Citrus Sinensis ID: 028038

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----

MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGSTEIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGTPPPQEPEDVGPTRLVGYFMLGWLILSFVLSIALNR

ccccccccHHHHHccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc

ccEEEccccEEEEcccccccccccccccccccEEEEEccccccEEEEEEcccccccccccccccccccccccHccHHHHHHHHcccccccccHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccEEcccEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc

MAAISSTTATVCIsqknfytpspkrnsllshsinsyfptrprkqltvrntgdvsaetgsteiepearsdpsslISALNVERALRGIAItdadhygrlelrrgcsfDEVALAYKNKLEglkdqgldeEEESKKIKLLKESYSILSSEEERRLYDWSlartenpdryvwpfevdvtqtpkgtpppqepedvgptrlVGYFMLGWLILSFVLSIALNR

maaissttatvcisqknfytpspkrnsLLSHSInsyfptrprkqltvrntgdvsaetgsteiepearsdpssLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKleglkdqgldeeeeskkikllkesysilsseeerrlYDWSLArtenpdryvWPFEVDVtqtpkgtpppqepedvGPTRLVGYFMLGWLILSFVLSIALNR

MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGSTEIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDeeeeskkikllkesysilsseeerrlyDWSLARTENPDRYVWPFEVDVTQTPKGTPPPQEPEDVGPTRLVGYFMLGWLILSFVLSIALNR

**********VCIS***********************************************************ISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKL*********************************RLYDWSLARTENPDRYVWPFEVDV******************TRLVGYFMLGWLILSFVLSIAL**

*****ST*ATVCISQKN************SHSINSY***********************************************RGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGL***EESKKIKLLKESYSILSSEEERRLYDW***********************************GPTRLVGYFMLGWLILSFVLSIALNR

********ATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTV************************SLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQT***********DVGPTRLVGYFMLGWLILSFVLSIALNR

***ISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNT*******************PSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGTPPPQEPEDVGPTRLVGYFMLGWLILSFVLSIALNR

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		215	2.2.26 [Sep-21-2011]
A6Q486		373	Chaperone protein DnaJ OS	yes	no	0.344	0.198	0.407	7e-06
A6QBG7		377	Chaperone protein DnaJ OS	yes	no	0.306	0.175	0.358	0.0003

>sp\|A6Q486\|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1	Back alignment and function desciption

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 88  ITDADHYGRLELRRGCSFDEVALAYKN-KLEGLKDQGLDEEEESKKIKLLKESYSILSSE 146
           + D D+Y  LE+ R  SF+E+  AY+   L+   D+  D  E  +K KL+ E+Y +LS E
Sbjct: 1   MVDIDYYELLEVDRNASFEEIKKAYRKLALKYHPDRNPDNPEAEEKFKLINEAYQVLSDE 60

Query: 147 EERRLYD-WSLARTEN 161
           E+R LYD +  A  EN
Sbjct: 61  EKRALYDQYGKAGLEN 76

Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Nitratiruptor sp. (strain SB155-2) (taxid: 387092)

>sp\|A6QBG7\|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		215
343887317		192	DNAJ heat shock N-terminal domain-contai	0.855	0.958	1.0	1e-102
225429654		214	PREDICTED: uncharacterized protein LOC10	0.976	0.981	0.592	8e-62
449531159		221	PREDICTED: uncharacterized protein LOC10	0.958	0.932	0.566	5e-58
388500840		211	unknown [Medicago truncatula]	0.958	0.976	0.541	2e-56
357465833		211	DnaJ domain family [Medicago truncatula]	0.958	0.976	0.541	2e-56
449447357		176	PREDICTED: uncharacterized protein LOC10	0.706	0.863	0.677	1e-54
388498580		212	unknown [Lotus japonicus]	0.962	0.976	0.567	2e-53
356507072		215	PREDICTED: uncharacterized protein LOC10	0.958	0.958	0.584	1e-51
356514723		215	PREDICTED: uncharacterized protein LOC10	0.953	0.953	0.572	4e-51
388494850		213	unknown [Lotus japonicus] gi\|388496632\|g	0.972	0.981	0.562	7e-51

>gi\|343887317\|dbj\|BAK61863.1\| DNAJ heat shock N-terminal domain-containing protein [Citrus unshiu]	Back alignment and taxonomy information

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST 60
           MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST
Sbjct: 1   MAAISSTTATVCISQKNFYTPSPKRNSLLSHSINSYFPTRPRKQLTVRNTGDVSAETGST 60

Query: 61  EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK 120
           EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK
Sbjct: 61  EIEPEARSDPSSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLK 120

Query: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180
           DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT
Sbjct: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180

Query: 181 PPPQ 184
           PPPQ
Sbjct: 181 PPPQ 184

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225429654\|ref\|XP_002281227.1\| PREDICTED: uncharacterized protein LOC100257708 [Vitis vinifera] gi\|296081705\|emb\|CBI20710.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449531159\|ref\|XP_004172555.1\| PREDICTED: uncharacterized protein LOC101231129 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|388500840\|gb\|AFK38486.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357465833\|ref\|XP_003603201.1\| DnaJ domain family [Medicago truncatula] gi\|355492249\|gb\|AES73452.1\| DnaJ domain family [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449447357\|ref\|XP_004141435.1\| PREDICTED: uncharacterized protein LOC101217656 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|388498580\|gb\|AFK37356.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

>gi\|356507072\|ref\|XP_003522295.1\| PREDICTED: uncharacterized protein LOC100793741 [Glycine max]	Back alignment and taxonomy information

>gi\|356514723\|ref\|XP_003526053.1\| PREDICTED: uncharacterized protein LOC100782990 [Glycine max]	Back alignment and taxonomy information

>gi\|388494850\|gb\|AFK35491.1\| unknown [Lotus japonicus] gi\|388496632\|gb\|AFK36382.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		215
TAIR\|locus:1005716171		218	NdhU "NADH dehydrogenase-like	0.879	0.866	0.465	1.4e-41

TAIR\|locus:1005716171 NdhU "NADH dehydrogenase-like complex U" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 441 (160.3 bits), Expect = 1.4e-41, P = 1.4e-41
 Identities = 93/200 (46%), Positives = 122/200 (61%)

Query:    27 SLLSHSINSY-FPTRPR---KQLT---VRNTGDVSAET----GSTEIEPEARSDPSSLIS 75
             S+L H  ++  FP +P    K++     RN+ +VSAE     GS+    EA  +  SLIS
Sbjct:    19 SVLHHVPSTCSFPWKPTINTKRIICSPARNSSEVSAEAETEGGSSTAVDEAPKESPSLIS 78

Query:    76 ALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDXXXXXXXXXX 135
             ALNVERALRG+ ITD DHYGRL + R CS+D+V + YK +++ LK+QGLD          
Sbjct:    79 ALNVERALRGLPITDVDHYGRLGIFRNCSYDQVTIGYKERVKELKEQGLDEEQLKTKMDL 138

Query:   136 XXXXXXXXXXXXXXXXXDWSLARTENPDRYVWPFEVDVTQTPKGTPPPQEPEDVGPTRLV 195
                              DWSLAR+E  +RYVWPFEVD+ +  +  PPPQEPEDVGPTR++
Sbjct:   139 IKESYTILSTVEERRMYDWSLARSEKAERYVWPFEVDIMEPSREEPPPQEPEDVGPTRIL 198

Query:   196 GYFMLGWLILSFVLSIALNR 215
             GYF+  WL+L   LS+A NR
Sbjct:   199 GYFIGAWLVLGVALSVAFNR 218


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.315   0.132   0.393    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      215       188   0.00087  110 3  11 22  0.49    32
                                                     31  0.42    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  595 (63 KB)
  Total size of DFA:  160 KB (2095 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  19.16u 0.14s 19.30t   Elapsed:  00:00:01
  Total cpu time:  19.16u 0.14s 19.30t   Elapsed:  00:00:01
  Start:  Tue May 21 03:49:02 2013   End:  Tue May 21 03:49:03 2013

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0031072 "heat shock protein binding" evidence=IEA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		215
pfam00226		63	pfam00226, DnaJ, DnaJ domain	8e-09
PTZ00037		421	PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov	2e-05
PRK14281		397	PRK14281, PRK14281, chaperone protein DnaJ; Provis	2e-04
PRK14284		391	PRK14284, PRK14284, chaperone protein DnaJ; Provis	3e-04
smart00271		60	smart00271, DnaJ, DnaJ molecular chaperone homolog	5e-04
COG0484		371	COG0484, DnaJ, DnaJ-class molecular chaperone with	7e-04
cd06257		55	cd06257, DnaJ, DnaJ domain or J-domain	7e-04
PRK10767		371	PRK10767, PRK10767, chaperone protein DnaJ; Provis	0.001
PRK14283		378	PRK14283, PRK14283, chaperone protein DnaJ; Provis	0.001
PRK14297		380	PRK14297, PRK14297, chaperone protein DnaJ; Provis	0.002
PRK14299		291	PRK14299, PRK14299, chaperone protein DnaJ; Provis	0.004

>gnl\|CDD\|215804 pfam00226, DnaJ, DnaJ domain	Back alignment and domain information

 Score = 49.8 bits (120), Expect = 8e-09
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 92  DHYGRLELRRGCSFDEVALAYKNKLEGLK---DQGLDEEEESKKIKLLKESYSILSSEEE 148
           D+Y  L + R  S +E+  AY+     LK   D+   +    +K K + E+Y +LS  E+
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLA--LKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEK 58

Query: 149 RRLYD 153
           R +YD
Sbjct: 59  RAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63

>gnl\|CDD\|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain	Back alignment and domain information

>gnl\|CDD\|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|99751 cd06257, DnaJ, DnaJ domain or J-domain	Back alignment and domain information

>gnl\|CDD\|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional	Back alignment and domain information

>gnl\|CDD\|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		215
COG0484		371	DnaJ DnaJ-class molecular chaperone with C-termina	99.9
KOG0713		336	consensus Molecular chaperone (DnaJ superfamily) [	99.87
PRK14288		369	chaperone protein DnaJ; Provisional	99.82
PRK14296		372	chaperone protein DnaJ; Provisional	99.81
KOG0712		337	consensus Molecular chaperone (DnaJ superfamily) [	99.79
PRK14279		392	chaperone protein DnaJ; Provisional	99.79
PRK14286		372	chaperone protein DnaJ; Provisional	99.78
PRK14287		371	chaperone protein DnaJ; Provisional	99.77
PRK14299		291	chaperone protein DnaJ; Provisional	99.77
PRK14283		378	chaperone protein DnaJ; Provisional	99.77
PRK14276		380	chaperone protein DnaJ; Provisional	99.76
PF00226		64	DnaJ: DnaJ domain; InterPro: IPR001623 The prokary	99.76
PRK14282		369	chaperone protein DnaJ; Provisional	99.76
PRK14298		377	chaperone protein DnaJ; Provisional	99.76
PTZ00037		421	DnaJ_C chaperone protein; Provisional	99.76
PRK14278		378	chaperone protein DnaJ; Provisional	99.76
PRK14291		382	chaperone protein DnaJ; Provisional	99.75
KOG0715		288	consensus Molecular chaperone (DnaJ superfamily) [	99.75
PRK14280		376	chaperone protein DnaJ; Provisional	99.75
PRK14277		386	chaperone protein DnaJ; Provisional	99.75
PRK14295		389	chaperone protein DnaJ; Provisional	99.75
PRK14285		365	chaperone protein DnaJ; Provisional	99.74
PRK14294		366	chaperone protein DnaJ; Provisional	99.74
PRK14284		391	chaperone protein DnaJ; Provisional	99.73
PRK14297		380	chaperone protein DnaJ; Provisional	99.73
PRK14301		373	chaperone protein DnaJ; Provisional	99.73
PRK10767		371	chaperone protein DnaJ; Provisional	99.72
KOG0691		296	consensus Molecular chaperone (DnaJ superfamily) [	99.72
KOG0716		279	consensus Molecular chaperone (DnaJ superfamily) [	99.72
KOG0717		508	consensus Molecular chaperone (DnaJ superfamily) [	99.72
PRK14281		397	chaperone protein DnaJ; Provisional	99.71
TIGR02349		354	DnaJ_bact chaperone protein DnaJ. This model repre	99.71
PRK10266		306	curved DNA-binding protein CbpA; Provisional	99.7
PRK14300		372	chaperone protein DnaJ; Provisional	99.7
PRK14292		371	chaperone protein DnaJ; Provisional	99.7
PRK14289		386	chaperone protein DnaJ; Provisional	99.7
PRK14293		374	chaperone protein DnaJ; Provisional	99.69
PRK14290		365	chaperone protein DnaJ; Provisional	99.69
KOG0718		546	consensus Molecular chaperone (DnaJ superfamily) [	99.67
PTZ00341		1136	Ring-infected erythrocyte surface antigen; Provisi	99.67
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	99.66
smart00271		60	DnaJ DnaJ molecular chaperone homology domain.	99.66
KOG0719		264	consensus Molecular chaperone (DnaJ superfamily) [	99.65
cd06257		55	DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho	99.63
COG2214		237	CbpA DnaJ-class molecular chaperone [Posttranslati	99.61
TIGR03835		871	termin_org_DnaJ terminal organelle assembly protei	99.56
KOG0720		490	consensus Molecular chaperone (DnaJ superfamily) [	99.55
KOG0721		230	consensus Molecular chaperone (DnaJ superfamily) [	99.53
KOG0722		329	consensus Molecular chaperone (DnaJ superfamily) [	99.49
PHA03102		153	Small T antigen; Reviewed	99.47
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	99.46
PRK05014		171	hscB co-chaperone HscB; Provisional	99.45
PRK01356		166	hscB co-chaperone HscB; Provisional	99.44
PRK00294		173	hscB co-chaperone HscB; Provisional	99.38
PRK03578		176	hscB co-chaperone HscB; Provisional	99.37
KOG0714		306	consensus Molecular chaperone (DnaJ superfamily) [	99.36
PRK09430		267	djlA Dna-J like membrane chaperone protein; Provis	99.26
KOG1150		250	consensus Predicted molecular chaperone (DnaJ supe	99.26
PTZ00100		116	DnaJ chaperone protein; Provisional	99.23
PHA02624		647	large T antigen; Provisional	99.2
COG5269		379	ZUO1 Ribosome-associated chaperone zuotin [Transla	99.13
COG5407		610	SEC63 Preprotein translocase subunit Sec63 [Intrac	99.12
TIGR00714		157	hscB Fe-S protein assembly co-chaperone HscB. This	98.86
PRK01773		173	hscB co-chaperone HscB; Provisional	98.82
KOG0568		342	consensus Molecular chaperone (DnaJ superfamily) [	98.25
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	97.88
KOG0723		112	consensus Molecular chaperone (DnaJ superfamily) [	97.18
COG1076		174	DjlA DnaJ-domain-containing proteins 1 [Posttransl	96.04
KOG0431		453	consensus Auxilin-like protein and related protein	95.79
KOG3192		168	consensus Mitochondrial J-type chaperone [Posttran	95.72
PF13446		62	RPT: A repeated domain in UCH-protein	91.09
COG1076		174	DjlA DnaJ-domain-containing proteins 1 [Posttransl	89.82
KOG0724		335	consensus Zuotin and related molecular chaperones	88.05
PF11833		194	DUF3353: Protein of unknown function (DUF3353); In	86.37
PF03656		127	Pam16: Pam16; InterPro: IPR005341 The Pam16 protei	82.0

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.90  E-value=1.9e-24  Score=195.43  Aligned_cols=72  Identities=25%  Similarity=0.328  Sum_probs=67.2

Q ss_pred             CCCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCC-cHHHHHHHHHHHHHHHHcCChhHHHHHHHHhcccc
Q 028038           89 TDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLD-EEEESKKIKLLKESYSILSSEEERRLYDWSLARTE  160 (215)
Q Consensus        89 ~~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l~~~~  160 (215)
                      ...|||+||||+++||.+|||+||||||++||||+|+ +++|+++|++|+|||+|||||+||+.||+.-....
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~   74 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGF   74 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccc
Confidence            4579999999999999999999999999999999999 89999999999999999999999999997755443

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14288 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14296 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14279 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14286 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14287 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14299 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14283 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14276 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []	Back alignment and domain information

>PRK14282 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14298 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PTZ00037 DnaJ_C chaperone protein; Provisional	Back alignment and domain information

>PRK14278 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14291 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14280 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14277 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14295 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14285 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14294 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14284 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14297 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14301 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK10767 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14281 chaperone protein DnaJ; Provisional	Back alignment and domain information

>TIGR02349 DnaJ_bact chaperone protein DnaJ	Back alignment and domain information

>PRK10266 curved DNA-binding protein CbpA; Provisional	Back alignment and domain information

>PRK14300 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14292 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14289 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14293 chaperone protein DnaJ; Provisional	Back alignment and domain information

>PRK14290 chaperone protein DnaJ; Provisional	Back alignment and domain information

>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>smart00271 DnaJ DnaJ molecular chaperone homology domain	Back alignment and domain information

>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd06257 DnaJ DnaJ domain or J-domain	Back alignment and domain information

>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ	Back alignment and domain information

>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA03102 Small T antigen; Reviewed	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05014 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>PRK01356 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>PRK00294 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>PRK03578 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional	Back alignment and domain information

>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00100 DnaJ chaperone protein; Provisional	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB	Back alignment and domain information

>PRK01773 hscB co-chaperone HscB; Provisional	Back alignment and domain information

>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only]	Back alignment and domain information

>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13446 RPT: A repeated domain in UCH-protein	Back alignment and domain information

>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised	Back alignment and domain information

>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) []	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		215
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
2ctw_A		109	DNAJ homolog subfamily C member 5; J-domain, chape	3e-06
2l6l_A		155	DNAJ homolog subfamily C member 24; DPH4, Zn-CSL,	2e-05
2dn9_A		79	DNAJ homolog subfamily A member 3; J-domain, TID1,	2e-05
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	3e-05
2cug_A		88	Mkiaa0962 protein; DNAJ-like domain, structural ge	3e-05
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	4e-05
2och_A		73	Hypothetical protein DNJ-12; HSP40, J-domain, chap	4e-05
1hdj_A		77	Human HSP40, HDJ-1; molecular chaperone; NMR {Homo	5e-05
2pf4_E		174	Small T antigen; PP2A, SV40, DNAJ, aalpha subunit,	6e-05
2ctq_A		112	DNAJ homolog subfamily C member 12; J-domain, chap	7e-05
2o37_A		92	Protein SIS1; HSP40, J-domain, cochaperone, APC900	8e-05
1bq0_A		103	DNAJ, HSP40; chaperone, heat shock, protein foldin	8e-05
2lgw_A		99	DNAJ homolog subfamily B member 2; J domain, HSJ1A	8e-05
2ej7_A		82	HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati	9e-05
2ctp_A		78	DNAJ homolog subfamily B member 12; J-domain, chap	1e-04
2yua_A		99	Williams-beuren syndrome chromosome region 18 prot	1e-04
2ctr_A		88	DNAJ homolog subfamily B member 9; J-domain, chape	1e-04
1wjz_A		94	1700030A21RIK protein; J-domain, DNAJ like protein	2e-04
2dmx_A		92	DNAJ homolog subfamily B member 8; DNAJ J domain,	2e-04
1gh6_A		114	Large T antigen; tumor suppressor, oncoprotein, an	5e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 46.8 bits (110), Expect = 2e-06
 Identities = 29/207 (14%), Positives = 57/207 (27%), Gaps = 46/207 (22%)

Query: 16  KNFYTPSPKRNSLL------SHSINSYFPTRPRKQLTVRNTGDVSAETGSTEIEPEARSD 69
           +      P  N LL      +    + F    +  LT R        + +T         
Sbjct: 235 RRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHH 294

Query: 70  PSSLISALNVERALRGIAITDADHYGRLELRR-GCSFDEVALA--------YKNKLEGLK 120
             +L         L+ +     D      L R   + +   L+             +  K
Sbjct: 295 SMTLTPDEVKSLLLKYLDCRPQD------LPREVLTTNPRRLSIIAESIRDGLATWDNWK 348

Query: 121 DQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSLARTENPDRYVWPFEVDVTQTPKGT 180
               D     K   +++ S ++L   E R+++   L+        V+P    +   P   
Sbjct: 349 HVNCD-----KLTTIIESSLNVLEPAEYRKMF-DRLS--------VFPPSAHI---PTIL 391

Query: 181 -------PPPQEPEDVGPTRLVGYFML 200
                      +   V   +L  Y ++
Sbjct: 392 LSLIWFDVIKSDVMVV-VNKLHKYSLV 417

PyMOL of 1vt4

>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109	Back alignment and structure

>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155	Back alignment and structure

>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210	Back alignment and structure

>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73	Back alignment and structure

>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77	Back alignment and structure

>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174	Back alignment and structure

>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112	Back alignment and structure

>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92	Back alignment and structure

>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103	Back alignment and structure

>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82	Back alignment and structure

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78	Back alignment and structure

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99	Back alignment and structure

>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94	Back alignment and structure

>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		215
2ctp_A		78	DNAJ homolog subfamily B member 12; J-domain, chap	99.84
1wjz_A		94	1700030A21RIK protein; J-domain, DNAJ like protein	99.84
1hdj_A		77	Human HSP40, HDJ-1; molecular chaperone; NMR {Homo	99.83
2ctr_A		88	DNAJ homolog subfamily B member 9; J-domain, chape	99.83
2yua_A		99	Williams-beuren syndrome chromosome region 18 prot	99.83
2cug_A		88	Mkiaa0962 protein; DNAJ-like domain, structural ge	99.83
2dn9_A		79	DNAJ homolog subfamily A member 3; J-domain, TID1,	99.82
2ctq_A		112	DNAJ homolog subfamily C member 12; J-domain, chap	99.82
2ej7_A		82	HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati	99.81
2och_A		73	Hypothetical protein DNJ-12; HSP40, J-domain, chap	99.81
2ctw_A		109	DNAJ homolog subfamily C member 5; J-domain, chape	99.8
2lgw_A		99	DNAJ homolog subfamily B member 2; J domain, HSJ1A	99.8
2qsa_A		109	DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s	99.79
2dmx_A		92	DNAJ homolog subfamily B member 8; DNAJ J domain,	99.79
2o37_A		92	Protein SIS1; HSP40, J-domain, cochaperone, APC900	99.78
1bq0_A		103	DNAJ, HSP40; chaperone, heat shock, protein foldin	99.78
2l6l_A		155	DNAJ homolog subfamily C member 24; DPH4, Zn-CSL,	99.75
2ys8_A		90	RAB-related GTP-binding protein RABJ; DNAJ domain,	99.75
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	99.72
3lz8_A		329	Putative chaperone DNAJ; structure genomics, struc	99.7
3hho_A		174	CO-chaperone protein HSCB homolog; structural geno	99.69
1fpo_A		171	HSC20, chaperone protein HSCB; molecular chaperone	99.68
1gh6_A		114	Large T antigen; tumor suppressor, oncoprotein, an	99.67
1n4c_A		182	Auxilin; four helix bundle, protein binding; NMR {	99.67
1iur_A		88	KIAA0730 protein; DNAJ like domain, riken structur	99.66
3bvo_A		207	CO-chaperone protein HSCB, mitochondrial precurso;	99.65
1faf_A		79	Large T antigen; J domain, HPD motif, anti-paralle	99.64
3ag7_A		106	Putative uncharacterized protein F9E10.5; J-domain	99.64
2qwo_B		92	Putative tyrosine-protein phosphatase auxilin; cha	99.64
2pf4_E		174	Small T antigen; PP2A, SV40, DNAJ, aalpha subunit,	99.63
3uo3_A		181	J-type CO-chaperone JAC1, mitochondrial; structura	99.63
2guz_A		71	Mitochondrial import inner membrane translocase su	99.55
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	99.51
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.14
2guz_B		65	Mitochondrial import inner membrane translocase su	98.49
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	93.81

>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

Probab=99.84  E-value=3.5e-21  Score=137.71  Aligned_cols=69  Identities=23%  Similarity=0.328  Sum_probs=65.2

Q ss_pred             CCCCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCCcHHHHHHHHHHHHHHHHcCChhHHHHHHHHh
Q 028038           88 ITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLDEEEESKKIKLLKESYSILSSEEERRLYDWSL  156 (215)
Q Consensus        88 ~~~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l  156 (215)
                      ....|||+||||+++|+.++||+|||++++++|||++..+.+.+.|++|++||++|+||.+|+.||..+
T Consensus         4 ~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~~   72 (78)
T 2ctp_A            4 GSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFG   72 (78)
T ss_dssp             SCSCCHHHHHTCCTTCCHHHHHHHHHHHHTTSCTTTCSSHHHHHHHHHHHHHHHHHTSHHHHHHHHHTC
T ss_pred             CCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHcC
Confidence            345799999999999999999999999999999999988889999999999999999999999999875

PyMOL of 2ctp

>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1	Back alignment and structure

>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1	Back alignment and structure

>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A	Back alignment and structure

>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans}	Back alignment and structure

>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae}	Back alignment and structure

>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A	Back alignment and structure

>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus}	Back alignment and structure

>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A	Back alignment and structure

>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1	Back alignment and structure

>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1	Back alignment and structure

>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J	Back alignment and structure

>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1	Back alignment and structure

>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens}	Back alignment and structure

>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1	Back alignment and structure

>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A	Back alignment and structure

>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C	Back alignment and structure

>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A	Back alignment and structure

>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		215
d1wjza_		94	a.2.3.1 (A:) CSL-type zinc finger-containing prote	1e-06
d1xbla_		75	a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain	3e-06
d1hdja_		77	a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9	4e-04
d1nz6a_		98	a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T	0.001
d1fpoa1		76	a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma	0.002

>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94	Back information, alignment and structure


class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 43.5 bits (102), Expect = 1e-06
 Identities = 18/90 (20%), Positives = 35/90 (38%), Gaps = 13/90 (14%)

Query: 71  SSLISALNVERALRGIAITDADHYGRLELRRGCSFDEVALAYKNKLEGLKDQ-------G 123
           SS  S + +E+ L+       D Y  L      +  ++   Y+  +              
Sbjct: 2   SSGSSGMALEQTLK------KDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPA 55

Query: 124 LDEEEESKKIKLLKESYSILSSEEERRLYD 153
              EE  +K   + +++ IL +EE ++ YD
Sbjct: 56  GTMEECMQKFIEIDQAWKILGNEETKKKYD 85

PyMOL of d1wjza_

>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75	Back information, alignment and structure

>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77	Back information, alignment and structure

>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98	Back information, alignment and structure

>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		215
d1xbla_		75	DnaJ chaperone, N-terminal (J) domain {Escherichia	99.86
d1hdja_		77	HSP40 {Human (Homo sapiens) [TaxId: 9606]}	99.84
d1wjza_		94	CSL-type zinc finger-containing protein 3 (J-domai	99.83
d1gh6a_		114	Large T antigen, the N-terminal J domain {Simian v	99.76
d1fpoa1		76	HSC20 (HSCB), N-terminal (J) domain {Escherichia c	99.72
d1fafa_		79	Large T antigen, the N-terminal J domain {Murine p	99.66
d1nz6a_		98	Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}	99.63
d1iura_		88	Hypothetical protein KIAA0730 {Human (Homo sapiens	99.6

>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=1.8e-22  Score=142.45  Aligned_cols=67  Identities=25%  Similarity=0.342  Sum_probs=62.5

Q ss_pred             CCCcccccCcCCCCCHHHHHHHHHHHHhcCCCCCCC-cHHHHHHHHHHHHHHHHcCChhHHHHHHHHh
Q 028038           90 DADHYGRLELRRGCSFDEVALAYKNKLEGLKDQGLD-EEEESKKIKLLKESYSILSSEEERRLYDWSL  156 (215)
Q Consensus        90 ~~d~Y~vLgv~~~As~~eIk~AYrkla~~~hpd~~~-~~~a~~~f~~i~~Ay~vLsdp~~R~~YD~~l  156 (215)
                      .+|||+||||+++||.+|||+|||++++.+|||+++ .+.+++.|++|++||+||+||.+|+.||...
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g   69 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG   69 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhC
Confidence            369999999999999999999999999999999987 4677889999999999999999999999863

PyMOL of d1xbla_

>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}	Back information, alignment and structure

>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}	Back information, alignment and structure

>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure