Citrus Sinensis ID: 027972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MHAAASLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
cccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHHcccHHHHHHHHHHHHHHHccccccEEEccEEEEEEEEccccEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHHccEEEEEEEEEEcccccccccccccccEEccc
ccHHHHHHccccccEEcccccccccccccccccccEccccccccccccccccEEEEccccccHHHHHHHHcccccHHHHHHHHHHccccccccccEEEEccHHHHccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccccEEEEEc
MHAAASLLNSSNLSLRFASQTqtrlspwiaapssvrlplnrsqnyrialpplhstvsgdstqpqqmasadvkaqdpriagissairvipdfpkpgimfqDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVIseeysleygkdVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECAcvielpelkgrerlgekplfvlvs
MHAAASLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAIrvipdfpkpGIMFQDITTLLLDTKAFRDTIDLFVerykdknisvvagEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVielpelkgrerlgekplfvlvs
MHaaasllnssnlslRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
***************************WI************************************************IAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERL****LFV***
**********************TRLSPWIA**************************************************ISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
MHAAASLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHST*******************DPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
************LSLRFA*QTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQ*******AQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAAASLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
P31166243 Adenine phosphoribosyltra yes no 0.935 0.831 0.572 6e-64
Q43199181 Adenine phosphoribosyltra N/A no 0.662 0.790 0.626 2e-54
Q42563192 Adenine phosphoribosyltra no no 0.652 0.734 0.569 4e-46
Q04WP5177 Adenine phosphoribosyltra yes no 0.620 0.757 0.440 1e-33
Q04NG3177 Adenine phosphoribosyltra yes no 0.620 0.757 0.440 1e-33
Q8EXN2177 Adenine phosphoribosyltra yes no 0.611 0.745 0.427 2e-32
Q75FP0177 Adenine phosphoribosyltra yes no 0.611 0.745 0.427 2e-32
A3QF54181 Adenine phosphoribosyltra yes no 0.625 0.745 0.421 4e-31
A9I0U7182 Adenine phosphoribosyltra yes no 0.629 0.747 0.414 2e-30
A5UBP3180 Adenine phosphoribosyltra yes no 0.583 0.7 0.445 6e-30
>sp|P31166|APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=APT1 PE=1 SV=2 Back     alignment and function desciption
 Score =  243 bits (621), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 161/241 (66%), Gaps = 39/241 (16%)

Query: 6   SLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQ 65
           S L S  L L  A      L+    AP S+RL  +RS         L    S  +++  +
Sbjct: 7   SPLVSHRLCLARAVPCNRLLNNHHRAPPSIRLSNHRSTTS------LRLFSSAAASRDSE 60

Query: 66  MASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDK 125
           MA+ DV  QDPRIA I+S+IRVIPDFPKPGIMFQDITTLLLDT+AF+DTI LFV+RYKDK
Sbjct: 61  MATEDV--QDPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDK 118

Query: 126 NISVVAG-------------------------------EVISEEYSLEYGKDVMEMHVGA 154
            ISVVAG                               +VISEEYSLEYG D +EMHVGA
Sbjct: 119 GISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTIEMHVGA 178

Query: 155 VQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVL 214
           V+ GERA+I+DDL+ATGGTL+AAIRLLERVGV +VECACVIELPELKG+E+LGE  LFVL
Sbjct: 179 VEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKEKLGETSLFVL 238

Query: 215 V 215
           V
Sbjct: 239 V 239
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 7
>sp|Q43199|APT1_WHEAT Adenine phosphoribosyltransferase 1 OS=Triticum aestivum GN=APT1 PE=2 SV=1 Back     alignment and function description
>sp|Q42563|APT2_ARATH Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana GN=APT2 PE=2 SV=1 Back     alignment and function description
>sp|Q04WP5|APT_LEPBL Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q04NG3|APT_LEPBJ Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q8EXN2|APT_LEPIN Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q75FP0|APT_LEPIC Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|A3QF54|APT_SHELP Adenine phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=apt PE=3 SV=2 Back     alignment and function description
>sp|A9I0U7|APT_BORPD Adenine phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|A5UBP3|APT_HAEIE Adenine phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=apt PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
224129882255 predicted protein [Populus trichocarpa] 0.995 0.843 0.612 1e-71
255538084253 Adenine phosphoribosyltransferase, putat 0.861 0.735 0.640 4e-67
351722933236 uncharacterized protein LOC100305792 [Gl 0.837 0.766 0.625 1e-64
82621166182 adenine phosphoribosyltransferase-like [ 0.699 0.829 0.730 3e-64
289540890186 adeninephosphoribosyl transferase [Trifo 0.694 0.806 0.707 4e-64
356514471235 PREDICTED: adenine phosphoribosyltransfe 0.898 0.825 0.596 6e-64
297845694242 hypothetical protein ARALYDRAFT_472949 [ 0.824 0.735 0.622 2e-63
414868743149 TPA: hypothetical protein ZEAMMB73_04072 0.671 0.973 0.793 3e-63
388520489184 unknown [Medicago truncatula] 0.685 0.804 0.701 3e-62
18396344243 adenine phosphoribosyltransferase 1 [Ara 0.935 0.831 0.572 3e-62
>gi|224129882|ref|XP_002320694.1| predicted protein [Populus trichocarpa] gi|222861467|gb|EEE99009.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 173/248 (69%), Gaps = 33/248 (13%)

Query: 1   MHAAASLLNSSNLSLRFASQTQTRLSPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDS 60
           +  + S+      S R    +  R S  IAA S  +LPL  SQNYR A   LH +VS   
Sbjct: 7   LRCSNSIFRPPPNSHRLRPPSLKRQSAPIAASSGAQLPLTFSQNYRTAPNRLHCSVSESQ 66

Query: 61  -TQPQQMASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFV 119
             Q ++MA+AD + QDPRIA ISSAIRVIPDFPKPGIMFQDITTLLLDTKAF+DTIDLFV
Sbjct: 67  WKQDREMATAD-EQQDPRIARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFV 125

Query: 120 ERYKDKNISVVAG-------------------------------EVISEEYSLEYGKDVM 148
           ERY+DKNISVVAG                               EVISEEYSLEYG D M
Sbjct: 126 ERYRDKNISVVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKM 185

Query: 149 EMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGE 208
           EMHVGAV+AGE AL++DDL+ATGGTL AA++LLERVGVHVVECACVIEL  LKGRERLG+
Sbjct: 186 EMHVGAVEAGEHALVIDDLIATGGTLCAAVKLLERVGVHVVECACVIELLGLKGRERLGD 245

Query: 209 KPLFVLVS 216
           +PLFVLV+
Sbjct: 246 RPLFVLVN 253

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538084|ref|XP_002510107.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] gi|223550808|gb|EEF52294.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722933|ref|NP_001236749.1| uncharacterized protein LOC100305792 [Glycine max] gi|255626617|gb|ACU13653.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|82621166|gb|ABB86271.1| adenine phosphoribosyltransferase-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|289540890|gb|ADD09567.1| adeninephosphoribosyl transferase [Trifolium repens] gi|289540907|gb|ADD09581.1| adeninephosphoribosyl transferase [Trifolium repens] Back     alignment and taxonomy information
>gi|356514471|ref|XP_003525929.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297845694|ref|XP_002890728.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] gi|297336570|gb|EFH66987.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|414868743|tpg|DAA47300.1| TPA: hypothetical protein ZEAMMB73_040727 [Zea mays] Back     alignment and taxonomy information
>gi|388520489|gb|AFK48306.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|18396344|ref|NP_564284.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] gi|38503396|sp|P31166.2|APT1_ARATH RecName: Full=Adenine phosphoribosyltransferase 1, chloroplastic; Short=APRT 1; Flags: Precursor gi|21536559|gb|AAM60891.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana] gi|332192710|gb|AEE30831.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
TAIR|locus:2147967191 APT5 "adenine phosphoribosyltr 0.388 0.439 0.690 3.7e-48
TAIR|locus:2016309192 APT2 "adenine phosphoribosyl t 0.388 0.437 0.690 4.7e-46
TAIR|locus:2127480183 APT3 "adenine phosphoribosyl t 0.439 0.519 0.693 7.9e-30
TAIR|locus:2135550182 APT4 "adenine phosphoribosyl t 0.439 0.521 0.663 7.1e-29
TIGR_CMR|GSU_1526171 GSU_1526 "adenine phosphoribos 0.388 0.491 0.440 1.6e-28
TIGR_CMR|SPO_3066179 SPO_3066 "adenine phosphoribos 0.347 0.418 0.533 2e-28
UNIPROTKB|F1S6K5180 LOC100622001 "Uncharacterized 0.388 0.466 0.476 1.7e-27
TIGR_CMR|SO_2012181 SO_2012 "adenine phosphoribosy 0.333 0.397 0.486 1.7e-27
TIGR_CMR|CPS_3745181 CPS_3745 "adenine phosphoribos 0.337 0.403 0.493 4e-26
UNIPROTKB|Q56JW4180 APRT "Adenine phosphoribosyltr 0.388 0.466 0.452 6.4e-26
TAIR|locus:2147967 APT5 "adenine phosphoribosyltransferase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 292 (107.8 bits), Expect = 3.7e-48, Sum P(2) = 3.7e-48
 Identities = 58/84 (69%), Positives = 68/84 (80%)

Query:   132 GEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVEC 191
             G+VISE Y LEYG D +EMHVGAV+  ER +I+DDLVATGGTLSAA+ LLE  G  VVEC
Sbjct:    99 GKVISESYELEYGHDRLEMHVGAVEPRERVIIIDDLVATGGTLSAAMSLLESQGAEVVEC 158

Query:   192 ACVIELPELKGRERLGEKPLFVLV 215
             ACVI LPE+KG+ +L  KPL+VLV
Sbjct:   159 ACVIGLPEVKGQHKLKGKPLYVLV 182
GO:0003999 "adenine phosphoribosyltransferase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006168 "adenine salvage" evidence=IEA
GO:0009116 "nucleoside metabolic process" evidence=IEA
TAIR|locus:2016309 APT2 "adenine phosphoribosyl transferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127480 APT3 "adenine phosphoribosyl transferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135550 APT4 "adenine phosphoribosyl transferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1526 GSU_1526 "adenine phosphoribosyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3066 SPO_3066 "adenine phosphoribosyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6K5 LOC100622001 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2012 SO_2012 "adenine phosphoribosyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3745 CPS_3745 "adenine phosphoribosyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q56JW4 APRT "Adenine phosphoribosyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P31166APT1_ARATH2, ., 4, ., 2, ., 70.57260.93510.8312yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.20.963
4th Layer2.4.2.70.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
PLN02293187 PLN02293, PLN02293, adenine phosphoribosyltransfer 1e-92
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransfer 3e-65
TIGR01090169 TIGR01090, apt, adenine phosphoribosyltransferase 4e-53
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransf 9e-43
PRK12560187 PRK12560, PRK12560, adenine phosphoribosyltransfer 9e-20
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 6e-14
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferas 6e-13
PRK07322178 PRK07322, PRK07322, adenine phosphoribosyltransfer 1e-06
COG0461201 COG0461, PyrE, Orotate phosphoribosyltransferase [ 2e-05
PRK00455202 PRK00455, pyrE, orotate phosphoribosyltransferase; 3e-05
PRK09219189 PRK09219, PRK09219, xanthine phosphoribosyltransfe 8e-05
TIGR01251308 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph 9e-05
PRK00934285 PRK00934, PRK00934, ribose-phosphate pyrophosphoki 1e-04
TIGR01367187 TIGR01367, pyrE_Therm, orotate phosphoribosyltrans 2e-04
PRK00129209 PRK00129, upp, uracil phosphoribosyltransferase; R 3e-04
PRK07199301 PRK07199, PRK07199, phosphoribosylpyrophosphate sy 4e-04
COG0462314 COG0462, PrsA, Phosphoribosylpyrophosphate synthet 4e-04
COG1040225 COG1040, ComFC, Predicted amidophosphoribosyltrans 5e-04
TIGR00336173 TIGR00336, pyrE, orotate phosphoribosyltransferase 8e-04
PRK06031233 PRK06031, PRK06031, phosphoribosyltransferase; Pro 0.002
TIGR01091207 TIGR01091, upp, uracil phosphoribosyltransferase 0.003
PRK08558238 PRK08558, PRK08558, adenine phosphoribosyltransfer 0.004
>gnl|CDD|177930 PLN02293, PLN02293, adenine phosphoribosyltransferase Back     alignment and domain information 
 Score =  268 bits (687), Expect = 1e-92
 Identities = 117/180 (65%), Positives = 128/180 (71%), Gaps = 31/180 (17%)

Query: 67  ASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKN 126
           A  +    DPR+ GISSAIRV+PDFPKPGIMFQDITTLLLD KAF+DTIDLFVERY+D  
Sbjct: 3   AMENGDQGDPRLQGISSAIRVVPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYRDMG 62

Query: 127 ISVVAG-------------------------------EVISEEYSLEYGKDVMEMHVGAV 155
           ISVVAG                               EVISEEY LEYG D +EMHVGAV
Sbjct: 63  ISVVAGIEARGFIFGPPIALAIGAKFVPLRKPGKLPGEVISEEYVLEYGTDCLEMHVGAV 122

Query: 156 QAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLV 215
           + GERAL++DDL+ATGGTL AAI LLER G  VVECACVIELPELKGRE+L  KPLFVLV
Sbjct: 123 EPGERALVIDDLIATGGTLCAAINLLERAGAEVVECACVIELPELKGREKLNGKPLFVLV 182

Length = 187
>gnl|CDD|235028 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233267 TIGR01090, apt, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|183595 PRK12560, PRK12560, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|180928 PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223537 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|234771 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181705 PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|234868 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|233377 TIGR01367, pyrE_Therm, orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>gnl|CDD|234653 PRK00129, upp, uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|235960 PRK07199, PRK07199, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223970 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129436 TIGR00336, pyrE, orotate phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|235678 PRK06031, PRK06031, phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130163 TIGR01091, upp, uracil phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|181466 PRK08558, PRK08558, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG1712183 consensus Adenine phosphoribosyl transferases [Nuc 100.0
PLN02293187 adenine phosphoribosyltransferase 99.97
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 99.93
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.92
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.92
PRK12560187 adenine phosphoribosyltransferase; Provisional 99.92
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.86
PRK09219189 xanthine phosphoribosyltransferase; Validated 99.83
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 99.83
PRK13809206 orotate phosphoribosyltransferase; Provisional 99.82
PRK09213271 pur operon repressor; Provisional 99.81
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 99.81
PRK13812176 orotate phosphoribosyltransferase; Provisional 99.79
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 99.78
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 99.78
PRK08558238 adenine phosphoribosyltransferase; Provisional 99.78
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 99.77
PRK13811170 orotate phosphoribosyltransferase; Provisional 99.76
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 99.75
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 99.71
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 99.7
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.7
PRK06031233 phosphoribosyltransferase; Provisional 99.65
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 99.48
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 99.34
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 98.95
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.94
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 98.91
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.9
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 98.88
PLN02238189 hypoxanthine phosphoribosyltransferase 98.81
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.78
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.76
PLN02297326 ribose-phosphate pyrophosphokinase 98.76
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.75
TIGR00201190 comF comF family protein. This protein is found in 98.73
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 98.73
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.72
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 98.71
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.66
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 98.65
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.65
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.62
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.61
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 98.59
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.58
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.57
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 98.57
PRK11595227 DNA utilization protein GntX; Provisional 98.52
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.5
PLN02369302 ribose-phosphate pyrophosphokinase 98.47
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.45
PRK08525445 amidophosphoribosyltransferase; Provisional 98.42
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.41
PRK09246501 amidophosphoribosyltransferase; Provisional 98.38
PLN02440479 amidophosphoribosyltransferase 98.36
PRK06781471 amidophosphoribosyltransferase; Provisional 98.36
TIGR01091207 upp uracil phosphoribosyltransferase. that include 98.35
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 98.33
PRK07349500 amidophosphoribosyltransferase; Provisional 98.26
PRK09123479 amidophosphoribosyltransferase; Provisional 98.22
COG2236192 Predicted phosphoribosyltransferases [General func 98.21
PRK05793469 amidophosphoribosyltransferase; Provisional 98.2
PRK07272484 amidophosphoribosyltransferase; Provisional 98.13
PLN02541244 uracil phosphoribosyltransferase 98.08
KOG3367216 consensus Hypoxanthine-guanine phosphoribosyltrans 98.08
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 98.08
PRK08341442 amidophosphoribosyltransferase; Provisional 98.04
PRK06388474 amidophosphoribosyltransferase; Provisional 98.01
PRK07631475 amidophosphoribosyltransferase; Provisional 97.97
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 97.85
PRK07847510 amidophosphoribosyltransferase; Provisional 97.72
KOG1448316 consensus Ribose-phosphate pyrophosphokinase [Nucl 97.6
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 97.53
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 97.28
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 97.27
PF15609191 PRTase_2: Phosphoribosyl transferase 97.03
COG1926220 Predicted phosphoribosyltransferases [General func 96.95
KOG0572474 consensus Glutamine phosphoribosylpyrophosphate am 95.4
KOG1503354 consensus Phosphoribosylpyrophosphate synthetase-a 93.5
KOG1017267 consensus Predicted uracil phosphoribosyltransfera 87.15
PF15610274 PRTase_3: PRTase ComF-like 85.34
>KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-40  Score=271.05  Aligned_cols=143  Identities=67%  Similarity=1.111  Sum_probs=138.8

Q ss_pred             CchHHHHHHhhcccCCCCCCCCcEEEechhhhcCHHHHHHHHHHHHHHhcC---CCccEEE-------------------
Q 027972           74 QDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKD---KNISVVA-------------------  131 (216)
Q Consensus        74 ~~~~~~~l~~~Ir~~PdfPk~Gi~f~Dit~Ll~dP~~~~~l~~~lae~~~~---~~iDvVv-------------------  131 (216)
                      .|+|++.|+.+||.+||||++||+|.|+++++.||.+|+.+++.|+++|++   +++|+|+                   
T Consensus         4 ~d~~~~~ik~~ir~~pdFPk~GI~F~Di~pll~dP~af~~lidlf~~h~~~~~~~~Id~iaGlEaRGFLFGP~iAlalG~   83 (183)
T KOG1712|consen    4 ADPRLKYIKTAIRVVPDFPKKGIMFQDITPLLLDPKAFKKLIDLFVDHYRETFEMKIDVIAGLEARGFLFGPSIALALGA   83 (183)
T ss_pred             ccHHHHHHHHhheeCCCCCCCceehhhhhhhhcCHHHHHHHHHHHHHHHHHHhcCcceEEEeeeecceecCcHHHHHhCC
Confidence            589999999999999999999999999999999999999999999999998   7899999                   


Q ss_pred             ------------eeEEEEeeecccCccceeeecCcccCCCEEEEEeccccccHHHHHHHHHHHHcCCEEEEEEEEEEccC
Q 027972          132 ------------GEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPE  199 (216)
Q Consensus       132 ------------G~~ia~~y~~eyG~~~l~i~~~~i~~G~rVLIVDDVitTGgTl~aai~lL~~~Ga~vv~vavlie~~~  199 (216)
                                  |.+++.+|.+|||++.++|+++++++|+||+||||+++||||+.+|.+++++.||++++|+|+++.++
T Consensus        84 ~fVPiRK~gKLPG~~i~~~Y~lEYg~d~~Emq~~Ai~~g~rvvvVDDllATGGTl~AA~~Ll~r~ga~vvE~~~vieL~~  163 (183)
T KOG1712|consen   84 GFVPIRKPGKLPGEVISESYELEYGEDRFEMQKGAIKPGQRVVVVDDLLATGGTLAAATELLERVGAEVVECACVIELPE  163 (183)
T ss_pred             CeeecccCCCCCCceeEEEEeeecCccceeeeccccCCCCeEEEEechhhcCccHHHHHHHHHHhccEEEEEEEEEEccc
Confidence                        56899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCceeccC
Q 027972          200 LKGRERLGEKPLFVLVS  216 (216)
Q Consensus       200 ~~g~e~L~~~pv~sLl~  216 (216)
                      ++|+++|.++|+++|++
T Consensus       164 LkGr~kL~~~pl~~Ll~  180 (183)
T KOG1712|consen  164 LKGREKLKGKPLFSLLE  180 (183)
T ss_pred             cCCccccCCCccEEEee
Confidence            99999999999999985

>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>PF15610 PRTase_3: PRTase ComF-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2dy0_A190 Crystal Structure Of Project Jw0458 From Escherichi 3e-29
1ore_A180 Human Adenine Phosphoribosyltransferase Length = 18 7e-23
1g2q_A187 Crystal Structure Of Adenine Phosphoribosyltransfer 2e-10
1l1q_A186 Crystal Structure Of Aprtase From Giardia Lamblia C 2e-09
1mzv_A235 Crystal Structure Of Adenine Phosphoribosyltransfer 2e-08
1qb7_A236 Crystal Structures Of Adenine Phosphoribosyltransfe 2e-08
>pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 100/171 (58%), Gaps = 31/171 (18%)
Query: 67  ASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKN 126
            S+ + A   ++  + ++I+ I D+PKPGI+F+D+T+LL D KA+  +IDL VERYK+  
Sbjct: 4   GSSGMTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAG 63
Query: 127 ISVVAG-------------------------------EVISEEYSLEYGKDVMEMHVGAV 155
           I+ V G                               E ISE Y LEYG D +E+HV A+
Sbjct: 64  ITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAI 123
Query: 156 QAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERL 206
           + G++ L+VDDL+ATGGT+ A ++L+ R+G  V + A +I L +L G +RL
Sbjct: 124 KPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRL 174
>pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 Back     alignment and structure
>pdb|1G2Q|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase Length = 187 Back     alignment and structure
>pdb|1L1Q|A Chain A, Crystal Structure Of Aprtase From Giardia Lamblia Complexed With 9- Deazaadenine Length = 186 Back     alignment and structure
>pdb|1MZV|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase (Aprt) From Leishmania Tarentolae Length = 235 Back     alignment and structure
>pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosyltransferase From Leishmania Donovani. Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 1e-73
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 5e-72
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 9e-68
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 2e-66
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 4e-59
1o57_A291 PUR operon repressor; purine operon repressor, hel 5e-42
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 3e-35
1vch_A175 Phosphoribosyltransferase-related protein; structu 9e-24
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 5e-09
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 4e-07
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 5e-07
1vdm_A153 Purine phosphoribosyltransferase; structural genom 1e-06
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 1e-06
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 1e-06
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 3e-06
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 8e-06
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 3e-05
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 4e-05
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 4e-05
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 6e-05
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 7e-04
1wd5_A208 Hypothetical protein TT1426; structural genomics, 8e-04
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Back     alignment and structure
 Score =  220 bits (562), Expect = 1e-73
 Identities = 67/177 (37%), Positives = 102/177 (57%), Gaps = 33/177 (18%)

Query: 73  AQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAG 132
           A   ++  + ++I+ I D+PKPGI+F+D+T+LL D KA+  +IDL VERYK+  I+ V G
Sbjct: 10  ATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKVVG 69

Query: 133 -------------------------------EVISEEYSLEYGKDVMEMHVGAVQAGERA 161
                                          E ISE Y LEYG D +E+HV A++ G++ 
Sbjct: 70  TEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGDKV 129

Query: 162 LIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEK--PLFVLVS 216
           L+VDDL+ATGGT+ A ++L+ R+G  V + A +I L +L G +RL ++    + LV 
Sbjct: 130 LVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVP 186
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Length = 180 Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Length = 211 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Length = 453 Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Length = 243 Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Length = 221 Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Length = 226 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Length = 232 Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Length = 178 Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Length = 379 Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Length = 317 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.94
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.94
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.93
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 99.93
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.92
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 99.79
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 99.78
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 99.77
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 99.77
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 99.72
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 99.72
1vch_A175 Phosphoribosyltransferase-related protein; structu 99.72
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 99.71
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 99.7
1o57_A291 PUR operon repressor; purine operon repressor, hel 99.68
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 99.68
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 99.68
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 99.66
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 99.64
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.62
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 99.49
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 99.48
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.46
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 99.41
1vdm_A153 Purine phosphoribosyltransferase; structural genom 99.37
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 99.35
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.3
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.24
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 99.2
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.2
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.19
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.14
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.12
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 99.08
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 99.05
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.04
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 99.02
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 99.0
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 98.98
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 98.94
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 98.83
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 98.8
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 98.79
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 98.74
1wd5_A208 Hypothetical protein TT1426; structural genomics, 98.73
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.65
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 98.47
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 98.4
2e55_A208 Uracil phosphoribosyltransferase; structural genom 98.3
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 98.26
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 98.25
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 98.24
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 98.24
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 98.08
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 97.95
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 97.92
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 97.79
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
Probab=99.94  E-value=1.3e-26  Score=192.69  Aligned_cols=150  Identities=44%  Similarity=0.788  Sum_probs=122.9

Q ss_pred             cchhhhcccccCCchHHHHHHhhcccCCCCCCCCcEEEechhhhcCHHHHHHHHHHHHHHhcCCCccEEEee--------
Q 027972           62 QPQQMASADVKAQDPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGE--------  133 (216)
Q Consensus        62 ~~~~~~~~~~~~~~~~~~~l~~~Ir~~PdfPk~Gi~f~Dit~Ll~dP~~~~~l~~~lae~~~~~~iDvVvG~--------  133 (216)
                      +.+.|....     ..++.|++.||.+||||++|+.|+|++.++.||+.++.+++.|++.+++.++|+|+|.        
T Consensus         4 ~~~~~~~~~-----~~~~~l~~~i~~~p~~~~~g~~~~d~~~~~~~~~~~~~l~~~la~~~~~~~~d~Iv~v~~rG~~~a   78 (190)
T 2dy0_A            4 GSSGMTATA-----QQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKVVGTEARGFLFG   78 (190)
T ss_dssp             -----CCCH-----HHHHHHHHHSEEETTCSSTTCCEEETHHHHHCHHHHHHHHHHHHHHHTTTTCCEEEEETTHHHHHH
T ss_pred             CcccccccH-----HHHHHHHHHHhhCCCCCCCCeEEEeChhhhcCHHHHHHHHHHHHHHhccCCCCEEEEECcccHHHH
Confidence            445565442     2467799999999999999999999999999999999999999999987778988821        


Q ss_pred             -----------------------EEEEeeecccCccceeeecCcccCCCEEEEEeccccccHHHHHHHHHHHHcCCEEEE
Q 027972          134 -----------------------VISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVE  190 (216)
Q Consensus       134 -----------------------~ia~~y~~eyG~~~l~i~~~~i~~G~rVLIVDDVitTGgTl~aai~lL~~~Ga~vv~  190 (216)
                                             .+...|..+|+.+.+++..+.+.+|++||||||++|||+|+.+++++|+++|++++.
T Consensus        79 ~~la~~l~~p~~~~rk~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~gk~VLlVDDvitTG~Tl~~a~~~L~~~Ga~~V~  158 (190)
T 2dy0_A           79 APVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVAD  158 (190)
T ss_dssp             HHHHHHHTCEEEEEBSTTCCCSCEEEEEEEETTEEEEEEEEGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEE
T ss_pred             HHHHHHHCCCEEEEEecCCCCcccccceehhhcCceEEEEeccccCCcCEEEEEEccccchHHHHHHHHHHHHcCCEEEE
Confidence                                   122233345666667776556679999999999999999999999999999999999


Q ss_pred             EEEEEEccCcccccccC--CCCceeccC
Q 027972          191 CACVIELPELKGRERLG--EKPLFVLVS  216 (216)
Q Consensus       191 vavlie~~~~~g~e~L~--~~pv~sLl~  216 (216)
                      ++|++++.+++|+++|.  ++|+++|++
T Consensus       159 ~~~l~~~~~~~~~~~l~~~g~~v~sl~~  186 (190)
T 2dy0_A          159 AAFIINLFDLGGEQRLEKQGITSYSLVP  186 (190)
T ss_dssp             EEEEEEEGGGCHHHHHHTTTCEEEEEEE
T ss_pred             EEEEEEccCcchHHHHhhCCCcEEEEEE
Confidence            99999999888999996  799999863
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1zn7a1178 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sap 5e-44
d1l1qa_181 c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [Tax 7e-42
d1g2qa_178 c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Sacch 5e-39
d1qb7a_236 c.61.1.1 (A:) Adenine PRTase {Leishmania donovani 4e-32
d1o57a2202 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C 6e-29
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransfer 6e-25
d1y0ba1191 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransfer 3e-23
d1nula_150 c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {E 2e-04
d1vdma1153 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyl 0.003
d1wd5a_208 c.61.1.1 (A:) Putative phosphoribosyltransferase T 0.003
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  143 bits (361), Expect = 5e-44
 Identities = 61/176 (34%), Positives = 87/176 (49%), Gaps = 34/176 (19%)

Query: 75  DPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKD---KNISVVA 131
           D  +  +   IR  PDFP PG++F+DI+ +L D  +FR  I L     K      I  +A
Sbjct: 1   DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIA 60

Query: 132 GE-------------------------------VISEEYSLEYGKDVMEMHVGAVQAGER 160
           G                                 +   YSLEYGK  +E+   A++ G+R
Sbjct: 61  GLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQR 120

Query: 161 ALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLVS 216
            ++VDDL+ATGGT++AA  LL R+   V+EC  ++EL  LKGRE+L   P F L+ 
Sbjct: 121 VVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQ 176
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Length = 181 Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 178 Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Length = 236 Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 202 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 99.98
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 99.97
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.93
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 99.88
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 99.86
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 99.8
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 99.75
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 99.59
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.29
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 98.88
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.83
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.82
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 98.78
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.7
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.64
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.62
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 98.6
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.52
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.5
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.49
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 98.48
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.47
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.47
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.47
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.21
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 97.96
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 97.72
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 97.57
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 97.49
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 97.31
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 97.24
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 97.1
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 96.92
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 86.96
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 80.53
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-34  Score=238.35  Aligned_cols=142  Identities=43%  Similarity=0.791  Sum_probs=130.0

Q ss_pred             chHHHHHHhhcccCCCCCCCCcEEEechhhhcCHHHHHHHHHHHHHHhcC---CCccEEEe-------------------
Q 027972           75 DPRIAGISSAIRVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKD---KNISVVAG-------------------  132 (216)
Q Consensus        75 ~~~~~~l~~~Ir~~PdfPk~Gi~f~Dit~Ll~dP~~~~~l~~~lae~~~~---~~iDvVvG-------------------  132 (216)
                      +++||.|++.||.+||||++||.|+|+++++.||+.++++++.|++++++   .++|+|+|                   
T Consensus         1 ~~~~~~l~~~i~~~pd~P~~Gi~f~Di~~il~~P~~~~~~~~~la~~~~~~~~~~~D~Iv~~e~~Gi~la~~lA~~l~~p   80 (178)
T d1zn7a1           1 DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLG   80 (178)
T ss_dssp             CHHHHHHHTTCEEEETSSSTTCEEEECHHHHHSHHHHHHHHHHHHHHHHHHHTTCCCEEEEETTGGGGTHHHHHHHHTCE
T ss_pred             ChHHHHHHHhccccCCCCCCCCeEEECchhhhCHHHHHHHHHHHHhhhhhhcCCCcceEEEeccccchhhhhhHHHcCCC
Confidence            57899999999999999999999999999999999999999999998864   57999992                   


Q ss_pred             ------------eEEEEeeecccCccceeeecCcccCCCEEEEEeccccccHHHHHHHHHHHHcCCEEEEEEEEEEccCc
Q 027972          133 ------------EVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTLSAAIRLLERVGVHVVECACVIELPEL  200 (216)
Q Consensus       133 ------------~~ia~~y~~eyG~~~l~i~~~~i~~G~rVLIVDDVitTGgTl~aai~lL~~~Ga~vv~vavlie~~~~  200 (216)
                                  ..+...+..+||.+.++++.+.+.+|+||||||||++||+|+.+++++++++||++++++|++++.++
T Consensus        81 ~v~~Rk~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~rVlIVDDviaTGgT~~a~~~ll~~~Ga~vvg~~~ii~~~~~  160 (178)
T d1zn7a1          81 CVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSL  160 (178)
T ss_dssp             EEEEEETTCCCSSEEEEEEEETTEEEEEEEETTSSCTTCEEEEEEEEESSSHHHHHHHHHHHHTTCEEEEEEEEEEEGGG
T ss_pred             ceEeeecCCCCccceeEEeeccccccceeeccCcccCCCeEEEehhhhhhchHHHHHHHHHHHCCCEEEEEEEEEEcCcC
Confidence                        13445667788888889999999999999999999999999999999999999999999999999998


Q ss_pred             ccccccCCCCceeccC
Q 027972          201 KGRERLGEKPLFVLVS  216 (216)
Q Consensus       201 ~g~e~L~~~pv~sLl~  216 (216)
                      +|+++|.++|++||++
T Consensus       161 ~g~~~l~~~pv~SL~~  176 (178)
T d1zn7a1         161 KGREKLAPVPFFSLLQ  176 (178)
T ss_dssp             CHHHHHTTSCEEEEEE
T ss_pred             CHHHhcCCCCeEEEEE
Confidence            9999999999999974
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure