Citrus Sinensis ID: 028038
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 215 | ||||||
| 343887317 | 192 | DNAJ heat shock N-terminal domain-contai | 0.855 | 0.958 | 1.0 | 1e-102 | |
| 225429654 | 214 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.981 | 0.592 | 8e-62 | |
| 449531159 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.958 | 0.932 | 0.566 | 5e-58 | |
| 388500840 | 211 | unknown [Medicago truncatula] | 0.958 | 0.976 | 0.541 | 2e-56 | |
| 357465833 | 211 | DnaJ domain family [Medicago truncatula] | 0.958 | 0.976 | 0.541 | 2e-56 | |
| 449447357 | 176 | PREDICTED: uncharacterized protein LOC10 | 0.706 | 0.863 | 0.677 | 1e-54 | |
| 388498580 | 212 | unknown [Lotus japonicus] | 0.962 | 0.976 | 0.567 | 2e-53 | |
| 356507072 | 215 | PREDICTED: uncharacterized protein LOC10 | 0.958 | 0.958 | 0.584 | 1e-51 | |
| 356514723 | 215 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.953 | 0.572 | 4e-51 | |
| 388494850 | 213 | unknown [Lotus japonicus] gi|388496632|g | 0.972 | 0.981 | 0.562 | 7e-51 |
| >gi|343887317|dbj|BAK61863.1| DNAJ heat shock N-terminal domain-containing protein [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 377 bits (969), Expect = e-102, Method: Compositional matrix adjust.
Identities = 184/184 (100%), Positives = 184/184 (100%)
Query: 1 MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST 60
MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST
Sbjct: 1 MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST 60
Query: 61 EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK 120
EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK
Sbjct: 61 EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK 120
Query: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180
DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT
Sbjct: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180
Query: 181 PPPQ 184
PPPQ
Sbjct: 181 PPPQ 184
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225429654|ref|XP_002281227.1| PREDICTED: uncharacterized protein LOC100257708 [Vitis vinifera] gi|296081705|emb|CBI20710.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449531159|ref|XP_004172555.1| PREDICTED: uncharacterized protein LOC101231129 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388500840|gb|AFK38486.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357465833|ref|XP_003603201.1| DnaJ domain family [Medicago truncatula] gi|355492249|gb|AES73452.1| DnaJ domain family [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449447357|ref|XP_004141435.1| PREDICTED: uncharacterized protein LOC101217656 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388498580|gb|AFK37356.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356507072|ref|XP_003522295.1| PREDICTED: uncharacterized protein LOC100793741 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356514723|ref|XP_003526053.1| PREDICTED: uncharacterized protein LOC100782990 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388494850|gb|AFK35491.1| unknown [Lotus japonicus] gi|388496632|gb|AFK36382.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 215 | ||||||
| TAIR|locus:1005716171 | 218 | NdhU "NADH dehydrogenase-like | 0.879 | 0.866 | 0.465 | 1.4e-41 |
| TAIR|locus:1005716171 NdhU "NADH dehydrogenase-like complex U" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 441 (160.3 bits), Expect = 1.4e-41, P = 1.4e-41
Identities = 93/200 (46%), Positives = 122/200 (61%)
Query: 27 SLLSHSINSY-FPTRPR---KQLT---VRNTGDVSAET----GSTEIEPEARSDPSSLIS 75
S+L H ++ FP +P K++ RN+ +VSAE GS+ EA + SLIS
Sbjct: 19 SVLHHVPSTCSFPWKPTINTKRIICSPARNSSEVSAEAETEGGSSTAVDEAPKESPSLIS 78
Query: 76 ALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDXXXXXXXXXX 135
ALNVERALRG+ ITD DHYGRL + R CS+D+V + YK +++ LK+QGLD
Sbjct: 79 ALNVERALRGLPITDVDHYGRLGIFRNCSYDQVTIGYKERVKELKEQGLDEEQLKTKMDL 138
Query: 136 XXXXXXXXXXXXXXXXXDWSLARTENPDRYVWPFEVDVTQTPKGTPPPQEPEDVGPTRLV 195
DWSLAR+E +RYVWPFEVD+ + + PPPQEPEDVGPTR++
Sbjct: 139 IKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDIMEPSREEPPPQEPEDVGPTRIL 198
Query: 196 GYFMLGWLILSFVLSIALNR 215
GYF+ WL+L LS+A NR
Sbjct: 199 GYFIGAWLVLGVALSVAFNR 218
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.315 0.132 0.393 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 215 188 0.00087 110 3 11 22 0.49 32
31 0.42 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 595 (63 KB)
Total size of DFA: 160 KB (2095 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 19.16u 0.14s 19.30t Elapsed: 00:00:01
Total cpu time: 19.16u 0.14s 19.30t Elapsed: 00:00:01
Start: Tue May 21 03:49:02 2013 End: Tue May 21 03:49:03 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 215 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 8e-09 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-05 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 3e-04 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 5e-04 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 7e-04 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 7e-04 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 0.002 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 0.004 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 49.8 bits (120), Expect = 8e-09
Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (7%)
Query: 92 DHYGRLELRRGCSFDEVALAYKNKLEGLK---DQGLDEEEESKKIKLLKESYSILSSEEE 148
D+Y L + R S +E+ AY+ LK D+ + +K K + E+Y +LS E+
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLA--LKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEK 58
Query: 149 RRLYD 153
R +YD
Sbjct: 59 RAIYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.9 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.87 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.81 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.77 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.76 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.76 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.76 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.76 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.75 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.75 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.73 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.72 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.71 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.71 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.7 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.7 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.7 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.7 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.69 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.69 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.67 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.67 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.66 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.66 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.63 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.61 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.56 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.55 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.53 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.49 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.47 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.46 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.45 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.44 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.37 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.36 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.26 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 99.26 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.23 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.2 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 99.13 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.12 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.86 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.82 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.25 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 97.88 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.18 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.04 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.79 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 95.72 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 91.09 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 89.82 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 88.05 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 86.37 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 82.0 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.9e-24 Score=195.43 Aligned_cols=72 Identities=25% Similarity=0.328 Sum_probs=67.2
Q ss_pred CCCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCC-cHHHHHHHHHHHHHHHHcCChhHHHHHHHHhcccc
Q 028038 89 TDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLD-EEEESKKIKLLKESYSILSSEEERRLYDWSLARTE 160 (215)
Q Consensus 89 ~~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l~~~~ 160 (215)
...|||+||||+++||.+|||+||||||++||||+|+ +++|+++|++|+|||+|||||+||+.||+.-....
T Consensus 2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~ 74 (371)
T COG0484 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGF 74 (371)
T ss_pred CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccc
Confidence 4579999999999999999999999999999999999 89999999999999999999999999997755443
|
|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 215 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 3e-06 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-05 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-05 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-05 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-05 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 4e-05 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 5e-05 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 6e-05 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 7e-05 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 8e-05 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 8e-05 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 8e-05 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 9e-05 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-04 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-04 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-04 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-04 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 2e-04 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 5e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 46.8 bits (110), Expect = 2e-06
Identities = 29/207 (14%), Positives = 57/207 (27%), Gaps = 46/207 (22%)
Query: 16 KNFYTPSPKRNSLL------SHSINSYFPTRPRKQLTVRNTGDVSAETGSTEIEPEARSD 69
+ P N LL + + F + LT R + +T
Sbjct: 235 RRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHH 294
Query: 70 PSSLISALNVERALRGIAITDADHYGRLELRR-GCSFDEVALA--------YKNKLEGLK 120
+L L+ + D L R + + L+ + K
Sbjct: 295 SMTLTPDEVKSLLLKYLDCRPQD------LPREVLTTNPRRLSIIAESIRDGLATWDNWK 348
Query: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180
D K +++ S ++L E R+++ L+ V+P + P
Sbjct: 349 HVNCD-----KLTTIIESSLNVLEPAEYRKMF-DRLS--------VFPPSAHI---PTIL 391
Query: 181 -------PPPQEPEDVGPTRLVGYFML 200
+ V +L Y ++
Sbjct: 392 LSLIWFDVIKSDVMVV-VNKLHKYSLV 417
|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.84 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.84 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.83 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.83 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.83 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.83 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.82 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.82 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.81 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.81 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.8 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.8 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.79 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.79 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.78 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.78 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.75 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.75 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.72 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.7 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.69 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.68 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.67 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.67 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.66 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.65 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.64 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.64 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.64 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.63 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.63 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.55 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.51 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.14 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.49 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.81 |
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.84 E-value=3.5e-21 Score=137.71 Aligned_cols=69 Identities=23% Similarity=0.328 Sum_probs=65.2
Q ss_pred CCCCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCCcHHHHHHHHHHHHHHHHcCChhHHHHHHHHh
Q 028038 88 ITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSL 156 (215)
Q Consensus 88 ~~~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l 156 (215)
....|||+||||+++|+.++||+|||++++++|||++..+.+.+.|++|++||++|+||.+|+.||..+
T Consensus 4 ~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~~ 72 (78)
T 2ctp_A 4 GSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFG 72 (78)
T ss_dssp SCSCCHHHHHTCCTTCCHHHHHHHHHHHHTTSCTTTCSSHHHHHHHHHHHHHHHHHTSHHHHHHHHHTC
T ss_pred CCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHcC
Confidence 345799999999999999999999999999999999988889999999999999999999999999875
|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 215 | ||||
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 1e-06 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 3e-06 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 4e-04 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 0.001 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 0.002 |
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 43.5 bits (102), Expect = 1e-06
Identities = 18/90 (20%), Positives = 35/90 (38%), Gaps = 13/90 (14%)
Query: 71 SSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQ-------G 123
SS S + +E+ L+ D Y L + ++ Y+ +
Sbjct: 2 SSGSSGMALEQTLK------KDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPA 55
Query: 124 LDEEEESKKIKLLKESYSILSSEEERRLYD 153
EE +K + +++ IL +EE ++ YD
Sbjct: 56 GTMEECMQKFIEIDQAWKILGNEETKKKYD 85
|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 215 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.86 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.83 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.76 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.72 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.66 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.63 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.6 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.86 E-value=1.8e-22 Score=142.45 Aligned_cols=67 Identities=25% Similarity=0.342 Sum_probs=62.5
Q ss_pred CCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCC-cHHHHHHHHHHHHHHHHcCChhHHHHHHHHh
Q 028038 90 DADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLD-EEEESKKIKLLKESYSILSSEEERRLYDWSL 156 (215)
Q Consensus 90 ~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l 156 (215)
.+|||+||||+++||.+|||+|||++++.+|||+++ .+.+++.|++|++||+||+||.+|+.||...
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g 69 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 69 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHT
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhC
Confidence 369999999999999999999999999999999987 4677889999999999999999999999863
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|