae Length = 109 Back     alignment and structure
>pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 Back     alignment and structure
>pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza Sativa Length = 130 Back     alignment and structure
>pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Complex With The Target Protein Basi Length = 125 Back     alignment and structure
>pdb|2OE0|A Chain A, Crystal Structure Of Mitochondrial Thioredoxin 3 From Saccharomyces Cerevisiae Length = 114 Back     alignment and structure
>pdb|1V98|A Chain A, Crystal Structure Analysis Of Thioredoxin From Thermus Thermophilus Length = 140 Back     alignment and structure
>pdb|3F3R|A Chain A, Crystal Structure Of Yeast Thioredoxin1-Glutathione Mixed Disulfide Complex Length = 109 Back     alignment and structure
>pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 Back     alignment and structure
>pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 Back     alignment and structure
>pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 Back     alignment and structure
>pdb|3D21|A Chain A, Crystal Structure Of A Poplar Wild-Type Thioredoxin H, Pttrxh4 Length = 139 Back     alignment and structure
>pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 Back     alignment and structure
>pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|3P2A|A Chain A, Crystal Structure Of Thioredoxin 2 From Yersinia Pestis Length = 148 Back     alignment and structure
>pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|2E0Q|A Chain A, Crystal Structure Of K53e Thioredoxin From Sulfolobus Tokodaii Strain7 Length = 104 Back     alignment and structure
>pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 Back     alignment and structure
>pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 3e-17
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 4e-17
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 1e-16
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 3e-15
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 9e-15
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 1e-14
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 1e-14
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 1e-14
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 2e-14
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 3e-14
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 7e-14
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 7e-14
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 1e-13
1wmj_A130 Thioredoxin H-type; structural genomics, program f 1e-13
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 1e-13
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 2e-13
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 2e-13
4euy_A105 Uncharacterized protein; structural genomics, PSI- 2e-13
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 2e-13
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 2e-13
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 5e-13
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 8e-13
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 2e-12
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 3e-12
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 4e-12
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 3e-11
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 1e-10
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 2e-10
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 2e-09
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 5e-07
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 3e-09
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 7e-09
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 2e-08
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 2e-08
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-08
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 2e-08
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 2e-08
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 4e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 6e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 7e-08
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 1e-07
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 2e-06
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 3e-07
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 1e-04
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 4e-07
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 2e-05
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 4e-07
1mek_A120 Protein disulfide isomerase; electron transport, r 5e-07
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 6e-07
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 6e-07
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 8e-07
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 1e-06
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 3e-06
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 5e-06
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 5e-06
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 7e-06
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 8e-06
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 9e-06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 2e-05
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 2e-05
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 2e-05
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 2e-05
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 3e-05
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 3e-05
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 3e-05
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 3e-05
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 5e-05
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 7e-05
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 1e-04
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 1e-04
2l57_A126 Uncharacterized protein; structural genomics, unkn 1e-04
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 1e-04
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 1e-04
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 1e-04
2l5l_A136 Thioredoxin; structural genomics, electron transpo 1e-04
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 1e-04
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 2e-04
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 2e-04
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 2e-04
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 3e-04
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 3e-04
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 3e-04
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 3e-04
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 3e-04
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 3e-04
2yzu_A109 Thioredoxin; redox protein, electron transport, st 4e-04
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 4e-04
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 5e-04
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 5e-04
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 6e-04
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 6e-04
1bed_A181 DSBA oxidoreductase; TCPG, protein disulfide isome 7e-04
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 7e-04
2kuc_A130 Putative disulphide-isomerase; structural genomics 7e-04
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 7e-04
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 8e-04
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 9e-04
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
 Score = 73.1 bits (180), Expect = 3e-17
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query: 40  ESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVH 99
             L  AG +L VV F   GCG C  + P    ++   P   FL+V+  + +    + N+ 
Sbjct: 14  PELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNIS 73

Query: 100 VLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKH 134
             P F+F+R    R+  +   +A     ++ + +H
Sbjct: 74  ATPTFQFFRNKV-RIDQYQGADA--VGLEEKIKQH 105


>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Length = 195 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Length = 193 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Length = 193 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 Back     alignment and structure
>1bed_A DSBA oxidoreductase; TCPG, protein disulfide isomerase, disulfide oxidoreductase; 2.00A {Vibrio cholerae} SCOP: c.47.1.13 PDB: 2ijy_A Length = 181 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 1e-10
d2ifqa1105 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien 4e-09
d2trcp_217 c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ 2e-08
d1ti3a_113 c.47.1.1 (A:) Thioredoxin {European aspen (Populus 5e-08
d1xwaa_111 c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m 5e-08
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 7e-08
d1z6na1166 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps 2e-07
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 3e-07
d1syra_103 c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas 3e-07
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 5e-07
d1xfla_114 c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi 5e-07
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 1e-06
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 1e-06
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 1e-06
d1hyua496 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase 2e-06
d1ep7a_112 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 5e-06
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 1e-05
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 1e-05
d1a8la2107 c.47.1.2 (A:120-226) Protein disulfide isomerase, 5e-05
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 6e-05
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 7e-05
d1fb6a_104 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 9e-05
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 1e-04
d1r26a_113 c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax 2e-04
d1eeja1156 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC 2e-04
d2b5xa1143 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase 0.001
d1sena_135 c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 0.002
d1nhoa_85 c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik 0.003
d1fo5a_85 c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik 0.003
d1g7ea_122 c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, 0.003
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 0.003
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin-like protein, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.4 bits (130), Expect = 1e-10
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 3/98 (3%)

Query: 37  DLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSL 96
           D    L  AG +L VV F   GCG C  + P    ++   P   FL+V+  + +    + 
Sbjct: 11  DFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATN 70

Query: 97  NVHVLPFFRFYRGAHGRVCSFSCTNATIKKFKDALAKH 134
           N+   P F+F+R    R+  +   +A     ++ + +H
Sbjct: 71  NISATPTFQFFRNKV-RIDQYQGADA--VGLEEKIKQH 105


>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.93
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.92
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.92
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.92
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.92
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.92
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.92
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.92
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.92
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.91
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.91
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.91
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.91
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.9
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.9
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.9
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.89
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.89
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.86
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.85
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.84
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.84
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.84
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.83
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.8
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.79
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.79
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.79
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.79
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.78
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.73
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.6
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.56
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.56
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.53
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.52
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.49
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.49
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.44
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.42
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.39
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.37
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 99.36
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.35
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.3
d1wjka_100 Thioredoxin-like structure containing protein C330 99.3
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.23
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 98.59
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 98.55
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 98.48
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 98.46
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 98.43
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 98.43
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 98.41
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.39
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 98.38
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 98.25
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.25
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 98.25
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.18
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 98.13
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 98.07
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 98.01
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 98.0
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 97.98
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 97.93
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 97.93
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 97.93
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 97.9
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.85
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 97.82
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 97.81
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.8
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 97.76
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 97.75
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 97.65
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.49
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 97.48
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.39
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.37
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.36
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.33
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 97.15
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.12
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.01
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 96.97
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 96.87
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.69
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 96.13
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 95.81
d2axoa1225 Hypothetical protein Atu2684 {Agrobacterium tumefa 94.27
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 93.89
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 93.87
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 93.71
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 93.0
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 91.5
d1hyua3102 Alkyl hydroperoxide reductase subunit F (AhpF), N- 91.34
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 90.91
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 90.67
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 89.52
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 88.07
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 88.05
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 87.28
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 86.19
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 84.86
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 83.98
d1t4za_105 Adaptive-response sensory-kinase SasA, N-terminal 80.4
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin-like protein, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=6e-25  Score=148.70  Aligned_cols=106  Identities=25%  Similarity=0.482  Sum_probs=97.5

Q ss_pred             CCCEEECCHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCCCEEEE
Q ss_conf             57089569636999998139993999997899966774899999999879993999996767488898779982778999
Q 027830           27 RLALELGRHKDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRF  106 (218)
Q Consensus        27 ~~v~~i~s~~~~~~~l~~~~~k~vlV~FyA~WC~~Ck~l~p~~~~la~~~~~v~~~~Vd~~~~~~l~~~~~I~~~Pti~l  106 (218)
                      ++|..|.+.++|++.+..+++++++|+|||+||++|+.+.|.|++++++++++.|++||++++++++.+|+|.++||+++
T Consensus         1 ~~v~~i~s~~~f~~~l~~~~~klvvv~F~a~wC~~Ck~~~p~~~~la~~~~~~~f~~vd~d~~~~l~~~~~v~~~Pt~~~   80 (107)
T d1gh2a_           1 VGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQF   80 (107)
T ss_dssp             CCEEEECSGGGHHHHHHHTTTSCEEEEEECSSCHHHHHHHHHHHHHHHHCTTSEEEEEETTTSHHHHHHTTCCSSSEEEE
T ss_pred             CCEEECCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHCCCEECEEEEE
T ss_conf             95489099999999998679997999998898778643133220012322100222344432433466528144328999


Q ss_pred             EECCCEEEEEEECCCCCHHHHHHHHHHHC
Q ss_conf             96998239887048538999999999549
Q 027830          107 YRGAHGRVCSFSCTNATIKKFKDALAKHT  135 (218)
Q Consensus       107 f~~g~~~~~~~~~g~~~~~~l~~~i~~~~  135 (218)
                      |++|+ .+..+. | .+.+.|.++|++++
T Consensus        81 ~~~G~-~v~~~~-G-~~~~~l~~~i~k~l  106 (107)
T d1gh2a_          81 FRNKV-RIDQYQ-G-ADAVGLEEKIKQHL  106 (107)
T ss_dssp             EETTE-EEEEEE-S-SCHHHHHHHHHHHH
T ss_pred             EECCE-EEEEEE-C-CCHHHHHHHHHHHH
T ss_conf             99998-999995-9-79999999999963



>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure