Citrus Sinensis ID: 027901

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------

MAAFKPMAFLALLVVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDKVPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLGIRSSDSQKTSSNNETISRDDENQAISFQPGKFHWMSILIMSMVIAIWK

cccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcc

cHHHHHHHHHHHHHHHHHHHHccccccccHHHcHccccHHcccccccccccccccccccEEEEccccccccccccccccccccccEccccEEccccccccccccccccccccccccccEEEEccccEEEcccccEEEEEcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHc

MAAFKPMAFLALLVVLLpttalgdlddlapalspffdkmcekvdcgkgkcradmthpfnfrcecepgwkktkdndedndhsflpciipdctlhydschtapppdpdkvphnisvfepcswiycgegtcrntsnykhtceckpgfnnllntsyfpcfsnctlgadceklgirssdsqktssnnetisrddenqaisfqpgkfhWMSILIMSMVIAIWK

MAAFKPMAFLALLVVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCradmthpfnfrcecepgWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDKVPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLGirssdsqktssnnetisrddenqaISFQPGKFHWMSILIMSMVIAIWK

MAAFKPMAFlallvvllpttalgdlddlapalSPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDKVPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLGIRSSDSQKTSSNNETISRDDENQAISFQPGKFHWMSILIMSMVIAIWK

****KPMAFLALLVVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKK********DHSFLPCIIPDCTLHYDSCHT********VPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLG*************************SFQPGKFHWMSILIMSMVIAIW*

**AFKPMAFLALLVVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDKVPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLG******************************KFHWMSILIMSMVIAIWK

*AAFKPMAFLALLVVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDKVPHNISVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLGI*************************FQPGKFHWMSILIMSMVIAIWK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHi

oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo

SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHi

SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		217
351723053		204	uncharacterized protein LOC100500690 pre	0.930	0.990	0.465	6e-54
255542322		204	conserved hypothetical protein [Ricinus	0.935	0.995	0.472	2e-53
224123390		211	predicted protein [Populus trichocarpa]	0.953	0.981	0.486	4e-53
356576694		202	PREDICTED: uncharacterized protein LOC10	0.921	0.990	0.460	7e-51
225451297		206	PREDICTED: uncharacterized protein LOC10	0.843	0.888	0.510	7e-50
388492988		203	unknown [Medicago truncatula]	0.917	0.980	0.452	2e-49
297737101		212	unnamed protein product [Vitis vinifera]	0.972	0.995	0.426	6e-43
449442915		213	PREDICTED: uncharacterized protein LOC10	0.829	0.845	0.475	9e-40
255552065		240	conserved hypothetical protein [Ricinus	0.870	0.787	0.438	1e-39
356502862		213	PREDICTED: uncharacterized protein LOC10	0.926	0.943	0.423	2e-39

>gi\|351723053\|ref\|NP_001238033.1\| uncharacterized protein LOC100500690 precursor [Glycine max] gi\|255630943\|gb\|ACU15834.1\| unknown [Glycine max]	Back alignment and taxonomy information

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 102/219 (46%), Positives = 145/219 (66%), Gaps = 17/219 (7%)

Query: 1   MAAFKPMAFLALL-VVLLPTTALGDLDDLAPALSPFFDKMCEKVDCGKGKCRADMTHPFN 59
           M + K +  +A+L +VLLP  A GD       ++ FFDK+CE+V+CGKG C  + ++P N
Sbjct: 1   MGSSKLLGIMAMLFIVLLPMAAKGD------NITDFFDKVCEEVECGKGSCVVNTSYPLN 54

Query: 60  FRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTLHYDSCHTAPPPDPDK-VPHNISVFEPC 118
           F CEC+ GWK+T+D+D++   SFLPC+IP+C+L+Y  C  APPP P+K  PHN S F+PC
Sbjct: 55  FVCECDSGWKRTQDDDDEYATSFLPCVIPECSLNY-GCQPAPPPVPEKSFPHNFSAFDPC 113

Query: 119 SWIYCGEGTCRNTSNYKHTCECKPGFNNLLNTSYFPCFSNCTLGADCEKLGIRSSDSQKT 178
            W YCGEGTC     + H CEC+P + NLLN S FPC+S CTLG+DC +LGI+ ++S   
Sbjct: 114 YWAYCGEGTCTKNRTHTHRCECQPNYYNLLNISVFPCYSECTLGSDCSRLGIKVANSSTD 173

Query: 179 SSNNETISRDDENQAISFQPGKFHWMSILIMSMVIAIWK 217
           S +        ++ + S   G+FHWM +L+MS  + +W 
Sbjct: 174 SGS--------QDSSASIFTGRFHWMVMLLMSTGMVMWS 204

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255542322\|ref\|XP_002512224.1\| conserved hypothetical protein [Ricinus communis] gi\|223548185\|gb\|EEF49676.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|224123390\|ref\|XP_002319067.1\| predicted protein [Populus trichocarpa] gi\|222857443\|gb\|EEE94990.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356576694\|ref\|XP_003556465.1\| PREDICTED: uncharacterized protein LOC100805440 [Glycine max]	Back alignment and taxonomy information

>gi\|225451297\|ref\|XP_002272890.1\| PREDICTED: uncharacterized protein LOC100267439 [Vitis vinifera] gi\|298204883\|emb\|CBI34190.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388492988\|gb\|AFK34560.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297737101\|emb\|CBI26302.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449442915\|ref\|XP_004139226.1\| PREDICTED: uncharacterized protein LOC101221137 [Cucumis sativus] gi\|449482961\|ref\|XP_004156455.1\| PREDICTED: uncharacterized LOC101221137 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255552065\|ref\|XP_002517077.1\| conserved hypothetical protein [Ricinus communis] gi\|223543712\|gb\|EEF45240.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|356502862\|ref\|XP_003520234.1\| PREDICTED: uncharacterized protein LOC100802013 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		217
TAIR\|locus:504955446		212	AT4G14746 "AT4G14746" [Arabido	0.806	0.825	0.368	4e-35
UNIPROTKB\|F1NJR4		658	FBN1 "Uncharacterized protein"	0.612	0.202	0.304	1.1e-05
UNIPROTKB\|F1NJR3		708	FBN1 "Uncharacterized protein"	0.612	0.187	0.304	1.2e-05
MGI\|MGI:95489		2871	Fbn1 "fibrillin 1" [Mus muscul	0.635	0.048	0.301	1.7e-05
UNIPROTKB\|F1PIA3		2871	FBN1 "Uncharacterized protein"	0.635	0.048	0.301	3.3e-05
UNIPROTKB\|F1N4K8		2871	FBN1 "Fibrillin-1" [Bos taurus	0.635	0.048	0.301	3.3e-05
UNIPROTKB\|P98133		2871	FBN1 "Fibrillin-1" [Bos taurus	0.635	0.048	0.301	3.3e-05
UNIPROTKB\|F1SN67		2336	FBN1 "Fibrillin-1" [Sus scrofa	0.635	0.059	0.294	3.5e-05
UNIPROTKB\|H0YND0		853	FBN1 "Fibrillin-1" [Homo sapie	0.493	0.125	0.314	9.1e-05
UNIPROTKB\|F1NR89		870	SLIT2 "Uncharacterized protein	0.470	0.117	0.309	9.3e-05

TAIR\|locus:504955446 AT4G14746 "AT4G14746" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 380 (138.8 bits), Expect = 4.0e-35, P = 4.0e-35
 Identities = 69/187 (36%), Positives = 106/187 (56%)

Query:    33 SPFFDKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIPDCTL 92
             +P +D +C++V+CGKGKC+A     F + CECE GWK+      D    FLPCI P+CT 
Sbjct:    32 APVYDNICKEVECGKGKCKAPSNTTFMYECECEDGWKQF-----DQHLKFLPCITPNCTF 86

Query:    93 HYDSCHTAPPPDPDKVPH-NI-SVFEPCSWIYCGEGTCRNTSNYKHTCECKPGFNNLLNT 150
                    A P  P   P  NI S F+PC W+ CG G C ++  ++++C C+ G++NL+N 
Sbjct:    87 DLTCGEAASPAQPKPPPKDNITSFFDPCQWMDCGGGLCNSSMPFQYSCNCREGYSNLMNI 146

Query:   151 SYFPCFSNCTLGADCEKLGIRSSDSQKTSSNNETISRDDENQAISFQPGKFHWMSILIMS 210
             + FPC   C LG DC  LGI  S+S  +SS+   +    +NQ ++ +     W+++ +  
Sbjct:   147 TTFPCLKQCALGMDCLNLGIPLSNS--SSSSPPALPDSSKNQGLNLRGSSLWWITLCVS- 203

Query:   211 MVIAIWK 217
               +A W+
Sbjct:   204 --LAPWR 208

GO:0008150 "biological_process" evidence=ND

GO:0031225 "anchored to membrane" evidence=TAS

UNIPROTKB\|F1NJR4 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NJR3 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:95489 Fbn1 "fibrillin 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PIA3 FBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N4K8 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P98133 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SN67 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|H0YND0 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NR89 SLIT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00130386	hypothetical protein (211 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		217
KOG1219		4289	consensus Uncharacterized conserved protein, conta	99.31
KOG4289		2531	consensus Cadherin EGF LAG seven-pass G-type recep	99.15
KOG4289		2531	consensus Cadherin EGF LAG seven-pass G-type recep	98.39
KOG1214		1289	consensus Nidogen and related basement membrane pr	98.25
KOG1219		4289	consensus Uncharacterized conserved protein, conta	98.06
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	97.97
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	97.95
KOG1225		525	consensus Teneurin-1 and related extracellular mat	97.88
KOG1217		487	consensus Fibrillins and related proteins containi	97.86
KOG4260		350	consensus Uncharacterized conserved protein [Funct	97.75
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	97.75
KOG1217		487	consensus Fibrillins and related proteins containi	97.63
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.63
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.53
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	97.31
smart00181		35	EGF Epidermal growth factor-like domain.	97.18
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	97.17
cd00053		36	EGF Epidermal growth factor domain, found in epide	96.87
smart00181		35	EGF Epidermal growth factor-like domain.	96.85
cd00053		36	EGF Epidermal growth factor domain, found in epide	96.74
KOG1214		1289	consensus Nidogen and related basement membrane pr	96.47
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	96.46
KOG1225		525	consensus Teneurin-1 and related extracellular mat	96.42
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	96.3
KOG1226		783	consensus Integrin beta subunit (N-terminal portio	96.16
KOG1226		783	consensus Integrin beta subunit (N-terminal portio	96.08
PF12661		13	hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E	96.02
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	95.95
PF07974		32	EGF_2: EGF-like domain; InterPro: IPR013111 A sequ	94.67
PHA03099		139	epidermal growth factor-like protein (EGF-like pro	93.45
PF12662		24	cEGF: Complement Clr-like EGF-like	92.87
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	92.79
PHA02887		126	EGF-like protein; Provisional	92.13
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	91.85
KOG4260		350	consensus Uncharacterized conserved protein [Funct	91.18
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	90.82
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	89.75
PHA02887		126	EGF-like protein; Provisional	89.55
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	89.18
KOG3514		1591	consensus Neurexin III-alpha [Signal transduction	86.69
smart00051		63	DSL delta serrate ligand.	85.24
PHA03099		139	epidermal growth factor-like protein (EGF-like pro	85.14
PF07172		95	GRP: Glycine rich protein family; InterPro: IPR010	83.99
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	83.71
KOG1836		1705	consensus Extracellular matrix glycoprotein Lamini	83.16
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	82.12
KOG3516		1306	consensus Neurexin IV [Signal transduction mechani	80.96

>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]	Back alignment and domain information

Probab=99.31  E-value=2.1e-12  Score=137.14  Aligned_cols=104  Identities=22%  Similarity=0.584  Sum_probs=82.0

Q ss_pred             CCCCcCCCCCC-CeeecCCCCCCcccccCCCCCccCCCCCCCCCCCCCCccCC-CCcCCCC--ccccCCCCCCCC-CCCC
Q 027901           37 DKMCEKVDCGK-GKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIP-DCTLHYD--SCHTAPPPDPDK-VPHN  111 (217)
Q Consensus        37 ~d~C~~~pC~~-GtC~~~~~~~~~Y~C~C~pGwtG~~c~~~~~~~~~~PC~~~-~Ct~~~g--sC~~~~~~~~~g-~g~n  111 (217)
                      .+.|+.+||+| |+|....  .++|.|+|.+-|+|.+|+.+...|.++||-.+ .|...++  .|.|     |.| +|+.
T Consensus      3864 ~d~C~~npCqhgG~C~~~~--~ggy~CkCpsqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC-----~~gyTG~~ 3936 (4289)
T KOG1219|consen 3864 TDPCNDNPCQHGGTCISQP--KGGYKCKCPSQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNC-----PNGYTGKR 3936 (4289)
T ss_pred             ccccccCcccCCCEecCCC--CCceEEeCcccccCcccccccccccCCCCCCCCEEEecCCCeeEeC-----CCCccCce
Confidence            38999999998 6999874  57899999999999999977667777777644 5654321  3554     556 8888


Q ss_pred             CC-C-CCCCCCCccCC-CeEeeCCCCceeeecCCCCccCC
Q 027901          112 IS-V-FEPCSWIYCGE-GTCRNTSNYKHTCECKPGFNNLL  148 (217)
Q Consensus       112 ~~-~-~DpC~~~~Cg~-GtC~~~~~~sY~C~C~~Gy~n~~  148 (217)
                      |+ . +++|..++|++ |+|++..+ +|+|.|.+||.|..
T Consensus      3937 Ce~~Gi~eCs~n~C~~gg~C~n~~g-sf~CncT~g~~gr~ 3975 (4289)
T KOG1219|consen 3937 CEARGISECSKNVCGTGGQCINIPG-SFHCNCTPGILGRT 3975 (4289)
T ss_pred             eecccccccccccccCCceeeccCC-ceEeccChhHhccc
Confidence            54 3 78999999994 69998855 89999999999875

>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]	Back alignment and domain information

>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]	Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG4260 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium

Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>PHA02887 EGF-like protein; Provisional	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>KOG4260 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>PHA02887 EGF-like protein; Provisional	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>KOG3514 consensus Neurexin III-alpha [Signal transduction mechanisms]	Back alignment and domain information

>smart00051 DSL delta serrate ligand	Back alignment and domain information

>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional	Back alignment and domain information

>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures]	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>KOG3516 consensus Neurexin IV [Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		217
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.61
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.6
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.44
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.37
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.37
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.36
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.32
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.26
1aut_L		114	Activated protein C; serine proteinase, plasma cal	99.25
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.18
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.18
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	99.18
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	99.17
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	99.17
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.16
2vh0_B		134	Activated factor XA light chain; serine protease,	99.16
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	99.15
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	99.13
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.08
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	99.07
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.06
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	99.05
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.03
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.03
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	99.02
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	98.98
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	98.82
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	98.77
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	98.74
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	98.64
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.61
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	98.5
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	98.5
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.45
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.43
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	98.43
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	98.41
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	98.31
2bou_A		143	EGF-like module containing mucin-like hormone rece	98.3
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	98.27
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	98.27
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.26
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	98.25
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	98.2
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	98.17
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	98.16
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	98.14
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	98.14
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	98.12
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	98.11
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	98.06
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	98.01
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.0
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	97.94
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	97.93
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	97.9
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	97.87
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	97.86
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	97.84
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	97.66
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	97.66
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	97.64
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	97.63
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	97.63
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	97.61
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	97.57
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	97.52
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	97.47
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	97.46
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	97.43
1aut_L		114	Activated protein C; serine proteinase, plasma cal	97.36
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	97.32
2vh0_B		134	Activated factor XA light chain; serine protease,	97.29
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	97.25
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	97.21
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	97.2
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	97.18
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	97.17
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	97.17
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	97.15
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	97.15
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	97.1
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	96.98
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	96.97
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	96.95
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	96.91
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	96.88
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	96.7
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	96.65
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	96.63
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	96.61
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	96.58
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	96.56
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	96.55
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	96.39
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	96.36
3v65_B		386	Low-density lipoprotein receptor-related protein;	96.35
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	96.29
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	96.25
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	96.16
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	96.14
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	96.12
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	96.06
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	96.04
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	95.92
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	95.79
2wph_E		59	Coagulation factor IXA light chain; serine proteas	95.63
1iox_A		50	Betacellulin; EGF-like fold, hormone/growth factor	95.63
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	95.57
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	95.49
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	95.47
1ob1_C		99	Major merozoite surface protein; immune system, im	95.4
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	95.31
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	94.92
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	94.8
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	94.66
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	94.4
3qcw_A		1245	Neurexin-1-alpha; synaptic adhesion molecule, cell	94.33
1szb_A		170	Mannose binding lectin-associated serine protease-	93.88
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	93.74
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	93.69
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	93.35
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	92.87
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	92.71
3qcw_A		1245	Neurexin-1-alpha; synaptic adhesion molecule, cell	92.65
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	92.55
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	91.61
1szb_A		170	Mannose binding lectin-associated serine protease-	91.35
1nzi_A		159	Complement C1S component; calcium, innate immunity	90.88
2p26_A		280	Integrin beta-2; hybrid domain, PSI domain, I-EGF	90.05
4aqt_A		375	Laminin subunit gamma-1; cell adhesion; HET: NAG B	89.88
1nzi_A		159	Complement C1S component; calcium, innate immunity	87.48
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	85.87
2ygo_A		188	WIF-1, WNT inhibitory factor 1; signaling protein,	85.38
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	85.33
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	85.31
2e26_A		725	Reelin, reeler protein; signaling protein; HET: NA	85.26
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	84.21
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	84.19
2i9a_A		145	Urokinase-type plasminogen activator; growth facto	82.95

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

Probab=99.61  E-value=1.2e-15  Score=120.01  Aligned_cols=112  Identities=22%  Similarity=0.443  Sum_probs=82.2

Q ss_pred             CCCCCc--CCCCCC-CeeecCCCCCCcccccCCCCCccCCCCCCCCCCCCCCccCC-CCcCCCC--ccccCCCCCCCC-C
Q 027901           36 FDKMCE--KVDCGK-GKCRADMTHPFNFRCECEPGWKKTKDNDEDNDHSFLPCIIP-DCTLHYD--SCHTAPPPDPDK-V  108 (217)
Q Consensus        36 ~~d~C~--~~pC~~-GtC~~~~~~~~~Y~C~C~pGwtG~~c~~~~~~~~~~PC~~~-~Ct~~~g--sC~~~~~~~~~g-~  108 (217)
                      +.|+|.  ..||.+ |+|++.   .++|+|.|.+||+|.+|+.+++++...||... .|.+..+  .|.+     ++| +
T Consensus         4 dideC~~~~~~C~~~g~C~~~---~g~~~C~C~~Gy~G~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C-----~~G~~   75 (135)
T 2vj3_A            4 DVDECSLGANPCEHAGKCINT---LGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCIC-----MPGYE   75 (135)
T ss_dssp             CCCTTTSSSCSSSTTCEEEEC---SSSEEEECCTTEESTTSCEECCTTTTCCCCSSCEEEECSSCEEEEC-----CTTEE
T ss_pred             ccccccCCCCCCCCCCEeECC---CCCEEEECCCCCcCCcccccCccCCCCCCCCCCEEeCCCCCceeeC-----CCCCc
Confidence            468998  689985 899987   57899999999999999865556776666532 4443211  3443     566 7


Q ss_pred             CCCCC-CCCCCCCCccCC-CeEeeCCCCceeeecCCCCccCCCC-CCCCCc
Q 027901          109 PHNIS-VFEPCSWIYCGE-GTCRNTSNYKHTCECKPGFNNLLNT-SYFPCF  156 (217)
Q Consensus       109 g~n~~-~~DpC~~~~Cg~-GtC~~~~~~sY~C~C~~Gy~n~~n~-t~~pC~  156 (217)
                      |.+++ ++|+|...+|.+ |+|++..+ +|+|+|++||+|..-. ..++|.
T Consensus        76 G~~C~~~~~~C~~~~C~~~g~C~~~~g-~~~C~C~~G~~G~~C~~~i~~C~  125 (135)
T 2vj3_A           76 GVHCEVNTDECASSPCLHNGRCLDKIN-EFQCECPTGFTGHLCQVDLHHIL  125 (135)
T ss_dssp             SSSSCEECCTTTTCCSTTTCEEEECSS-CEEEECCTTEESSSSCEECC---
T ss_pred             CCcceecCCcccCCCcCCCCEeECCCC-CeEEECCCCCcCCccCccCcccc
Confidence            88864 689999999984 79999754 8999999999997532 346665

PyMOL of 2vj3

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ...

Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens}	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A*	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A*	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A*	Back alignment and structure

>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus}	Back alignment and structure

>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A*	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A*	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		217
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	98.85
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.79
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.75
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.69
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.67
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.64
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	98.55
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.52
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.51
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.48
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.48
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.48
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.37
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	98.36
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.36
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	98.32
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	98.29
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	98.29
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	98.28
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.21
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	98.12
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	98.1
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.05
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.05
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	97.98
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	97.98
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.85
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	97.82
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.81
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.8
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	97.79
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.7
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	97.66
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.51
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.46
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	97.42
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.38
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	97.34
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	97.32
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.31
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	97.23
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	97.23
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	97.1
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.03
d1nt0a3		45	Mannose-binding protein associated serine protease	97.03
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	97.01
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	96.87
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	96.83
d1szba2		45	Mannose-binding protein associated serine protease	96.75
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	96.34
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	96.34
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	96.31
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	96.27
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	96.24
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	96.22
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	96.01
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	95.97
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	95.93
d1nt0a3		45	Mannose-binding protein associated serine protease	95.73
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	95.36
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	95.32
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	95.29
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	94.75
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	94.68
d1dx5i1		43	Thrombomodulin, different EGF-like domains {Human	94.63
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	94.38
d2bz6l1		53	Coagulation factor VIIa {Human (Homo sapiens) [Tax	94.36
d1rfnb_		57	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	94.2
d1szba2		45	Mannose-binding protein associated serine protease	94.14
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	94.06
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	94.0
d1l3ya_		41	Integrin beta EGF-like domains {Human (Homo sapien	93.86
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	93.16
d1jv2b5		43	Integrin beta EGF-like domains {Human (Homo sapien	92.11
d1xdtr_		41	Heparin-binding epidermal growth factor, HBEGF {Hu	91.4
d1jv2b4		31	Integrin beta EGF-like domains {Human (Homo sapien	90.49
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	87.39
d2i9aa1		40	Plasminogen activator (urokinase-type) {Human (Hom	86.23
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	85.29
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	82.87

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Activated protein c (autoprothrombin IIa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.85  E-value=3.7e-10  Score=74.31  Aligned_cols=37  Identities=30%  Similarity=0.811  Sum_probs=33.6

Q ss_pred             CCCCcCCCCCCCeeecCCCCCCcccccCCCCCccCCCCCC
Q 027901           37 DKMCEKVDCGKGKCRADMTHPFNFRCECEPGWKKTKDNDE   76 (217)
Q Consensus        37 ~d~C~~~pC~~GtC~~~~~~~~~Y~C~C~pGwtG~~c~~~   76 (217)
                      .++|.++||+||+|++.   .++|+|.|.+||+|.+|+.+
T Consensus         8 ~~~C~~~PC~nG~C~~~---~~~y~C~C~~G~~G~~Ce~~   44 (48)
T d1autl1           8 EHPCASLCCGHGTCIDG---IGSFSCDCRSGWEGRFCQRE   44 (48)
T ss_dssp             CCSSSSTTTTSEEECCC---SSCCCEEECTTEESTTSCEE
T ss_pred             CCcccCCCCCCCEEECC---CCCCeEeCCCCCcCCCcccc
Confidence            57999999999999987   46899999999999999865

PyMOL of d1autl1

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure